Protein Family IF01876
Metagenome
Metatranscriptome
Isolate
634
Members
255
Samples
493
Scaffolds
117.43
Avg Length
Representative Sequence
- ID
- 3300007188|Ga0103264_1018684|Ga0103264_10186841
- Length
- 138 aa
- Sequence
- MARVKRGVTGHAKHKKTLKQARGFYGRRKNTIRAAMAAVDRAKQYAYRDRKNRKRTFRALWIQRINAAVREHGLSYGRFIDGLTKAGIEVDRKLLSDLAIHQPEAFAALVQSARQALDYLKQTTPGAYEGAVKQADS*
Sample Types
Isolate
22.2%
Metagenome
76.7%
MAG
0.0%
Metatranscriptome
1.1%
Single Cell
0.0%
Taxa Family Distribution
Apidae
17.6%
Unclassified
15.5%
Termitidae
15.1%
Formicidae
10.2%
Drosophilidae
9.0%
Elmidae
5.7%
Kalotermitidae
5.7%
Culicidae
4.5%
Armadillidiidae
2.4%
Aleyrodidae
2.0%
Termopsidae
1.6%
Rhinotermitidae
1.2%
Nephropidae
1.2%
Blattidae
1.2%
Psyllidae
1.2%
Daphniidae
0.8%
Tenebrionidae
0.8%
Passalidae
0.8%
Thomisidae
0.4%
Hodotermitidae
0.4%
Cerambycidae
0.4%
Aphelinidae
0.4%
Curculionidae
0.4%
Cambaridae
0.4%
Muscidae
0.4%
Kiwaidae
0.4%
Taxonomy
Archaea
0
Bacteria
472
Eukaryota
0
Viruses
0
Unclassified
162
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820914081 | Unclassified Actinobacteria Emb289P3bin87 | Isolate | Unclassified |
| 2 | 2843864159 | Acetobacter pomorum SH | Isolate | Drosophilidae |
| 3 | 2864831662 | Chryseobacterium sediminis S00068 | Isolate | Elmidae |
| 4 | 2864951976 | Brevundimonas bullata S00223 | Isolate | Elmidae |
| 5 | 2884203697 | Commensalibacter melissae ESL0284 | Isolate | Apidae |
| 6 | 2891591111 | Commensalibacter sp. ESL0382 | Isolate | Unclassified |
| 7 | 2891610497 | Commensalibacter melissae ESL0367 | Isolate | Apidae |
| 8 | 2894649344 | Allomuricauda alvinocaridis SCR12 | Isolate | Unclassified |
| 9 | 2711768164 | Tritonibacter mobilis S1942 | Isolate | Unclassified |
| 10 | 2751185856 | Bartonella apis BBC0244 | Isolate | Apidae |
| 11 | 2811995047 | Flavobacterium succinicans DD5b | Isolate | Daphniidae |
| 12 | 2816332545 | Tritonibacter mobilis S1923 | Isolate | Unclassified |
| 13 | 2820098966 | Unclassified Proteobacteria Lab288P1bin49 | Isolate | Unclassified |
| 14 | 2820115951 | Unclassified Proteobacteria Emb289P4bin33 | Isolate | Unclassified |
| 15 | 2820146621 | Unclassified Proteobacteria Emb289P3bin103 | Isolate | Unclassified |
| 16 | 2820750388 | Unclassified Bacteroidetes Nt197P3bin50 | Isolate | Unclassified |
| 17 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 18 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 19 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 20 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 21 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 22 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 23 | 651324000 | Acetobacter pomorum DM001 | Isolate | Drosophilidae |
| 24 | 8020009074 | Elizabethkingia anophelis MSU001 | Isolate | Culicidae |
| 25 | 8067588748 | Gluconobacter kondonii Dm-42 | Isolate | Drosophilidae |
| 26 | 8073617375 | Bartonella apis W8098 | Isolate | Apidae |
| 27 | 8082291289 | Bartonella apihabitans K-FP28 | Isolate | Apidae |
| 28 | 3002394112 | Gluconobacter sp. Gdi | Isolate | Drosophilidae |
| 29 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 30 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 31 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 32 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 33 | 3300021217 | Termite gut microbial communities from nest from French Guiana - 13-5 mRNA SA | Metatranscriptome | Termitidae |
| 34 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 35 | 3300028918 | Ant gut bacterial community from Dolichoderus sp. 2-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC085 | Metagenome | Formicidae |
| 36 | 3300029810 | Ant gut bacterial community from Dolichoderus sp. 4-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC189 | Metagenome | Formicidae |
| 37 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 38 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 39 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 40 | 8114076984 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 41 | 2820816657 | Unclassified Actinobacteria Nt197P3bin38 | Isolate | Unclassified |
| 42 | 2820901319 | Unclassified Actinobacteria Emb289P4bin58 | Isolate | Unclassified |
| 43 | 2832343623 | Apibacter adventoris wkB180 | Isolate | Apidae |
| 44 | 2835143510 | Yoonia maritima YPC211 | Isolate | Nephropidae |
| 45 | 2854576727 | Acetobacter okinawensis DsW_060 | Isolate | Drosophilidae |
| 46 | 2864788197 | Elizabethkingia anophelis S00027 | Isolate | Elmidae |
| 47 | 2864822740 | Chryseobacterium shigense S00064 | Isolate | Elmidae |
| 48 | 2882250448 | Bizionia sp. APA-3 | Isolate | |
| 49 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 50 | 2556921669 | Shinella sp. DD12 | Isolate | Daphniidae |
| 51 | 2630969010 | Friedmanniella luteola DSM 21741 | Isolate | Thomisidae |
| 52 | 2806310572 | Pukyongiella litopenaei SH-1 | Isolate | Unclassified |
| 53 | 2820721785 | Unclassified Fibrobacteres Lab288P1bin58 | Isolate | Unclassified |
| 54 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 55 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 56 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 57 | 8067579126 | Gluconobacter kondonii Dm-16 | Isolate | Drosophilidae |
| 58 | 8067581993 | Gluconobacter kondonii Dm-54 | Isolate | Drosophilidae |
| 59 | 8068946563 | Bartonella apihabitans M0187 | Isolate | Apidae |
| 60 | 8074882376 | Commensalibacter sp. M0270 | Isolate | Apidae |
| 61 | 3300002732 | Whitefly associated endosymbiont microbial communities from Neve Yaar, Israel Sample - Wolbechia Contigs | Metagenome | |
| 62 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 63 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 64 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 65 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 66 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 67 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 68 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 69 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 70 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 71 | 3300021222 | Termite gut microbial communities from nest from French Guiana - FG16_17b_4 mRNA SA | Metatranscriptome | |
