Protein Family IF01847
Metagenome
Isolate
263
Members
187
Samples
125
Scaffolds
384.48
Avg Length
Representative Sequence
- ID
- 3300007188|Ga0103264_1000208|Ga0103264_100020853
- Length
- 412 aa
- Sequence
- MDFELNDEQRAFADTARQFAMQAMAPHASQWDAEGIFPIDVIRAAGELGFCGLYANPDHGGLGLPRLDATLVFEALAEVCPSTTAYLTIHNMVNWMITTFARTDVAAQWGPRLSSGAQLGSYCLTEPGAGSDAASLITSARRDGDDYVINGTKAFISGAGATDVLVLMARTGGYGRKEEKMGWNSQPTRTITFEDVRIPAVNLLGQEGEGFRIAMKGLDGGRINIATCSVGAAQGALQAAHAHLQERKQFGKQLADFQALQFRLAEMTTQLVAARHMVRLAAVKLDAAHPDATTYCAMAKMFATDAGFRVCNDALQLHGGYGYIREYPLERWLRDTRVHQILEGTNEIMRLIISRRVLSAGDSALKRVTTRRSPQVTRTDTTSCLHRSEHAPFGFAHGREPAKSGLPGHGL*
Sample Types
Isolate
52.5%
Metagenome
47.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
32.9%
Elmidae
16.5%
Formicidae
8.2%
Culicidae
8.2%
Termitidae
8.2%
Armadillidiidae
5.3%
Curculionidae
2.9%
Drosophilidae
2.9%
Palinuridae
1.8%
Kalotermitidae
1.8%
Talitridae
1.8%
Daphniidae
1.2%
Cambaridae
1.2%
Hydrophilidae
1.2%
Trigoniulidae
0.6%
Nephropidae
0.6%
Crambidae
0.6%
Kiwaidae
0.6%
Lysianassidae
0.6%
Penaeidae
0.6%
Tenebrionidae
0.6%
Artemiidae
0.6%
Apidae
0.6%
Majidae
0.6%
Taxonomy
Archaea
0
Bacteria
231
Eukaryota
0
Viruses
0
Unclassified
32
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2511231129 | Vibrio sp. EJY3 | Isolate | Unclassified |
| 2 | 2565956518 | Vibrio pacinii DSM 19139 | Isolate | Unclassified |
| 3 | 2600255074 | Vibrio proteolyticus NBRC 13287 | Isolate | Unclassified |
| 4 | 2693429575 | Vibrio parahaemolyticus ISF-54-12 | Isolate | Unclassified |
| 5 | 2811995047 | Flavobacterium succinicans DD5b | Isolate | Daphniidae |
| 6 | 2864761044 | Stenotrophomonas rhizophilia S00008 | Isolate | Elmidae |
| 7 | 2864831662 | Chryseobacterium sediminis S00068 | Isolate | Elmidae |
| 8 | 2902896024 | Pseudoalteromonas sp. S1612 | Isolate | Unclassified |
| 9 | 2904728850 | Flavobacterium sp. xlx-214 | Isolate | |
| 10 | 2908136803 | Vibrio owensii 1700302 | Isolate | Unclassified |
| 11 | 2997380424 | Vibrio parahaemolyticus MVP1 | Isolate | Unclassified |
| 12 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 13 | 640963010 | Vibrio harveyi HY01 | Isolate | Unclassified |
| 14 | 8011357093 | Pseudomonas schmalbachii Milli4 | Isolate | Trigoniulidae |
| 15 | 8020009074 | Elizabethkingia anophelis MSU001 | Isolate | Culicidae |
| 16 | 8033364368 | Vibrio panuliri LBS 2 | Isolate | Nephropidae |
| 17 | 8100455565 | Delftia sp. S67 | Isolate | Curculionidae |
| 18 | 2531839005 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 19 | 2648501158 | Vibrio hepatarius DSM 19134 | Isolate | Unclassified |
| 20 | 2663763317 | Vibrio parahaemolyticus ISF-94-1 | Isolate | Unclassified |
| 21 | 2855798354 | Achromobacter insolitus AR476-2 | Isolate | Crambidae |
| 22 | 2864926767 | Pseudomonas nitritireducens S00179 | Isolate | Elmidae |
| 23 | 2889908211 | Bowmanella denitrificans JL63 | Isolate | Unclassified |
| 24 | 2912570088 | Vibrio parahaemolyticus CHN25 | Isolate | |
| 25 | 2921902974 | Chryseobacterium sp. cx-624 | Isolate | Cambaridae |
| 26 | 2958471994 | Flavobacterium sp. xlx-221 | Isolate | Cambaridae |
| 27 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 28 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 29 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 30 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 31 | 3300013007 | Symbiotic microbial communities associated with the hydrothermal yeti crab kiwa sp. n. from the East Pacific Rise in the East Pacific Ocean - crab 1, guts | Metagenome | Kiwaidae |
| 32 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 33 | 8051551332 | Vibrio vulnificus Vv003 | Isolate | |
| 34 | 8100449422 | Delftia sp. S66 | Isolate | Curculionidae |
| 35 | 2518285616 | Brachymonas chironomi DSM 19884 | Isolate | Unclassified |
