Protein Family IF01889

Metagenome Isolate
139 Members
63 Samples
123 Scaffolds
238.15 Avg Length

🧬 Representative Sequence

ID
3300007190|Ga0103267_1000536|Ga0103267_10005362
Length
272 aa
Sequence
VDTFTHTEKRFPHEKIKFAPENEIIKRYTTKQPKFMGRAFEYRRAAKEKRWDKMSRIFPRLGKAITMAAKEGGQDPDTNAALRTAIKNAKAQNMPKDNIDAAIKRATSKDAEAYAEINYEGKGPHGVLVFVECATDNPNRTVANVKSYFNKAGGSIVPNGSLDFMFNRKAVFEFEKTEQIDTEELELELIDAGLEEIENVEETIFVYGDYTAFGSLSEALEKLNIDVKKSNLQRIPTSPVEFSEEQLVDIEKMLDKIEDDDDIQQVFTNIA*

📊 Sample Types

Isolate 11.5%
Metagenome 88.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 21.0%
Kalotermitidae 17.7%
Unclassified 16.1%
Formicidae 14.5%
Blattidae 9.7%
Drosophilidae 6.5%
Termopsidae 3.2%
Rhinotermitidae 3.2%
Tenebrionidae 3.2%
Passalidae 1.6%
Hodotermitidae 1.6%
Kiwaidae 1.6%