| 72 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 73 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 74 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 75 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 76 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 77 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 78 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 79 | 2820767225 | Unclassified Bacteroidetes Lab288P3bin34 | Isolate | Unclassified |
| 80 | 2833052049 | Commensalibacter melissae AMU001 | Isolate | Apidae |
| 81 | 2864948220 | Elizabethkingia anophelis S00205 | Isolate | Elmidae |
| 82 | 2873468275 | Agrobacterium vitis S00131 | Isolate | Elmidae |
| 83 | 2513237393 | Gluconobacter morbifer G707 | Isolate | Drosophilidae |
| 84 | 2785510743 | Apibacter sp. ESL0404 | Isolate | Apidae |
| 85 | 2816332503 | Tritonibacter mobilis S1611 | Isolate | Unclassified |
| 86 | 2512047025 | Candidatus Portiera aleyrodidarum | Isolate | Aleyrodidae |
| 87 | 2518645538 | Candidatus Portiera aleyrodidarum BT-QVLC | Isolate | Aleyrodidae |
| 88 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 89 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 90 | 8073624232 | Bartonella sp. W8151 | Isolate | Apidae |
| 91 | 8074884171 | Commensalibacter sp. M0355 | Isolate | Apidae |
| 92 | 8100534375 | Gluconobacter sp. Dm-74 | Isolate | Drosophilidae |
| 93 | 2987037630 | Oecophyllibacter saccharovorans Ha5 | Isolate | Formicidae |
| 94 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 95 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 96 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 97 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 98 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 99 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 100 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 101 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 102 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 103 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 104 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 105 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 106 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 107 | 2820768849 | Unclassified Bacteroidetes Lab288P3bin194 | Isolate | Unclassified |
| 108 | 2820774381 | Unclassified Bacteroidetes Lab288P1bin37 | Isolate | Unclassified |
| 109 | 2820795054 | Unclassified Bacteroidetes Cu122P1bin21 | Isolate | Unclassified |
| 110 | 2837008993 | Oecophyllibacter saccharovorans Ta1 | Isolate | Formicidae |
| 111 | 2864923010 | Elizabethkingia anophelis S00177 | Isolate | Elmidae |
| 112 | 2864976888 | Novosphingobium chloroacetimidivorans S00245 | Isolate | Elmidae |
| 113 | 2084038013 | Anoplophora glabripennis gut microbial communities from Worchester, Massachusetts, USA - Larvae | Metagenome | Cerambycidae |
| 114 | 2515154046 | Candidatus Portiera aleyrodidarum | Isolate | Aleyrodidae |
| 115 | 2556921622 | Terasakiella pusilla DSM 6293 | Isolate | Unclassified |
| 116 | 2820748953 | Unclassified Bacteroidetes Nt197P4bin17 | Isolate | Unclassified |
| 117 | 2518285589 | Candidatus Portiera aleyrodidarum TV (unscreened) | Isolate | Aleyrodidae |
| 118 | 8067594896 | Gluconobacter kondonii Dm-18 | Isolate | Drosophilidae |
| 119 | 8068953321 | Bartonella apihabitans M0190 | Isolate | Apidae |
| 120 | 8074748739 | Commensalibacter sp. W8133 | Isolate | Apidae |
| 121 | 8100531325 | Gluconobacter sp. Dm-73 | Isolate | Drosophilidae |
| 122 | 3300060777 | Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_PS_b (Metagenome Metatranscriptome) | Metatranscriptome | Tenebrionidae |
| 123 | 644736336 | Candidatus Liberibacter asiaticus psy62 | Isolate | Psyllidae |
| 124 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 125 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 126 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 127 | 3300009460 | Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov | Metagenome | |
| 128 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 129 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 130 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 131 | 3300021245 | Termite gut microbial communities from nest from French Guiana - 11-4 mRNA SA | Metatranscriptome | Termitidae |
| 132 | 3300022820 | Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA | Metatranscriptome | Termitidae |
| 133 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 134 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 135 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 136 | 2832372155 | Apibacter adventoris wkB301 | Isolate | Apidae |
| 137 | 2843073756 | Oecophyllibacter saccharovorans Jb2 | Isolate | Formicidae |
| 138 | 2854520951 | Acetobacter pasteurianus AD | Isolate | Unclassified |
| 139 | 2864836148 | Arcicella rosea S00070 | Isolate | Elmidae |
| 140 | 2864866972 | Brevundimonas bullata S00123 | Isolate | Elmidae |
| 141 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 142 | 2529292732 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 143 | 2718218155 | Flavobacteriaceae bacterium UJ101 | Isolate | |
| 144 | 2751185853 | Bartonella apis BBC0178 | Isolate | Apidae |
| 145 | 2786546124 | Acetobacter sp. JWB | Isolate | Drosophilidae |
| 146 | 2816332302 | Candidatus Liberibacter asiaticus YCPsy | Isolate | Psyllidae |
| 147 | 8067591850 | Gluconobacter kondonii Dm-47 | Isolate | Drosophilidae |
| 148 | 8068944069 | Bartonella choladocola W8125 | Isolate | Apidae |
| 149 | 8068955631 | Bartonella apihabitans M0280 | Isolate | Apidae |
| 150 | 8073628750 | Bartonella sp. W8167 | Isolate | Apidae |
| 151 | 8074737057 | Commensalibacter sp. M0357 | Isolate | Apidae |
| 152 | 8074867669 | Commensalibacter sp. B14384M2 | Isolate | Apidae |
| 153 | 8074869529 | Commensalibacter sp. B14384M3 | Isolate | Apidae |
| 154 | 8074876897 | Commensalibacter sp. M0266 | Isolate | Apidae |
| 155 | 8100528075 | Gluconobacter sp. Dm-44 | Isolate | Drosophilidae |