| 36 | 2571042554 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 37 | 2603880170 | Burkholderiales A2 | Isolate | Unclassified |
| 38 | 2671180705 | Pseudoalteromonas piscicida S2040 | Isolate | Unclassified |
| 39 | 2873565274 | Diaphorobacter sp. HDW4A | Isolate | Hydrophilidae |
| 40 | 2998907766 | Penaeicola halotolerans LMIT005 | Isolate | |
| 41 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 42 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 43 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 44 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 45 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 46 | 8033368880 | Vibrio panuliri CAIM 1902 | Isolate | Palinuridae |
| 47 | 2524614573 | Marinospirillum minutulum DSM 6287 | Isolate | Unclassified |
| 48 | 2529292732 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 49 | 2648501820 | Vibrio nigripulchritudo BLFn1 | Isolate | Unclassified |
| 50 | 2667527830 | Vibrio parahaemolyticus ISF-29-3 | Isolate | Unclassified |
| 51 | 2681813507 | Insolitispirillum peregrinum integrum DSM 11589 | Isolate | Unclassified |
| 52 | 2687453742 | Burkholderiales bacterium B_Cag20 | Isolate | Unclassified |
| 53 | 2700989396 | Vibrio parahaemolyticus ISF-77-01 | Isolate | Unclassified |
| 54 | 2718218155 | Flavobacteriaceae bacterium UJ101 | Isolate | |
| 55 | 2785510762 | Vibrio parahaemolyticus VP14 | Isolate | Unclassified |
| 56 | 2833478085 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 57 | 2864859030 | Chromobacterium alkanivorans S00115 | Isolate | Elmidae |
| 58 | 2864866972 | Brevundimonas bullata S00123 | Isolate | Elmidae |
| 59 | 2864878056 | Flavobacterium notoginsengisoli S00128 | Isolate | Elmidae |
| 60 | 2864886855 | Flavobacterium nitrogenifigens S00142 | Isolate | Elmidae |
| 61 | 2864944480 | Pseudomonas fluvialis S00202 | Isolate | Elmidae |
| 62 | 2864960361 | Comamonas odontotermitis S00229 | Isolate | Elmidae |
| 63 | 2868169047 | Comamonas aquatica S00077 | Isolate | Elmidae |
| 64 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 65 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 66 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 67 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 68 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 69 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 70 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 71 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 72 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 73 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 74 | 8008122225 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 75 | 8042061949 | Vibrio harveyi Hep-2a-10 | Isolate | Unclassified |
| 76 | 8100461708 | Delftia sp. S65 | Isolate | Curculionidae |
| 77 | 8114076984 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 78 | 2501651205 | Colwellia sp. MT41 | Isolate | Lysianassidae |
| 79 | 2609459958 | Vibrio nigripulchritudo Wn13 | Isolate | Unclassified |
| 80 | 2636415542 | Vibrio nigripulchritudo SFn135 | Isolate | Unclassified |
| 81 | 2654587515 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 82 | 2820059968 | Unclassified Proteobacteria Nt197P4bin23 | Isolate | Unclassified |
| 83 | 2858407585 | Photobacterium swingsii DSM 24669 | Isolate | Unclassified |
| 84 | 2864764899 | Aeromonas fluvialis S00019 | Isolate | Elmidae |
| 85 | 2864768727 | Aeromonas veronii S00020 | Isolate | Elmidae |
| 86 | 2864788197 | Elizabethkingia anophelis S00027 | Isolate | Elmidae |
| 87 | 2864822740 | Chryseobacterium shigense S00064 | Isolate | Elmidae |
| 88 | 2864826666 | Acidovorax konjaci S00067 | Isolate | Elmidae |
| 89 | 2873571580 | Diaphorobacter sp. HDW4B | Isolate | Hydrophilidae |