🌳 Taxonomy

Archaea 0
Bacteria 121
Eukaryota 0
Viruses 0
Unclassified 18

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820750388 Unclassified Bacteroidetes Nt197P3bin50 Isolate Unclassified
2 2820751898 Unclassified Bacteroidetes Nc150P4bin22 Isolate Unclassified
3 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
4 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
5 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
6 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
7 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
8 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
9 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Formicidae
10 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
11 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
12 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
13 3300007150 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut Metagenome Drosophilidae
14 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
15 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
16 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
17 2609459943 Bacteroides reticulotermitis JCM 10512 Isolate Rhinotermitidae
18 2695420314 Dysgonomonas sp. BGC7 Isolate Unclassified
19 2870004507 Campylobacter coli 14983A Isolate Unclassified
20 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
21 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
22 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
23 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
24 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
25 2820789850 Unclassified Bacteroidetes Cu122P3bin3 Isolate Unclassified
26 2830041218 Bacteroides reticulotermitis DSM 105720 Isolate Unclassified
27 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
28 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
29 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
30 3300005307 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 1 gut Metagenome Drosophilidae
31 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
32 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
33 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
34 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
35 2627854132 Campylobacter peloridis LMG 23910 Isolate Unclassified
36 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
37 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
38 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
39 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
40 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
41 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
42 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
43 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
44 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
45 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
46 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
47 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
48 3004677695 Bacteroides sp. 214 Isolate Blattidae
49 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Formicidae
50 3300007139 Ant gut microbial communities from Cephalotes pellans, Brazil Metagenome Formicidae
51 3300007733 Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean Metagenome
52 3300013007 Symbiotic microbial communities associated with the hydrothermal yeti crab kiwa sp. n. from the East Pacific Rise in the East Pacific Ocean - crab 1, guts Metagenome Kiwaidae
53 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
54 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
55 2899132286 Myroides albus BIT-d1 Isolate Tenebrionidae
56 2922326829 Bacteroides sp. 224 Isolate Blattidae
57 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
58 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
59 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
60 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
61 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
62 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
63 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 JGI24702J35022_10025819 3300002462 Bacteria 3167
2 Ga0104048_1003069 3300007143 Bacteria 9543
3 Ga0103268_1000155 3300007192 Bacteria 22376
4 Ga0123357_10000340 3300009784 Bacteria 44197
5 Ga0466711_133919 3300042615 Unclassified 3199
6 Ga0466715_246897 3300042616 Bacteria 37494
7 Ga0466706_061662 3300042599 Bacteria 7672
8 Ga0466713_146264 3300042602 Bacteria 1701
9 Ga0466714_007872 3300042603 Unclassified 2888
10 Ga0466714_043034 3300042603 Unclassified 1419
11 Ga0466714_126151 3300042603 Bacteria 4932
12 Ga0466709_060234 3300042648 Bacteria 2458
13 Ga0466690_158733 3300042590 Bacteria 2643
14 Ga0466696_025646 3300042596 Bacteria 6797
15 Ga0466696_180685 3300042596 Bacteria 38837
16 Ga0466701_003736 3300042598 Bacteria 61016
17 Ga0466733_026339 3300042659 Bacteria 1581
18 CVPL010W_10005250 3300002931 Bacteria 13940