| 156 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 157 | 3300003131 | Encarsia pergandiella symbiont microbial communities from Weslaco, Texas | Metagenome | Aphelinidae |
| 158 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 159 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 160 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 161 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 162 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 163 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 164 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 165 | 3300028910 | Ant gut bacterial community from Dolichoderus sp. 1-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC161 | Metagenome | Formicidae |
| 166 | 2820789850 | Unclassified Bacteroidetes Cu122P3bin3 | Isolate | Unclassified |
| 167 | 2820820509 | Unclassified Actinobacteria Nt197P3bin23 | Isolate | Unclassified |
| 168 | 2832298047 | Apibacter sp. wkB309 | Isolate | Apidae |
| 169 | 2839192570 | Gluconobacter sp. DsW_056 | Isolate | Drosophilidae |
| 170 | 2839785767 | Thalassobius sp. I31.1 | Isolate | Nephropidae |
| 171 | 2847090942 | Elizabethkingia anophelis Ag1 | Isolate | Culicidae |
| 172 | 2864882932 | Chryseobacterium shingense S00136 | Isolate | Elmidae |
| 173 | 2864891731 | Chryseobacterium defluvii S00151 | Isolate | Elmidae |
| 174 | 2891675627 | Commensalibacter melissae ESL0366 | Isolate | Apidae |
| 175 | 2617271320 | Acetobacter pomorum DmCS_004 | Isolate | Drosophilidae |
| 176 | 2687453786 | Chryseobacterium culicis DSM 23031 | Isolate | Unclassified |
| 177 | 8073626464 | Bartonella apis W8152 | Isolate | Apidae |
| 178 | 8074832014 | Commensalibacter melissae M0391 | Isolate | Apidae |
| 179 | 8074875073 | Commensalibacter sp. M0265 | Isolate | Apidae |
| 180 | 8074878724 | Commensalibacter sp. M0267 | Isolate | Apidae |
| 181 | 8074880551 | Commensalibacter sp. M0268 | Isolate | Apidae |
| 182 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 183 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 184 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 185 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 186 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 187 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 188 | 3300029809 | Ant gut bacterial community from Dolichoderus sp. 3-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC188 | Metagenome | Formicidae |
| 189 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 190 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 191 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 192 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 193 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 194 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 195 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 196 | 2820797595 | Unclassified Bacteroidetes Co191P3bin3 | Isolate | Unclassified |
| 197 | 2834038347 | Gluconobacter sp. DsW_058 | Isolate | Drosophilidae |
| 198 | 2838772460 | Aquimarina sp. I32.4 | Isolate | Nephropidae |
| 199 | 2858084324 | Acetobacter sp. DsW_54 | Isolate | Drosophilidae |
| 200 | 2886876212 | Tokpelaia sp. RhiAcro1 | Isolate | Formicidae |
| 201 | 2891690481 | Commensalibacter melissae ESL0390 | Isolate | Apidae |
| 202 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 203 | 2517093038 | Candidatus Portiera aleyrodidarum BT-B | Isolate | Aleyrodidae |
| 204 | 2695420964 | Hyphomicrobiales bacterium JR021 | Isolate | Unclassified |
| 205 | 2751185858 | Bartonella apis BBC0122 | Isolate | Apidae |
| 206 | 2756170209 | Commensalibacter sp. ESL0284 | Isolate | Unclassified |
| 207 | 2799112231 | Apibacter sp. ESL0432 | Isolate | Unclassified |
| 208 | 2820736622 | Unclassified Bacteroidetes Th196P4bin26 | Isolate | Unclassified |
| 209 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 210 | 8068941587 | Bartonella choladocola B10834H15 | Isolate | Apidae |
| 211 | 8073619611 | Bartonella apis B10834G6 | Isolate | Apidae |
| 212 | 8074746876 | Commensalibacter sp. W6292M3 | Isolate | Apidae |
| 213 | 8074750600 | Commensalibacter sp. W8163 | Isolate | Apidae |
| 214 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 215 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 216 | 3300021239 | Termite gut microbial communities from nest from French Guiana - FG16_17_4 mRNA SA | Metatranscriptome | |
| 217 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 218 | 3300026175 | Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 | Metagenome | Formicidae |
| 219 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 220 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 221 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 222 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 223 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 224 | 2820772500 | Unclassified Bacteroidetes Lab288P1bin72 | Isolate | Unclassified |
| 225 | 2820792843 | Unclassified Bacteroidetes Cu122P3bin1 | Isolate | Unclassified |
| 226 | 2841330038 | Sulfitobacter sp. D7 | Isolate | |
| 227 | 2864934081 | Brevundimonas vesicularis S00192 | Isolate | Elmidae |
| 228 | 2864993140 | Agrobacterium vitis S00303 | Isolate | Elmidae |
| 229 | 2891605396 | Commensalibacter melissae ESL0392 | Isolate | Apidae |
| 230 | 2891614855 | Commensalibacter melissae ESL0379 | Isolate | Apidae |
| 231 | 2900132049 | Bartonella massiliensis OS09 | Isolate | Unclassified |
| 232 | 2921902974 | Chryseobacterium sp. cx-624 | Isolate | Cambaridae |
| 233 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 234 | 2718218026 | Phaeobacter porticola P97 | Isolate | Unclassified |
| 235 | 2820148564 | Unclassified Proteobacteria Emb289P1bin36 | Isolate | Unclassified |
| 236 | 2820737921 | Unclassified Bacteroidetes Th196P4bin18 | Isolate | Unclassified |
| 237 | 2820740053 | Unclassified Bacteroidetes Th196P3bin81 | Isolate | Unclassified |
| 238 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 239 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 240 | 8067483258 | Ochrobactrum soli MTP-C0764 | Isolate | Muscidae |
| 241 | 8067585538 | Gluconobacter kondonii Dm-68 | Isolate | Drosophilidae |
| 242 | 8068950955 | Bartonella apihabitans W8097 | Isolate | Apidae |