| 90 | 2880115952 | Vibrio parahaemolyticus PB1937 | Isolate | Unclassified |
| 91 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 92 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 93 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 94 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 95 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 96 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 97 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 98 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 99 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 100 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 101 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 102 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 103 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 104 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 105 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 106 | 8048928574 | Photobacterium swingsii CECT 7576 | Isolate | Unclassified |
| 107 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 108 | 2585428048 | Colwellia sp. NBT2012 | Isolate | |
| 109 | 2731957638 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 110 | 2864791955 | Aeromonas veronii S00030 | Isolate | Elmidae |
| 111 | 2864847319 | Pseudomonas alcaligenes S00099 | Isolate | Elmidae |
| 112 | 2864914039 | Chromobacterium alkanivorans S00172 | Isolate | Elmidae |
| 113 | 2864923010 | Elizabethkingia anophelis S00177 | Isolate | Elmidae |
| 114 | 2864988360 | Chromobacterium alkanivorans S00296 | Isolate | Elmidae |
| 115 | 2875320051 | Vibrio parahaemolyticus 160807 | Isolate | Unclassified |
| 116 | 2877638525 | Vibrio campbellii 1114GL | Isolate | Penaeidae |
| 117 | 2877647439 | Vibrio parahaemolyticus R13 | Isolate | Unclassified |
| 118 | 2896925746 | Vibrio nigripulchritudo SFn27 | Isolate | Unclassified |
| 119 | 2899132286 | Myroides albus BIT-d1 | Isolate | Tenebrionidae |
| 120 | 2989793055 | Vibrio atypicus DSM 25292 | Isolate | Unclassified |
| 121 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 122 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 123 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 124 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 125 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 126 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 127 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 128 | 8022096067 | Vibrio sp. SALL6 | Isolate | Unclassified |
| 129 | 8051461712 | Vibrio vulnificus Vv002 | Isolate | |
| 130 | 8060845732 | Vibrio vulnificus Vv006 | Isolate | |
| 131 | 2571042430 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 132 | 2590828803 | Pedobacter glucosidilyticus DD6b | Isolate | Daphniidae |
| 133 | 2627854002 | Vibrio nigripulchritudo ENn2 | Isolate | Unclassified |
| 134 | 2711768158 | Vibrio coralliilyticus S2043 | Isolate | Unclassified |
| 135 | 2850895757 | Vibrio campbellii 170502 | Isolate | Unclassified |
| 136 | 2860776474 | Vibrio parahaemolyticus R14 | Isolate | Unclassified |
| 137 | 2864870719 | Comamonas odontotermitis S00124 | Isolate | Elmidae |
| 138 | 2864903489 | Pseudomonas aeuginosa S00161 | Isolate | Elmidae |
| 139 | 2864937364 | Acidovorax soli S00198 | Isolate | Elmidae |
| 140 | 2864948220 | Elizabethkingia anophelis S00205 | Isolate | Elmidae |
| 141 | 2872471378 | Vibrio owensii V180403 | Isolate | Unclassified |
| 142 | 2891720358 | Azoarcus nasutitermitis CC-YHH838 | Isolate | Unclassified |
| 143 | 2902916284 | Pseudoalteromonas rubra S1946 | Isolate | Unclassified |