19 Ga0102739_1000267 3300007095 Bacteria 12363
20 Ga0105524_100415 3300007733 Bacteria 20497
21 Ga0466728_181221 3300042620 Bacteria 31399
22 Ga0466701_058067 3300042598 Bacteria 74144
23 Ga0466706_011591 3300042599 Bacteria 14693
24 Ga0466706_036123 3300042599 Bacteria 40157
25 Ga0466706_059283 3300042599 Bacteria 2416
26 Ga0466706_198060 3300042599 Bacteria 17980
27 Ga0466706_265268 3300042599 Bacteria 15915
28 Ga0466713_010388 3300042602 Bacteria 14180
29 Ga0466714_012360 3300042603 Bacteria 1156
30 Ga0466714_125806 3300042603 Bacteria 34866
31 Ga0466722_252268 3300042609 Bacteria 10996
32 Ga0466703_048013 3300042636 Bacteria 219350
33 Ga0466733_032988 3300042659 Bacteria 33257
34 Ga0466733_079531 3300042659 Unclassified 1082
35 JGI24702J35022_10177033 3300002462 Bacteria 1210
36 Ga0103266_1000353 3300007067 Bacteria 17634
37 Ga0103260_1000027 3300007139 Bacteria 71480
38 Ga0103267_1000391 3300007190 Bacteria 14813
39 Ga0466711_069689 3300042615 Unclassified 14407
40 Ga0466723_142663 3300042618 Bacteria 4548
41 Ga0466723_160704 3300042618 Bacteria 10736
42 Ga0466723_183938 3300042618 Bacteria 8946
43 Ga0466726_044927 3300042619 Bacteria 2853
44 Ga0466728_138908 3300042620 Bacteria 9000
45 Ga0466706_050067 3300042599 Bacteria 35562
46 Ga0466706_112779 3300042599 Bacteria 11684
47 Ga0466716_080663 3300042605 Bacteria 7562
48 Ga0466709_167096 3300042648 Bacteria 11219
49 Ga0466724_31268 3300042649 Bacteria 225286
50 Ga0157631_137297 3300013007 Bacteria 1162
51 Ga0466694_042143 3300042594 Bacteria 1845
52 Ga0466733_051324 3300042659 Bacteria 11325
53 Ga0466733_112768 3300042659 Bacteria 26659
54 Ga0466733_168571 3300042659 Bacteria 14566
55 IMNBL1DRAFT_c0012144 3300000062 Bacteria 3959
56 Ga0102740_1000054 3300007140 Unclassified 27264
57 Ga0103267_1000009 3300007190 Bacteria 74171
58 Ga0466711_340423 3300042615 Bacteria 2398
59 Ga0466706_062384 3300042599 Bacteria 15309
60 Ga0466707_269285 3300042601 Bacteria 5262
61 Ga0466714_018806 3300042603 Unclassified 1281
62 Ga0157631_112872 3300013007 Bacteria 1447
63 Ga0157631_136737 3300013007 Bacteria 5847
64 Ga0466696_005041 3300042596 Bacteria 9500
65 Ga0123356_10058663 3300010049 Bacteria 3590
66 Ga0123353_10668216 3300010167 Bacteria 1466
67 Ga0466733_035462 3300042659 Bacteria 10854
68 Ga0466733_045198 3300042659 Bacteria 4949
69 Ga0466733_105174 3300042659 Bacteria 3256
70 Ga0562377_0004 3300056842 Bacteria 3525959
71 Ga0074308_1113691 3300005307 Bacteria 2861
72 Ga0104048_1000738 3300007143 Bacteria 3444
73 Ga0103267_1000536 3300007190 Bacteria 12024
74 Ga0105524_104928 3300007733 Bacteria 3554
75 Ga0105524_105787 3300007733 Bacteria 1269
76 Ga0466706_104447 3300042599 Unclassified 3251
77 Ga0466706_217250 3300042599 Bacteria 41329
78 Ga0466706_256901 3300042599 Bacteria 3639
79 Ga0466716_508727 3300042605 Bacteria 29958
80 Ga0466690_077896 3300042590 Bacteria 14270
81 Ga0466696_116170 3300042596 Bacteria 3975
82 Ga0466701_011125 3300042598 Bacteria 31883
83 Ga0466732_096678 3300042656 Bacteria 23115
84 Ga0466732_447361 3300042656 Bacteria 66921
85 Ga0466733_218682 3300042659 Bacteria 17098
86 Ga0068305_10378891 3300005083 Bacteria 1740
87 Ga0104045_1026361 3300007085 Unclassified 3819
88 Ga0104048_1175526 3300007143 Bacteria 1048
89 Ga0103268_1001214 3300007192 Bacteria 6625
90 Ga0466706_021280 3300042599 Bacteria 24208
91 Ga0466714_125354 3300042603 Unclassified 5370
92 Ga0466709_136725 3300042648 Unclassified 21180
93 Ga0466708_305107 3300042652 Bacteria 23468
94 Ga0466657_387007 3300042582 Bacteria 76676
95 Ga0123354_10049157 3300010882 Bacteria 6400
96 Ga0123354_10244638 3300010882 Bacteria 1835
97 Ga0466733_187687 3300042659 Bacteria 3397
98 Ga0104045_1005006 3300007085 Bacteria 3120
99 Ga0466726_171597 3300042619 Bacteria 6067
100 Ga0466728_398132 3300042620 Bacteria 32620
101 Ga0466706_017256 3300042599 Unclassified 2020
102 Ga0466706_114796 3300042599 Bacteria 4102
103 Ga0466714_138691 3300042603 Unclassified 1352
104 Ga0466714_142339 3300042603 Unclassified 3458
105 Ga0466719_042388 3300042606 Bacteria 6529
106 Ga0466703_282847 3300042636 Bacteria 34480
107 Ga0157631_100610 3300013007 Bacteria 2444
108 Ga0466690_008835 3300042590 Bacteria 27085
109 Ga0466733_016851 3300042659 Bacteria 20196
110 Ga0466733_073117 3300042659 Bacteria 5276
111 CVPL005W_1000145 3300002934 Bacteria 30557
112 Ga0068305_10010097 3300005083 Bacteria 67125
113 Ga0103261_1000046 3300007083 Unclassified 39142
114 Ga0104019_1034625 3300007150 Unclassified 2218
115 Ga0466706_002280 3300042599 Unclassified 1023
116 Ga0466706_046752 3300042599 Bacteria 7867
117 Ga0466706_095810 3300042599 Bacteria 22568
118 Ga0466706_103607 3300042599 Bacteria 38782
119 Ga0466700_492090 3300042600 Bacteria 1316
120 Ga0466714_074988 3300042603 Bacteria 2014
121 Ga0466714_132716 3300042603 Unclassified 1406
122 Ga0466722_252949 3300042609 Bacteria 7852
123 Ga0466735_180494 3300042624 Bacteria 2824