| 243 | 8073621894 | Bartonella apis W8099 | Isolate | Apidae |
| 244 | 8074743123 | Commensalibacter melissae M0402 | Isolate | Apidae |
| 245 | 8063680480 | Candidatus Liberibacter asiaticus CoFLP | Isolate | Psyllidae |
| 246 | 3002401049 | Gluconobacter sp. Dm-62 | Isolate | Drosophilidae |
| 247 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 248 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 249 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 250 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 251 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 252 | 3300007763 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 5 gut | Metagenome | Drosophilidae |
| 253 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 254 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 255 | 3300013007 | Symbiotic microbial communities associated with the hydrothermal yeti crab kiwa sp. n. from the East Pacific Rise in the East Pacific Ocean - crab 1, guts | Metagenome | Kiwaidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_310025 | 3300042612 | Unclassified | 6013 |
| 2 | Ga0466732_409889 | 3300042656 | Unclassified | 4872 |
| 3 | Ga0466733_123446 | 3300042659 | Bacteria | 50285 |
| 4 | Ga0466733_125464 | 3300042659 | Bacteria | 11645 |
| 5 | Ga0466733_208754 | 3300042659 | Bacteria | 18747 |
| 6 | Ga0160472_100450 | 3300012839 | Bacteria | 29515 |
| 7 | Ga0223677_1006094 | 3300021239 | Unclassified | 577 |
| 8 | Ga0255572_1000003 | 3300026175 | Bacteria | 262489 |
| 9 | Ga0309903_100013 | 3300029809 | Bacteria | 41975 |
| 10 | Ga0466690_148584 | 3300042590 | Bacteria | 6067 |
| 11 | Ga0466690_196912 | 3300042590 | Bacteria | 20732 |
| 12 | Ga0466690_381631 | 3300042590 | Unclassified | 5786 |
| 13 | Ga0466690_400038 | 3300042590 | Bacteria | 5155 |
| 14 | Ga0466691_029420 | 3300042593 | Bacteria | 25628 |
| 15 | Ga0466696_141025 | 3300042596 | Bacteria | 7823 |
| 16 | Ga0466711_089981 | 3300042615 | Bacteria | 7482 |
| 17 | Ga0466715_636150 | 3300042616 | Bacteria | 6714 |
| 18 | Ga0466726_072948 | 3300042619 | Bacteria | 1761 |
| 19 | Ga0466728_289221 | 3300042620 | Bacteria | 14211 |
| 20 | Ga0123355_11009745 | 3300009826 | Unclassified | 882 |
| 21 | Ga0123355_11870052 | 3300009826 | Unclassified | 563 |
| 22 | Ga0123356_10005971 | 3300010049 | Bacteria | 12359 |
| 23 | Ga0123356_10970518 | 3300010049 | Unclassified | 1020 |
| 24 | Ga0123356_11733658 | 3300010049 | Bacteria | 775 |
| 25 | Ga0123353_10017614 | 3300010167 | Bacteria | 10513 |
| 26 | Ga0123353_10759116 | 3300010167 | Bacteria | 1348 |
| 27 | Ga0123353_10907367 | 3300010167 | Unclassified | 1198 |
| 28 | Ga0123353_11847582 | 3300010167 | Unclassified | 748 |
| 29 | Ga0123353_13339332 | 3300010167 | Bacteria | 511 |
| 30 | Ga0123354_10152845 | 3300010882 | Bacteria | 2786 |
| 31 | Ga0160471_114414 | 3300012812 | Bacteria | 790 |
| 32 | Ga0466701_054311 | 3300042598 | Bacteria | 18356 |
| 33 | Ga0466706_050641 | 3300042599 | Bacteria | 28814 |
| 34 | Ga0466700_306800 | 3300042600 | Bacteria | 3356 |
| 35 | Ga0466713_025378 | 3300042602 | Bacteria | 40984 |
| 36 | Ga0466714_005494 | 3300042603 | Bacteria | 3900 |
| 37 | Ga0466714_024743 | 3300042603 | Bacteria | 1312 |
| 38 | Ga0466714_063458 | 3300042603 | Unclassified | 3634 |
| 39 | Ga0466714_078588 | 3300042603 | Bacteria | 41151 |
| 40 | Ga0466714_108484 | 3300042603 | Bacteria | 20162 |
| 41 | Ga0466714_113826 | 3300042603 | Bacteria | 5218 |
| 42 | Ga0466714_115946 | 3300042603 | Bacteria | 9489 |
| 43 | Ga0466714_169375 | 3300042603 | Bacteria | 2020 |
| 44 | Ga0466717_206358 | 3300042604 | Bacteria | 4264 |
| 45 | Ga0466716_108377 | 3300042605 | Bacteria | 17952 |
| 46 | Ga0466719_486176 | 3300042606 | Unclassified | 1773 |
| 47 | Ga0466698_232625 | 3300042610 | Bacteria | 24344 |
| 48 | Ga0466698_482579 | 3300042610 | Bacteria | 1120 |
| 49 | Ga0466709_062901 | 3300042648 | Bacteria | 45932 |
| 50 | Ga0466709_169180 | 3300042648 | Bacteria | 45156 |
| 51 | Ga0466708_415768 | 3300042652 | Bacteria | 11732 |
| 52 | IMNBL1DRAFT_c0026727 | 3300000062 | Bacteria | 2185 |
| 53 | IMNBL1DRAFT_c0066935 | 3300000062 | Bacteria | 1052 |
| 54 | JGI24698J34947_10214712 | 3300002449 | Unclassified | 743 |
| 55 | JGI24698J34947_10235843 | 3300002449 | Unclassified | 692 |
| 56 | JGI24702J35022_10303016 | 3300002462 | Bacteria | 943 |
| 57 | JGI24705J35276_11565699 | 3300002504 | Unclassified | 579 |
| 58 | CVPL010W_10001263 | 3300002931 | Bacteria | 49318 |
| 59 | CVPL010L_1000500 | 3300002932 | Unclassified | 9473 |
| 60 | CVPL005L_10001721 | 3300002938 | Unclassified | 25257 |
| 61 | Ga0102736_1009439 | 3300007052 | Bacteria | 1132 |
| 62 | Ga0123357_10001672 | 3300009784 | Bacteria | 23842 |
| 63 | Ga0466705_045540 | 3300042612 | Bacteria | 2100 |
| 64 | Ga0466733_000042 | 3300042659 | Unclassified | 3056 |
| 65 | Ga0466733_059911 | 3300042659 | Bacteria | 27822 |
| 66 | Ga0466733_186975 | 3300042659 | Bacteria | 14055 |
| 67 | Ga0530661_012763 | 3300056564 | Bacteria | 2343 |
| 68 | Ga0160455_100649 | 3300012837 | Unclassified | 14918 |
| 69 | Ga0223687_123079 | 3300021217 | Bacteria | 605 |
| 70 | Ga0223683_1026940 | 3300021245 | Bacteria | 548 |
| 71 | Ga0255809_1029343 | 3300022820 | Unclassified | 682 |
| 72 | Ga0264413_150757 | 3300024493 | Bacteria | 1196 |
| 73 | Ga0466657_157937 | 3300042582 | Bacteria | 13245 |
| 74 | Ga0466657_377582 | 3300042582 | Unclassified | 2210 |
| 75 | Ga0466690_163337 | 3300042590 | Unclassified | 5542 |
| 76 | Ga0466699_160747 | 3300042597 | Bacteria | 1600 |
| 77 | Ga0466710_099940 | 3300042613 | Bacteria | 1293 |
| 78 | Ga0466715_101234 | 3300042616 | Bacteria | 3501 |
| 79 | Ga0466723_051722 | 3300042618 | Unclassified | 7452 |
| 80 | Ga0466723_101055 | 3300042618 | Bacteria | 4541 |
| 81 | Ga0466723_182390 | 3300042618 | Bacteria | 3889 |
| 82 | Ga0466723_289793 | 3300042618 | Bacteria | 6264 |
| 83 | Ga0466726_077805 | 3300042619 | Bacteria | 15528 |
| 84 | Ga0466726_251769 | 3300042619 | Bacteria | 6687 |
| 85 | Ga0466726_312631 | 3300042619 | Bacteria | 9664 |
| 86 | Ga0466728_095934 | 3300042620 | Unclassified | 4045 |
| 87 | Ga0466728_176057 | 3300042620 | Bacteria | 14282 |