| 144 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 145 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 146 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 147 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 148 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 149 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 150 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 151 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 152 | 8022087107 | Vibrio sp. OULL4 | Isolate | Unclassified |
| 153 | 8022439116 | Vibrio sp. ArtGut-C1 | Isolate | Artemiidae |
| 154 | 8065497608 | Tellurirhabdus bombi IE-0392 | Isolate | Apidae |
| 155 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 156 | 2551306507 | Vibrio parahaemolyticus PCV08-7 | Isolate | Unclassified |
| 157 | 2582581321 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 158 | 2585427605 | Colwellia sp. MT2012 | Isolate | |
| 159 | 2636415586 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 160 | 2667527887 | Vibrio harveyi LMG 4044 | Isolate | Unclassified |
| 161 | 2687453753 | Burkholderiales bacterium B_Cag25 | Isolate | Unclassified |
| 162 | 2687453786 | Chryseobacterium culicis DSM 23031 | Isolate | Unclassified |
| 163 | 2791355471 | Vibrio bivalvicida 605 | Isolate | Unclassified |
| 164 | 2791355473 | Vibrio barjaei 3062 | Isolate | Unclassified |
| 165 | 2843904799 | Shewanella khirikhana TH2012 | Isolate | Unclassified |
| 166 | 2847090942 | Elizabethkingia anophelis Ag1 | Isolate | Culicidae |
| 167 | 2864777284 | Aeromonas hydrophila S00023 | Isolate | Elmidae |
| 168 | 2864796242 | Aeromonas hydrophilia S00040 | Isolate | Elmidae |
| 169 | 2864882932 | Chryseobacterium shingense S00136 | Isolate | Elmidae |
| 170 | 2864891731 | Chryseobacterium defluvii S00151 | Isolate | Elmidae |
| 171 | 2873884416 | Photobacterium sanguinicancri Mj110 CAIM 1827 | Isolate | Majidae |
| 172 | 2918390780 | Glutamicibacter protophormiae DSM 20168 | Isolate | Unclassified |
| 173 | 3006225627 | Vibrio sp. Hep-1b-8 | Isolate | Unclassified |
| 174 | 3006242587 | Vibrio sp. RE86 | Isolate | Unclassified |
| 175 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 176 | 3300005307 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 1 gut | Metagenome | Drosophilidae |
| 177 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 178 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 179 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 180 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 181 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 182 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 183 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 184 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 185 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 186 | 8048923410 | Photobacterium sanguinicancri CECT 7579 | Isolate | Unclassified |
| 187 | 8051534459 | Vibrio vulnificus Vv004 | Isolate |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466701_050125 | 3300042598 | Bacteria | 85937 |
| 2 | Ga0466708_424648 | 3300042652 | Bacteria | 7211 |
| 3 | Ga0466725_230846 | 3300042654 | Bacteria | 3004 |
| 4 | CVPL010W_10004352 | 3300002931 | Bacteria | 15885 |
| 5 | Ga0103261_1000226 | 3300007083 | Bacteria | 9406 |
| 6 | Ga0104050_1000671 | 3300007153 | Bacteria | 4130 |
| 7 | Ga0103264_1000007 | 3300007188 | Bacteria | 144836 |
| 8 | Ga0160433_100154 | 3300012846 | Bacteria | 58953 |
| 9 | Ga0160443_100154 | 3300012848 | Bacteria | 98725 |
| 10 | Ga0466701_082567 | 3300042598 | Bacteria | 29061 |
| 11 | Ga0466730_024181 | 3300042625 | Bacteria | 38679 |
| 12 | Ga0466724_46819 | 3300042649 | Bacteria | 306737 |
| 13 | Ga0466708_151324 | 3300042652 | Bacteria | 3234 |
| 14 | CVPL005W_1000164 | 3300002934 | Bacteria | 28912 |
| 15 | Ga0072941_1322872 | 3300005201 | Bacteria | 2081 |