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300007150 Ga0104019_1034625 Ga0104019_10346253 209
2 3300042659 Ga0466733_073117 Ga0466733_073117_3446_4162 212
3 3300042599 Ga0466706_021280 Ga0466706_021280_788_1444 218
4 3300042599 Ga0466706_256901 Ga0466706_256901_49_726 218
5 3300042659 Ga0466733_051324 Ga0466733_051324_186_842 218
6 3300042659 Ga0466733_079531 Ga0466733_079531_185_841 218
7 3300042603 Ga0466714_142339 Ga0466714_142339_415_1074 219
8 3300042603 Ga0466714_125354 Ga0466714_125354_1696_2358 220
9 3300042599 Ga0466706_112779 Ga0466706_112779_2650_3315 221
10 3300042659 Ga0466733_035462 Ga0466733_035462_10007_10672 221
11 3300042599 Ga0466706_017256 Ga0466706_017256_1018_1689 223
12 3300042659 Ga0466733_218682 Ga0466733_218682_11071_11745 224
13 3300042599 Ga0466706_046752 Ga0466706_046752_6273_6950 225
14 3300042599 Ga0466706_114796 Ga0466706_114796_3290_3967 225
15 3300042659 Ga0466733_032988 Ga0466733_032988_29220_29903 227
16 3300010882 Ga0123354_10244638 Ga0123354_102446382 228
17 3300042659 Ga0466733_045198 Ga0466733_045198_516_1202 228
18 3300042624 Ga0466735_180494 Ga0466735_180494_2052_2777 231
19 3300007733 Ga0105524_105787 Ga0105524_1057871 235
20 3300042605 Ga0466716_508727 Ga0466716_508727_21814_22521 235
21 3300042618 Ga0466723_142663 Ga0466723_142663_2553_3260 235
22 3300042648 Ga0466709_136725 Ga0466709_136725_20184_20891 235
23 iso_pr_bacteria 2627854132 2630358312 235
24 iso_pr_bacteria 2870004507 2870005148 235
25 3300042590 Ga0466690_158733 Ga0466690_158733_1606_2316 236
26 3300042594 Ga0466694_042143 Ga0466694_042143_1116_1826 236
27 3300042596 Ga0466696_180685 Ga0466696_180685_3595_4305 236
28 3300042598 Ga0466701_003736 Ga0466701_003736_41783_42493 236
29 3300042598 Ga0466701_011125 Ga0466701_011125_12924_13634 236
30 3300042598 Ga0466701_058067 Ga0466701_058067_2939_3649 236
31 3300042599 Ga0466706_095810 Ga0466706_095810_9758_10468 236
32 3300042599 Ga0466706_198060 Ga0466706_198060_10899_11609 236
33 3300042603 Ga0466714_125806 Ga0466714_125806_20745_21455 236
34 3300042605 Ga0466716_080663 Ga0466716_080663_5551_6261 236
35 3300042606 Ga0466719_042388 Ga0466719_042388_1129_1839 236
36 3300042615 Ga0466711_069689 Ga0466711_069689_2152_2862 236
37 3300042619 Ga0466726_171597 Ga0466726_171597_4607_5317 236
38 3300042620 Ga0466728_138908 Ga0466728_138908_5504_6214 236
39 3300042620 Ga0466728_181221 Ga0466728_181221_22166_22876 236
40 3300042636 Ga0466703_048013 Ga0466703_048013_76281_76991 236
41 3300042636 Ga0466703_282847 Ga0466703_282847_22634_23344 236
42 3300042648 Ga0466709_167096 Ga0466709_167096_9575_10285 236
43 3300042649 Ga0466724_31268 Ga0466724_31268_74299_75009 236
44 3300042652 Ga0466708_305107 Ga0466708_305107_2043_2753 236
45 3300042656 Ga0466732_096678 Ga0466732_096678_17944_18654 236
46 3300042656 Ga0466732_447361 Ga0466732_447361_55373_56083 236