| 88 | Ga0466728_404526 | 3300042620 | Unclassified | 2396 |
| 89 | Ga0123357_10058721 | 3300009784 | Bacteria | 5164 |
| 90 | Ga0123357_10392526 | 3300009784 | Bacteria | 1273 |
| 91 | Ga0123355_10702331 | 3300009826 | Unclassified | 1161 |
| 92 | Ga0123355_10716057 | 3300009826 | Unclassified | 1144 |
| 93 | Ga0123355_10956146 | 3300009826 | Unclassified | 919 |
| 94 | Ga0123356_10035306 | 3300010049 | Bacteria | 4672 |
| 95 | Ga0123356_10036025 | 3300010049 | Unclassified | 4620 |
| 96 | Ga0123356_10332451 | 3300010049 | Unclassified | 1637 |
| 97 | Ga0123356_13335945 | 3300010049 | Unclassified | 558 |
| 98 | Ga0123353_10269871 | 3300010167 | Bacteria | 2622 |
| 99 | Ga0123353_10511915 | 3300010167 | Bacteria | 1745 |
| 100 | Ga0123353_10595827 | 3300010167 | Bacteria | 1581 |
| 101 | Ga0123353_11591249 | 3300010167 | Unclassified | 826 |
| 102 | Ga0123353_12574597 | 3300010167 | Bacteria | 603 |
| 103 | Ga0123353_12972927 | 3300010167 | Unclassified | 550 |
| 104 | Ga0123354_10291651 | 3300010882 | Bacteria | 1562 |
| 105 | Ga0123354_10300234 | 3300010882 | Unclassified | 1520 |
| 106 | Ga0466701_037243 | 3300042598 | Bacteria | 5153 |
| 107 | Ga0466706_188194 | 3300042599 | Bacteria | 37930 |
| 108 | Ga0466706_242809 | 3300042599 | Bacteria | 8617 |
| 109 | Ga0466713_104006 | 3300042602 | Bacteria | 1299 |
| 110 | Ga0466714_058160 | 3300042603 | Bacteria | 1481 |
| 111 | Ga0466717_005361 | 3300042604 | Unclassified | 1949 |
| 112 | Ga0466716_184887 | 3300042605 | Unclassified | 1341 |
| 113 | Ga0466722_169591 | 3300042609 | Bacteria | 6808 |
| 114 | Ga0466722_263459 | 3300042609 | Bacteria | 1210 |
| 115 | Ga0466697_002351 | 3300042611 | Unclassified | 1071 |
| 116 | Ga0466703_122128 | 3300042636 | Bacteria | 7487 |
| 117 | Ga0466703_276653 | 3300042636 | Bacteria | 5771 |
| 118 | Ga0466703_287852 | 3300042636 | Unclassified | 11417 |
| 119 | Ga0466703_418593 | 3300042636 | Bacteria | 4356 |
| 120 | Ga0466704_121841 | 3300042643 | Bacteria | 12540 |
| 121 | Ga0466724_47761 | 3300042649 | Bacteria | 163277 |
| 122 | Ga0466708_175756 | 3300042652 | Bacteria | 21252 |
| 123 | Ga0466725_211762 | 3300042654 | Bacteria | 62408 |
| 124 | Ga0466727_041923 | 3300042655 | Bacteria | 21720 |
| 125 | Ga0466727_069849 | 3300042655 | Unclassified | 1958 |
| 126 | IMNBL1DRAFT_c0007253 | 3300000062 | Bacteria | 5869 |
| 127 | JGI24698J34947_10233748 | 3300002449 | Unclassified | 697 |
| 128 | JGI24702J35022_10001803 | 3300002462 | Unclassified | 13195 |
| 129 | JGI24702J35022_10013016 | 3300002462 | Unclassified | 4613 |
| 130 | JGI24702J35022_11004367 | 3300002462 | Unclassified | 519 |
| 131 | Ga0127649_101303 | 3300009460 | Bacteria | 65750 |
| 132 | Ga0123357_10000007 | 3300009784 | Bacteria | 257289 |
| 133 | Ga0466705_056392 | 3300042612 | Bacteria | 28280 |
| 134 | Ga0466732_253018 | 3300042656 | Unclassified | 2627 |
| 135 | Ga0160457_1000022 | 3300012858 | Bacteria | 339795 |
| 136 | Ga0160457_1001554 | 3300012858 | Bacteria | 6147 |
| 137 | Ga0466656_020616 | 3300042550 | Unclassified | 1036 |
| 138 | Ga0466656_380573 | 3300042550 | Unclassified | 2783 |
| 139 | Ga0466657_351789 | 3300042582 | Bacteria | 55510 |
| 140 | Ga0466690_183549 | 3300042590 | Unclassified | 3276 |
| 141 | Ga0466693_439873 | 3300042592 | Bacteria | 186295 |
| 142 | Ga0466696_481607 | 3300042596 | Bacteria | 13935 |
| 143 | Ga0466699_154582 | 3300042597 | Unclassified | 1376 |
| 144 | Ga0466711_319118 | 3300042615 | Bacteria | 3959 |
| 145 | Ga0466711_402154 | 3300042615 | Bacteria | 17656 |
| 146 | Ga0466715_154331 | 3300042616 | Bacteria | 6031 |
| 147 | Ga0466715_376733 | 3300042616 | Bacteria | 17373 |
| 148 | Ga0466726_013143 | 3300042619 | Bacteria | 12145 |
| 149 | Ga0466729_192010 | 3300042621 | Bacteria | 1796 |
| 150 | Ga0123357_10005386 | 3300009784 | Bacteria | 15311 |
| 151 | Ga0123355_10856257 | 3300009826 | Bacteria | 999 |
| 152 | Ga0123355_11102504 | 3300009826 | Unclassified | 825 |
| 153 | Ga0123356_10509489 | 3300010049 | Unclassified | 1360 |
| 154 | Ga0123356_10997715 | 3300010049 | Bacteria | 1007 |
| 155 | Ga0123356_11353279 | 3300010049 | Unclassified | 874 |
| 156 | Ga0123353_10045675 | 3300010167 | Bacteria | 6954 |
| 157 | Ga0123353_11258904 | 3300010167 | Bacteria | 965 |
| 158 | Ga0123353_11415520 | 3300010167 | Unclassified | 892 |
| 159 | Ga0123354_10127392 | 3300010882 | Bacteria | 3241 |
| 160 | Ga0466706_134819 | 3300042599 | Bacteria | 9924 |
| 161 | Ga0466707_129170 | 3300042601 | Bacteria | 5791 |
| 162 | Ga0466713_062852 | 3300042602 | Bacteria | 4436 |
| 163 | Ga0466713_089366 | 3300042602 | Bacteria | 9909 |
| 164 | Ga0466713_127795 | 3300042602 | Bacteria | 20441 |
| 165 | Ga0466714_026831 | 3300042603 | Unclassified | 7575 |
| 166 | Ga0466714_044318 | 3300042603 | Bacteria | 3064 |
| 167 | Ga0466714_163141 | 3300042603 | Unclassified | 1478 |
| 168 | Ga0466716_137613 | 3300042605 | Bacteria | 2664 |
| 169 | Ga0466719_001354 | 3300042606 | Unclassified | 1035 |
| 170 | Ga0466721_195668 | 3300042608 | Bacteria | 2838 |
| 171 | Ga0466729_220935 | 3300042621 | Bacteria | 5071 |
| 172 | Ga0466734_037895 | 3300042623 | Bacteria | 1031 |
| 173 | Ga0466735_063781 | 3300042624 | Bacteria | 2689 |
| 174 | Ga0466724_09429 | 3300042649 | Bacteria | 389876 |
| 175 | Ga0466708_160115 | 3300042652 | Unclassified | 10381 |
| 176 | Ga0466725_460307 | 3300042654 | Unclassified | 2905 |
| 177 | Ga0466727_307144 | 3300042655 | Bacteria | 1661 |
| 178 | IMNBL1DRAFT_c0009089 | 3300000062 | Bacteria | 4970 |
| 179 | HBC_ctgsDRAFT_1001018 | 3300000333 | Unclassified | 6099 |
| 180 | JGI24702J35022_10005614 | 3300002462 | Unclassified | 7317 |
| 181 | JGI24702J35022_10006618 | 3300002462 | Unclassified | 6690 |
| 182 | JGI24705J35276_12219918 | 3300002504 | Unclassified | 2234 |
| 183 | JGI24696J40584_12954552 | 3300002834 | Unclassified | 2658 |
| 184 | JGI24696J40584_12955105 | 3300002834 | Bacteria | 2763 |
| 185 | CVPL010W_10000233 | 3300002931 | Bacteria | 52424 |
| 186 | CVPL005L_10011724 | 3300002938 | Bacteria | 6742 |
| 187 | Ga0102736_1010464 | 3300007052 | Bacteria | 1586 |
| 188 | Ga0102739_1030780 | 3300007095 | Unclassified | 715 |
| 189 | Ga0103264_1000081 | 3300007188 | Bacteria | 56731 |