47 3300042659 Ga0466733_016851 Ga0466733_016851_7889_8599 236
48 iso_pr_bacteria 2820750388 2820751176 236
49 iso_pr_bacteria 2820751898 2820753390 236
50 iso_pr_bacteria 2820789850 2820790818 236
51 iso_pr_bacteria 2820789850 2820791191 236
52 iso_pr_bacteria 2899132286 2899134421 236
53 3300002462 JGI24702J35022_10177033 JGI24702J35022_101770331 237
54 3300002931 CVPL010W_10005250 CVPL010W_100052508 237
55 3300002934 CVPL005W_1000145 CVPL005W_100014512 237
56 3300005307 Ga0074308_1113691 Ga0074308_11136914 237
57 3300007067 Ga0103266_1000353 Ga0103266_10003536 237
58 3300007083 Ga0103261_1000046 Ga0103261_100004628 237
59 3300007085 Ga0104045_1005006 Ga0104045_10050062 237
60 3300007085 Ga0104045_1026361 Ga0104045_10263615 237
61 3300007095 Ga0102739_1000267 Ga0102739_10002676 237
62 3300007139 Ga0103260_1000027 Ga0103260_100002766 237
63 3300007140 Ga0102740_1000054 Ga0102740_10000541 237
64 3300007143 Ga0104048_1000738 Ga0104048_10007382 237
65 3300007143 Ga0104048_1003069 Ga0104048_10030694 237
66 3300007190 Ga0103267_1000009 Ga0103267_100000936 237
67 3300007190 Ga0103267_1000391 Ga0103267_100039112 237
68 3300007192 Ga0103268_1000155 Ga0103268_10001554 237
69 3300007192 Ga0103268_1001214 Ga0103268_10012142 237
70 3300010049 Ga0123356_10058663 Ga0123356_100586634 237
71 3300042599 Ga0466706_011591 Ga0466706_011591_4888_5622 237
72 3300042602 Ga0466713_010388 Ga0466713_010388_3727_4440 237
73 3300042609 Ga0466722_252949 Ga0466722_252949_1551_2264 237
74 3300042616 Ga0466715_246897 Ga0466715_246897_27660_28373 237
75 3300042659 Ga0466733_105174 Ga0466733_105174_2213_2926 237
76 3300013007 Ga0157631_100610 Ga0157631_1006103 238
77 3300042590 Ga0466690_008835 Ga0466690_008835_7282_7998 238
78 3300042596 Ga0466696_116170 Ga0466696_116170_507_1223 238
79 3300042599 Ga0466706_104447 Ga0466706_104447_410_1126 238
80 3300042601 Ga0466707_269285 Ga0466707_269285_1876_2592 238
81 3300042602 Ga0466713_146264 Ga0466713_146264_278_994 238
82 3300042603 Ga0466714_007872 Ga0466714_007872_1805_2521 238
83 3300042603 Ga0466714_043034 Ga0466714_043034_665_1381 238
84 3300042603 Ga0466714_132716 Ga0466714_132716_190_906 238
85 3300042648 Ga0466709_060234 Ga0466709_060234_392_1108 238
86 3300042599 Ga0466706_002280 Ga0466706_002280_74_793 239
87 3300042599 Ga0466706_265268 Ga0466706_265268_11827_12546 239
88 3300042603 Ga0466714_012360 Ga0466714_012360_28_747 239
89 3300042603 Ga0466714_018806 Ga0466714_018806_154_873 239
90 3300042603 Ga0466714_138691 Ga0466714_138691_102_821 239
91 3300042609 Ga0466722_252268 Ga0466722_252268_2543_3262 239
92 3300042659 Ga0466733_168571 Ga0466733_168571_5307_6026 239
93 3300010882 Ga0123354_10049157 Ga0123354_100491575 240
94 3300042603 Ga0466714_074988 Ga0466714_074988_1140_1862 240
95 3300042615 Ga0466711_133919 Ga0466711_133919_1186_1908 240