| 190 | Ga0103264_1000166 | 3300007188 | Bacteria | 38393 |
| 191 | Ga0103264_1000270 | 3300007188 | Bacteria | 28372 |
| 192 | Ga0466733_104255 | 3300042659 | Bacteria | 1708 |
| 193 | Ga0466733_186866 | 3300042659 | Bacteria | 153934 |
| 194 | Ga0160458_104714 | 3300012832 | Bacteria | 1647 |
| 195 | Ga0160472_100004 | 3300012839 | Bacteria | 753687 |
| 196 | Ga0160448_106013 | 3300012854 | Bacteria | 3086 |
| 197 | Ga0160435_1028834 | 3300012857 | Unclassified | 894 |
| 198 | Ga0255809_1041172 | 3300022820 | Unclassified | 502 |
| 199 | Ga0466690_182011 | 3300042590 | Unclassified | 5226 |
| 200 | Ga0466690_256340 | 3300042590 | Bacteria | 5461 |
| 201 | Ga0466692_171932 | 3300042591 | Bacteria | 367168 |
| 202 | Ga0466691_040690 | 3300042593 | Bacteria | 3743 |
| 203 | Ga0466694_112202 | 3300042594 | Unclassified | 1848 |
| 204 | Ga0466694_376172 | 3300042594 | Unclassified | 4858 |
| 205 | Ga0466696_177908 | 3300042596 | Bacteria | 11253 |
| 206 | Ga0466710_205907 | 3300042613 | Bacteria | 1150 |
| 207 | Ga0466711_117108 | 3300042615 | Bacteria | 4471 |
| 208 | Ga0466711_145131 | 3300042615 | Bacteria | 39663 |
| 209 | Ga0466715_348432 | 3300042616 | Unclassified | 1068 |
| 210 | Ga0466723_075676 | 3300042618 | Unclassified | 4914 |
| 211 | Ga0466728_082257 | 3300042620 | Bacteria | 106309 |
| 212 | Ga0466728_199563 | 3300042620 | Unclassified | 2707 |
| 213 | Ga0466728_395128 | 3300042620 | Bacteria | 5350 |
| 214 | Ga0123357_10136510 | 3300009784 | Bacteria | 3031 |
| 215 | Ga0123355_10446203 | 3300009826 | Unclassified | 1634 |
| 216 | Ga0123355_11162331 | 3300009826 | Unclassified | 793 |
| 217 | Ga0123356_10244920 | 3300010049 | Unclassified | 1866 |
| 218 | Ga0123356_10461199 | 3300010049 | Bacteria | 1420 |
| 219 | Ga0123356_10731127 | 3300010049 | Bacteria | 1159 |
| 220 | Ga0123353_10000490 | 3300010167 | Bacteria | 48867 |
| 221 | Ga0123354_10419942 | 3300010882 | Unclassified | 1112 |
| 222 | Ga0466701_049065 | 3300042598 | Bacteria | 2323 |
| 223 | Ga0466706_279696 | 3300042599 | Unclassified | 3231 |
| 224 | Ga0466700_479238 | 3300042600 | Bacteria | 20513 |
| 225 | Ga0466713_010317 | 3300042602 | Bacteria | 8281 |
| 226 | Ga0466713_030788 | 3300042602 | Bacteria | 1352 |
| 227 | Ga0466714_163829 | 3300042603 | Bacteria | 2797 |
| 228 | Ga0466719_211047 | 3300042606 | Unclassified | 3348 |
| 229 | Ga0466719_214496 | 3300042606 | Unclassified | 4626 |
| 230 | Ga0466722_176003 | 3300042609 | Bacteria | 44911 |
| 231 | Ga0466697_000635 | 3300042611 | Bacteria | 14006 |
| 232 | Ga0466731_008519 | 3300042622 | Unclassified | 2210 |
| 233 | Ga0466731_309755 | 3300042622 | Unclassified | 4858 |
| 234 | Ga0466735_122223 | 3300042624 | Bacteria | 2275 |
| 235 | Ga0466703_021693 | 3300042636 | Unclassified | 7598 |
| 236 | Ga0466704_183540 | 3300042643 | Bacteria | 1469 |
| 237 | Ga0466725_007978 | 3300042654 | Bacteria | 1265 |
| 238 | Ga0466725_097650 | 3300042654 | Bacteria | 4206 |
| 239 | Ga0466727_162580 | 3300042655 | Bacteria | 9266 |
| 240 | Ga0466727_247564 | 3300042655 | Bacteria | 21966 |
| 241 | JGI24705J35276_11900406 | 3300002504 | Unclassified | 751 |
| 242 | JGI24699J35502_10459999 | 3300002509 | Bacteria | 594 |
| 243 | CVPL010W_10003885 | 3300002931 | Bacteria | 16958 |
| 244 | Ga0068302_10032908 | 3300005071 | Unclassified | 3578 |
| 245 | Ga0072940_1212868 | 3300005200 | Bacteria | 1294 |
| 246 | Ga0103263_100909 | 3300007042 | Unclassified | 3952 |
| 247 | Ga0103264_1000027 | 3300007188 | Bacteria | 89570 |
| 248 | Ga0466732_005715 | 3300042656 | Bacteria | 91596 |
| 249 | Ga0466732_337544 | 3300042656 | Bacteria | 6394 |
| 250 | Ga0265387_1018691 | 3300024582 | Unclassified | 1016 |
| 251 | Ga0316159_10028 | 3300030930 | Bacteria | 37800 |
| 252 | Ga0466692_195075 | 3300042591 | Bacteria | 15006 |
| 253 | Ga0466693_109461 | 3300042592 | Bacteria | 182600 |
| 254 | Ga0466691_038469 | 3300042593 | Bacteria | 5074 |
| 255 | Ga0466691_052313 | 3300042593 | Bacteria | 16873 |
| 256 | Ga0466694_071777 | 3300042594 | Unclassified | 2267 |
| 257 | Ga0466694_117566 | 3300042594 | Bacteria | 2008 |
| 258 | Ga0466695_062450 | 3300042595 | Bacteria | 1541 |
| 259 | Ga0466715_165590 | 3300042616 | Unclassified | 3605 |
| 260 | Ga0466715_411282 | 3300042616 | Bacteria | 7095 |
| 261 | Ga0466723_018855 | 3300042618 | Bacteria | 15901 |
| 262 | Ga0123357_10505602 | 3300009784 | Bacteria | 1000 |
| 263 | Ga0123355_10076527 | 3300009826 | Unclassified | 5352 |
| 264 | Ga0123356_10156521 | 3300010049 | Bacteria | 2270 |
| 265 | Ga0123356_12291576 | 3300010049 | Unclassified | 675 |
| 266 | Ga0123356_13804920 | 3300010049 | Bacteria | 521 |
| 267 | Ga0123353_10149945 | 3300010167 | Bacteria | 3724 |
| 268 | Ga0123353_10651052 | 3300010167 | Unclassified | 1491 |
| 269 | Ga0123353_11100494 | 3300010167 | Unclassified | 1055 |
| 270 | Ga0123353_12103559 | 3300010167 | Bacteria | 687 |
| 271 | Ga0123353_12559905 | 3300010167 | Bacteria | 605 |
| 272 | Ga0123354_10115975 | 3300010882 | Bacteria | 3497 |
| 273 | Ga0123354_10417675 | 3300010882 | Unclassified | 1118 |
| 274 | Ga0466706_002466 | 3300042599 | Bacteria | 39380 |
| 275 | Ga0466706_080441 | 3300042599 | Bacteria | 247551 |
| 276 | Ga0466706_117973 | 3300042599 | Bacteria | 1365 |
| 277 | Ga0466706_142051 | 3300042599 | Bacteria | 39569 |
| 278 | Ga0466707_224027 | 3300042601 | Bacteria | 2405 |
| 279 | Ga0466707_297878 | 3300042601 | Bacteria | 29546 |
| 280 | Ga0466714_157821 | 3300042603 | Bacteria | 9563 |
| 281 | Ga0466719_268013 | 3300042606 | Bacteria | 12719 |
| 282 | Ga0466722_172519 | 3300042609 | Bacteria | 3764 |
| 283 | Ga0466722_208670 | 3300042609 | Bacteria | 9951 |
| 284 | Ga0466734_004940 | 3300042623 | Unclassified | 1043 |
| 285 | Ga0466734_032852 | 3300042623 | Bacteria | 2634 |
| 286 | Ga0466734_062471 | 3300042623 | Bacteria | 1708 |
| 287 | Ga0466703_031968 | 3300042636 | Bacteria | 28293 |
| 288 | Ga0466703_120828 | 3300042636 | Unclassified | 3922 |
| 289 | Ga0466704_524158 | 3300042643 | Bacteria | 6041 |
| 290 | Ga0466709_165161 | 3300042648 | Bacteria | 19220 |
| 291 | Ga0466709_192258 | 3300042648 | Bacteria | 165099 |
| 292 | IMNBL1DRAFT_c0033513 | 3300000062 | Bacteria | 1838 |
| 293 | HBC_ctgsDRAFT_1116592 | 3300000333 | Bacteria | 607 |
| 294 | JGI24702J35022_10007650 | 3300002462 | Bacteria | 6175 |
| 295 | JGI24702J35022_10062668 | 3300002462 | Unclassified | 1992 |
| 296 | JGI24705J35276_11828290 | 3300002504 | Unclassified | 701 |
| 297 | JGI24705J35276_12073545 | 3300002504 | Unclassified | 958 |
| 298 | CVPL010L_1000004 | 3300002932 | Bacteria | 122747 |
| 299 | Ga0052165_100010 | 3300003131 | Bacteria | 20162 |
| 300 | Ga0063521_1000464 | 3300003973 | Bacteria | 20104 |
| 301 | Ga0068302_10674021 | 3300005071 | Bacteria | 539 |
| 302 | Ga0103266_1000060 | 3300007067 | Bacteria | 67164 |
| 303 | Ga0102734_1000333 | 3300007129 | Bacteria | 14132 |
| 304 | Ga0102737_1007977 | 3300007142 | Unclassified | 1897 |
| 305 | Ga0105004_1071240 | 3300007763 | Bacteria | 6925 |
| 306 | Ga0466697_106251 | 3300042611 | Bacteria | 2630 |
| 307 | Ga0466697_183987 | 3300042611 | Unclassified | 2804 |
| 308 | Ga0466732_426027 | 3300042656 | Unclassified | 1261 |
| 309 | Ga0466733_095726 | 3300042659 | Bacteria | 5141 |
| 310 | Ga0466733_164789 | 3300042659 | Bacteria | 2295 |
| 311 | Ga0160468_100026 | 3300012819 | Bacteria | 270033 |
| 312 | Ga0160445_132553 | 3300012847 | Bacteria | 629 |
| 313 | Ga0160448_120717 | 3300012854 | Bacteria | 1070 |
| 314 | Ga0223678_1001617 | 3300021222 | Bacteria | 727 |
| 315 | Ga0264413_128012 | 3300024493 | Bacteria | 7346 |
| 316 | Ga0265387_1001475 | 3300024582 | Unclassified | 3450 |
| 317 | Ga0265387_1038640 | 3300024582 | Bacteria | 809 |
| 318 | Ga0309902_000009 | 3300028910 | Bacteria | 101841 |
| 319 | Ga0466690_060607 | 3300042590 | Unclassified | 2246 |
| 320 | Ga0466691_087879 | 3300042593 | Bacteria | 11574 |
| 321 | Ga0466696_443545 | 3300042596 | Unclassified | 6085 |
| 322 | Ga0466710_418252 | 3300042613 | Unclassified | 1697 |
| 323 | Ga0466711_222029 | 3300042615 | Bacteria | 12497 |
| 324 | Ga0466711_410435 | 3300042615 | Bacteria | 5552 |
| 325 | Ga0466723_077027 | 3300042618 | Bacteria | 10260 |
| 326 | Ga0466723_277057 | 3300042618 | Unclassified | 2686 |
| 327 | Ga0466726_331300 | 3300042619 | Unclassified | 1218 |
| 328 | Ga0466728_093166 | 3300042620 | Bacteria | 80427 |
| 329 | Ga0466728_152777 | 3300042620 | Unclassified | 6956 |
| 330 | Ga0466728_399272 | 3300042620 | Bacteria | 209367 |
| 331 | Ga0123357_10145017 | 3300009784 | Unclassified | 2904 |
| 332 | Ga0123355_10115452 | 3300009826 | Unclassified | 4181 |
| 333 | Ga0123356_10034698 | 3300010049 | Bacteria | 4714 |
| 334 | Ga0123356_10092691 | 3300010049 | Unclassified | 2881 |
| 335 | Ga0123356_10108959 | 3300010049 | Unclassified | 2672 |
| 336 | Ga0123356_10237754 | 3300010049 | Unclassified | 1891 |
| 337 | Ga0123356_11245630 | 3300010049 | Unclassified | 909 |
| 338 | Ga0123356_11636274 | 3300010049 | Bacteria | 798 |
| 339 | Ga0123356_12164636 | 3300010049 | Bacteria | 695 |
| 340 | Ga0123356_12210457 | 3300010049 | Bacteria | 688 |
| 341 | Ga0123353_10000002 | 3300010167 | Bacteria | 351672 |
| 342 | Ga0123353_10044318 | 3300010167 | Bacteria | 7051 |
| 343 | Ga0123353_10334526 | 3300010167 | Bacteria | 2290 |
| 344 | Ga0123353_10480562 | 3300010167 | Bacteria | 1818 |
| 345 | Ga0123353_10798813 | 3300010167 | Unclassified | 1303 |
| 346 | Ga0123353_12460814 | 3300010167 | Unclassified | 621 |
| 347 | Ga0123354_10291852 | 3300010882 | Bacteria | 1561 |
| 348 | Ga0123354_10649249 | 3300010882 | Unclassified | 754 |
| 349 | Ga0466706_161384 | 3300042599 | Bacteria | 41570 |
| 350 | Ga0466713_082461 | 3300042602 | Bacteria | 15773 |
| 351 | Ga0466714_142977 | 3300042603 | Unclassified | 1191 |
| 352 | Ga0466717_037676 | 3300042604 | Unclassified | 2142 |
| 353 | Ga0466717_245369 | 3300042604 | Bacteria | 1741 |
| 354 | Ga0466716_029249 | 3300042605 | Unclassified | 2403 |
| 355 | Ga0466716_438524 | 3300042605 | Bacteria | 7482 |
| 356 | Ga0466734_030594 | 3300042623 | Bacteria | 22089 |
| 357 | Ga0466703_059053 | 3300042636 | Bacteria | 5617 |
| 358 | Ga0466703_110878 | 3300042636 | Bacteria | 2669 |
| 359 | Ga0466703_130526 | 3300042636 | Bacteria | 5845 |
| 360 | Ga0466704_207886 | 3300042643 | Bacteria | 14092 |
| 361 | Ga0466709_084610 | 3300042648 | Bacteria | 13859 |
| 362 | Ga0466724_58610 | 3300042649 | Bacteria | 376410 |
| 363 | 2227480167 | 2225789004 | Bacteria | 99470 |
| 364 | 2227556028 | 2225789004 | Bacteria | 2786 |
| 365 | IMNBL1DRAFT_c0018465 | 3300000062 | Bacteria | 2899 |
| 366 | IMNBL1DRAFT_c0124939 | 3300000062 | Unclassified | 674 |
| 367 | JGI24705J35276_12034093 | 3300002504 | Bacteria | 893 |
| 368 | Ga0072941_1041787 | 3300005201 | Bacteria | 7104 |
| 369 | Ga0074278_109074 | 3300005721 | Bacteria | 58903 |
| 370 | Ga0102736_1000056 | 3300007052 | Bacteria | 29275 |
| 371 | Ga0103265_1000011 | 3300007068 | Bacteria | 44046 |
| 372 | Ga0102735_1001386 | 3300007080 | Unclassified | 4182 |
| 373 | Ga0103261_1012522 | 3300007083 | Bacteria | 1179 |
| 374 | Ga0102734_1003400 | 3300007129 | Bacteria | 7551 |
| 375 | Ga0104048_1002757 | 3300007143 | Bacteria | 2665 |
| 376 | Ga0466697_091886 | 3300042611 | Unclassified | 2996 |
| 377 | Ga0466705_027153 | 3300042612 | Bacteria | 9480 |
| 378 | Ga0466732_270034 | 3300042656 | Bacteria | 4368 |
| 379 | Ga0466733_130547 | 3300042659 | Unclassified | 2918 |
| 380 | Ga0466733_198403 | 3300042659 | Bacteria | 1986 |
| 381 | Ga0590801_09552 | 3300060777 | Bacteria | 673 |
| 382 | Ga0160456_103848 | 3300012820 | Unclassified | 2135 |
| 383 | Ga0160472_100123 | 3300012839 | Bacteria | 122373 |
| 384 | Ga0160447_134475 | 3300012849 | Bacteria | 630 |
| 385 | Ga0157631_111115 | 3300013007 | Bacteria | 1276 |
| 386 | Ga0415639_007901 | 3300038395 | Unclassified | 6228 |
| 387 | Ga0466657_141441 | 3300042582 | Bacteria | 1538 |
| 388 | Ga0466692_091832 | 3300042591 | Bacteria | 55079 |
| 389 | Ga0466691_006564 | 3300042593 | Bacteria | 5194 |
| 390 | Ga0466691_019370 | 3300042593 | Unclassified | 7975 |
| 391 | Ga0466691_096111 | 3300042593 | Bacteria | 4137 |
| 392 | Ga0466691_220517 | 3300042593 | Bacteria | 18441 |
| 393 | Ga0466694_283409 | 3300042594 | Bacteria | 2392 |
| 394 | Ga0466696_092398 | 3300042596 | Bacteria | 31103 |