96 3300042659 Ga0466733_026339 Ga0466733_026339_728_1450 240
97 3300042659 Ga0466733_187687 Ga0466733_187687_961_1683 240
98 3300056842 Ga0562377_0004 Ga0562377_0004_1500825_1501547 240
99 3300000062 IMNBL1DRAFT_c0012144 IMNBL1DRAFT_00121442 241
100 3300042590 Ga0466690_077896 Ga0466690_077896_9028_9753 241
101 3300042599 Ga0466706_103607 Ga0466706_103607_2490_3215 241
102 3300042600 Ga0466700_492090 Ga0466700_492090_485_1210 241
103 3300042618 Ga0466723_160704 Ga0466723_160704_566_1291 241
104 3300042618 Ga0466723_183938 Ga0466723_183938_1667_2392 241
105 iso_pr_bacteria 2695420314 2695471032 241
106 3300042599 Ga0466706_059283 Ga0466706_059283_1658_2386 242
107 iso_pr_bacteria 2940244548 2940246180 242
108 iso_pr_bacteria 2940248789 2940250417 242
109 iso_pr_bacteria 2940253009 2940254492 242
110 iso_pr_bacteria 2940257232 2940258498 242
111 3300042599 Ga0466706_036123 Ga0466706_036123_13184_13915 243
112 3300042599 Ga0466706_050067 Ga0466706_050067_8974_9705 243
113 3300042599 Ga0466706_062384 Ga0466706_062384_4380_5111 243
114 3300042599 Ga0466706_217250 Ga0466706_217250_6077_6808 243
115 3300042620 Ga0466728_398132 Ga0466728_398132_23003_23734 243
116 iso_pr_bacteria 3004677695 3004678766 243
117 3300007143 Ga0104048_1175526 Ga0104048_11755262 244
118 3300042596 Ga0466696_025646 Ga0466696_025646_1521_2255 244
119 iso_pr_bacteria 2922326829 2922329995 244
120 3300005083 Ga0068305_10378891 Ga0068305_103788912 245
121 3300042596 Ga0466696_005041 Ga0466696_005041_2818_3555 245
122 3300042599 Ga0466706_061662 Ga0466706_061662_882_1619 245
123 iso_pr_bacteria 2609459943 2610739984 245
124 3300005083 Ga0068305_10010097 Ga0068305_100100974 246
125 3300007733 Ga0105524_100415 Ga0105524_1004157 246
126 3300007733 Ga0105524_104928 Ga0105524_1049282 246
127 3300013007 Ga0157631_112872 Ga0157631_1128721 246
128 3300013007 Ga0157631_136737 Ga0157631_1367373 246
129 3300013007 Ga0157631_137297 Ga0157631_1372972 246
130 3300042582 Ga0466657_387007 Ga0466657_387007_44339_45082 247
131 iso_pr_bacteria 2830041218 2830042284 252
132 3300010167 Ga0123353_10668216 Ga0123353_106682162 255
133 3300042659 Ga0466733_112768 Ga0466733_112768_1168_1935 255
134 3300009784 Ga0123357_10000340 Ga0123357_1000034017 257
135 3300042603 Ga0466714_126151 Ga0466714_126151_1369_2145 258
136 3300042615 Ga0466711_340423 Ga0466711_340423_632_1429 258
137 3300002462 JGI24702J35022_10025819 JGI24702J35022_100258193 269
138 3300007190 Ga0103267_1000536 Ga0103267_10005362 272
139 3300042619 Ga0466726_044927 Ga0466726_044927_1908_2780 290

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01709 Transcrip_reg TACO1/YebC second and third domain 114 270 0.96
PF20772 TACO1_YebC_N TACO1/YebC protein N-terminal domain 39 108 0.96

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.73 0.82 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.