| 395 | Ga0466710_022453 | 3300042613 | Bacteria | 25234 |
| 396 | Ga0466710_044175 | 3300042613 | Unclassified | 1145 |
| 397 | Ga0466712_083617 | 3300042614 | Bacteria | 3294 |
| 398 | Ga0466715_411803 | 3300042616 | Bacteria | 24002 |
| 399 | Ga0466718_028031 | 3300042617 | Bacteria | 1252 |
| 400 | Ga0466723_120151 | 3300042618 | Bacteria | 33261 |
| 401 | Ga0466728_065619 | 3300042620 | Bacteria | 98744 |
| 402 | Ga0466728_207475 | 3300042620 | Bacteria | 3653 |
| 403 | Ga0466728_279048 | 3300042620 | Unclassified | 3119 |
| 404 | Ga0123357_10500578 | 3300009784 | Unclassified | 1009 |
| 405 | Ga0123356_10044970 | 3300010049 | Bacteria | 4109 |
| 406 | Ga0123356_10205204 | 3300010049 | Unclassified | 2014 |
| 407 | Ga0123356_10363065 | 3300010049 | Unclassified | 1576 |
| 408 | Ga0123356_11203735 | 3300010049 | Unclassified | 923 |
| 409 | Ga0123356_13066991 | 3300010049 | Unclassified | 583 |
| 410 | Ga0123353_12962037 | 3300010167 | Unclassified | 551 |
| 411 | Ga0466700_282045 | 3300042600 | Unclassified | 2694 |
| 412 | Ga0466713_015624 | 3300042602 | Bacteria | 9258 |
| 413 | Ga0466714_017911 | 3300042603 | Bacteria | 1491 |
| 414 | Ga0466714_029945 | 3300042603 | Bacteria | 10098 |
| 415 | Ga0466714_049043 | 3300042603 | Bacteria | 1256 |
| 416 | Ga0466714_089055 | 3300042603 | Bacteria | 9374 |
| 417 | Ga0466717_011477 | 3300042604 | Unclassified | 2005 |
| 418 | Ga0466716_448839 | 3300042605 | Bacteria | 1404 |
| 419 | Ga0466697_051642 | 3300042611 | Bacteria | 1408 |
| 420 | Ga0466734_124068 | 3300042623 | Bacteria | 1011 |
| 421 | Ga0466735_031188 | 3300042624 | Unclassified | 7063 |
| 422 | Ga0466703_021762 | 3300042636 | Unclassified | 1066 |
| 423 | Ga0466704_617585 | 3300042643 | Bacteria | 11742 |
| 424 | Ga0466727_001491 | 3300042655 | Bacteria | 3382 |
| 425 | Ga0466727_204171 | 3300042655 | Unclassified | 1152 |
| 426 | IMNBL1DRAFT_c0015335 | 3300000062 | Bacteria | 3328 |
| 427 | IMNBL1DRAFT_c0020983 | 3300000062 | Unclassified | 2627 |
| 428 | IMNBL1DRAFT_c0026389 | 3300000062 | Unclassified | 2206 |
| 429 | JGI24698J34947_10233572 | 3300002449 | Unclassified | 697 |
| 430 | JGI24702J35022_10676435 | 3300002462 | Unclassified | 641 |
| 431 | JGI24705J35276_11462989 | 3300002504 | Unclassified | 545 |
| 432 | JGI24705J35276_12056153 | 3300002504 | Unclassified | 927 |
| 433 | JGI24705J35276_12084817 | 3300002504 | Bacteria | 981 |
| 434 | JGI24705J35276_12090957 | 3300002504 | Unclassified | 995 |
| 435 | JGI24705J35276_12234366 | 3300002504 | Bacteria | 5456 |
| 436 | JGI24696J40584_12412073 | 3300002834 | Bacteria | 559 |
| 437 | JGI24696J40584_12898656 | 3300002834 | Bacteria | 1171 |
| 438 | CVPL005L_10016436 | 3300002938 | Unclassified | 4543 |
| 439 | Ga0072941_1134067 | 3300005201 | Bacteria | 6588 |
| 440 | Ga0102738_1000072 | 3300007141 | Bacteria | 40458 |
| 441 | Ga0103264_1018684 | 3300007188 | Bacteria | 3382 |
| 442 | Ga0103267_1047061 | 3300007190 | Unclassified | 1419 |
| 443 | Ga0466705_137022 | 3300042612 | Unclassified | 4333 |
| 444 | Ga0466733_119239 | 3300042659 | Bacteria | 24180 |
| 445 | Ga0160433_100002 | 3300012846 | Bacteria | 625007 |
| 446 | Ga0309901_1000019 | 3300028918 | Bacteria | 429099 |
| 447 | Ga0309904_1000020 | 3300029810 | Bacteria | 23208 |
| 448 | Ga0415639_145508 | 3300038395 | Unclassified | 1326 |
| 449 | Ga0466657_330543 | 3300042582 | Bacteria | 2173 |
| 450 | Ga0466693_101578 | 3300042592 | Unclassified | 3304 |
| 451 | Ga0466691_012800 | 3300042593 | Bacteria | 55247 |
| 452 | Ga0466696_048088 | 3300042596 | Bacteria | 9133 |
| 453 | Ga0466715_117797 | 3300042616 | Unclassified | 11582 |
| 454 | Ga0466715_371462 | 3300042616 | Bacteria | 29074 |
| 455 | Ga0466728_071004 | 3300042620 | Unclassified | 9163 |
| 456 | Ga0466729_008090 | 3300042621 | Bacteria | 6104 |
| 457 | Ga0123357_10107560 | 3300009784 | Unclassified | 3571 |
| 458 | Ga0123356_10216746 | 3300010049 | Unclassified | 1968 |
| 459 | Ga0123356_10792765 | 3300010049 | Unclassified | 1118 |
| 460 | Ga0123356_11958107 | 3300010049 | Unclassified | 730 |
| 461 | Ga0123353_10021295 | 3300010167 | Bacteria | 9727 |
| 462 | Ga0123353_10287415 | 3300010167 | Unclassified | 2520 |
| 463 | Ga0123353_10295016 | 3300010167 | Bacteria | 2479 |
| 464 | Ga0123353_10378965 | 3300010167 | Bacteria | 2117 |
| 465 | Ga0123354_10097407 | 3300010882 | Bacteria | 4008 |
| 466 | Ga0123354_10318032 | 3300010882 | Bacteria | 1441 |
| 467 | Ga0123354_10546219 | 3300010882 | Bacteria | 876 |
| 468 | Ga0466701_052131 | 3300042598 | Bacteria | 6147 |
| 469 | Ga0466701_055627 | 3300042598 | Bacteria | 218820 |
| 470 | Ga0466706_132532 | 3300042599 | Bacteria | 1975 |
| 471 | Ga0466714_009885 | 3300042603 | Bacteria | 4065 |
| 472 | Ga0466714_074198 | 3300042603 | Bacteria | 829090 |
| 473 | Ga0466717_026136 | 3300042604 | Unclassified | 1226 |
| 474 | Ga0466717_049853 | 3300042604 | Bacteria | 2309 |
| 475 | Ga0466717_208803 | 3300042604 | Bacteria | 1097 |
| 476 | Ga0466716_049258 | 3300042605 | Bacteria | 9806 |
| 477 | Ga0466716_475296 | 3300042605 | Bacteria | 9321 |
| 478 | Ga0466719_502339 | 3300042606 | Unclassified | 2295 |
| 479 | Ga0466698_272491 | 3300042610 | Unclassified | 2671 |
| 480 | Ga0466704_217206 | 3300042643 | Bacteria | 87649 |
| 481 | Ga0466724_09922 | 3300042649 | Bacteria | 1805 |
| 482 | Ga0466724_31046 | 3300042649 | Bacteria | 1392 |
| 483 | Ga0466708_132874 | 3300042652 | Bacteria | 15716 |
| 484 | Ga0466708_183984 | 3300042652 | Bacteria | 148491 |
| 485 | Ga0466708_228583 | 3300042652 | Bacteria | 25073 |
| 486 | Ga0466708_381158 | 3300042652 | Bacteria | 6389 |
| 487 | AglaG_GDN60OX02FKEET | 2084038013 | Bacteria | 515 |
| 488 | IMNBL1DRAFT_c0008435 | 3300000062 | Unclassified | 5244 |
| 489 | IMNBL1DRAFT_c0055834 | 3300000062 | Bacteria | 1214 |
| 490 | Meta3P_1002985 | 3300002464 | Bacteria | 31909 |
| 491 | WW0001_100604 | 3300002732 | Unclassified | 4581 |
| 492 | Ga0103265_1008800 | 3300007068 | Bacteria | 1329 |
| 493 | Ga0103267_1000113 | 3300007190 | Bacteria | 30309 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00453 | Ribosomal_L20 | Ribosomal protein L20 | 3 | 109 | 0.99 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.