| 16 | Ga0102739_1000234 | 3300007095 | Bacteria | 13745 |
| 17 | Ga0102734_1002060 | 3300007129 | Unclassified | 4846 |
| 18 | Ga0102737_1000993 | 3300007142 | Unclassified | 8412 |
| 19 | Ga0104048_1003060 | 3300007143 | Bacteria | 3914 |
| 20 | Ga0104019_1004109 | 3300007150 | Bacteria | 10061 |
| 21 | Ga0104050_1200471 | 3300007153 | Bacteria | 2299 |
| 22 | Ga0103264_1000355 | 3300007188 | Bacteria | 41601 |
| 23 | Ga0103267_1000045 | 3300007190 | Bacteria | 74090 |
| 24 | Ga0103268_1000260 | 3300007192 | Bacteria | 17388 |
| 25 | Ga0466657_152672 | 3300042582 | Unclassified | 1538 |
| 26 | Ga0466701_010924 | 3300042598 | Bacteria | 123388 |
| 27 | Ga0466701_019111 | 3300042598 | Bacteria | 65197 |
| 28 | Ga0466730_036904 | 3300042625 | Unclassified | 3889 |
| 29 | DPOL_contig02311 | 2035918003 | Unclassified | 5346 |
| 30 | SPBB_contig03388 | 2044078006 | Unclassified | 4664 |
| 31 | CVPL005W_1000257 | 3300002934 | Bacteria | 23073 |
| 32 | Ga0102735_1000182 | 3300007080 | Bacteria | 19417 |
| 33 | Ga0104045_1004264 | 3300007085 | Unclassified | 5508 |
| 34 | Ga0104048_1169394 | 3300007143 | Bacteria | 2116 |
| 35 | Ga0104050_1001241 | 3300007153 | Unclassified | 11226 |
| 36 | Ga0103267_1018161 | 3300007190 | Unclassified | 4112 |
| 37 | Ga0123354_10038867 | 3300010882 | Bacteria | 7383 |
| 38 | Ga0160470_103196 | 3300012813 | Bacteria | 2717 |
| 39 | Ga0160469_100160 | 3300012824 | Bacteria | 71074 |
| 40 | Ga0160441_105015 | 3300012825 | Unclassified | 2006 |
| 41 | Ga0160431_100056 | 3300012828 | Bacteria | 97724 |
| 42 | Ga0160445_100066 | 3300012847 | Bacteria | 123455 |
| 43 | Ga0466693_061076 | 3300042592 | Bacteria | 8322 |
| 44 | Ga0466701_045669 | 3300042598 | Bacteria | 85216 |
| 45 | Ga0466734_030513 | 3300042623 | Bacteria | 30324 |
| 46 | Ga0466725_332846 | 3300042654 | Bacteria | 33341 |
| 47 | CVPL005W_1000408 | 3300002934 | Unclassified | 17744 |
| 48 | Ga0074308_1018184 | 3300005307 | Unclassified | 5774 |
| 49 | Ga0104045_1019427 | 3300007085 | Unclassified | 4267 |
| 50 | Ga0102737_1000167 | 3300007142 | Bacteria | 21930 |
| 51 | Ga0160468_101149 | 3300012819 | Unclassified | 7358 |
| 52 | Ga0160434_100091 | 3300012850 | Bacteria | 55948 |
| 53 | Ga0160435_1005668 | 3300012857 | Unclassified | 2807 |
| 54 | Ga0466656_316316 | 3300042550 | Bacteria | 2299 |
| 55 | Ga0466701_022073 | 3300042598 | Bacteria | 54125 |
| 56 | Ga0466717_072754 | 3300042604 | Unclassified | 6275 |
| 57 | Ga0466724_58610 | 3300042649 | Bacteria | 376410 |
| 58 | Ga0466724_59820 | 3300042649 | Bacteria | 124441 |
| 59 | Ga0466724_69524 | 3300042649 | Bacteria | 891007 |
| 60 | CVPL005L_10001082 | 3300002938 | Bacteria | 37702 |
| 61 | Ga0102740_1009577 | 3300007140 | Unclassified | 1558 |
| 62 | Ga0103264_1000153 | 3300007188 | Bacteria | 44108 |
| 63 | Ga0160464_100004 | 3300012805 | Bacteria | 404522 |
| 64 | Ga0160466_100037 | 3300012809 | Bacteria | 197425 |
| 65 | Ga0160455_100406 | 3300012837 | Bacteria | 23909 |
| 66 | Ga0160430_108847 | 3300012852 | Bacteria | 1866 |
| 67 | Ga0466705_300706 | 3300042612 | Bacteria | 16398 |
| 68 | Ga0466701_016134 | 3300042598 | Bacteria | 4835 |
| 69 | Ga0466701_049405 | 3300042598 | Bacteria | 162418 |
| 70 | Ga0466721_195240 | 3300042608 | Bacteria | 4526 |
| 71 | Ga0466730_022941 | 3300042625 | Bacteria | 238769 |
| 72 | Ga0466730_055459 | 3300042625 | Unclassified | 21836 |
| 73 | CVPL010W_10002900 | 3300002931 | Unclassified | 19962 |
| 74 | Ga0102736_1004668 | 3300007052 | Bacteria | 1810 |
| 75 | Ga0103264_1000208 | 3300007188 | Bacteria | 52687 |
| 76 | Ga0160471_100689 | 3300012812 | Unclassified | 8355 |
| 77 | Ga0160469_100115 | 3300012824 | Unclassified | 116736 |
| 78 | Ga0160431_100295 | 3300012828 | Bacteria | 28623 |
| 79 | Ga0160457_1000092 | 3300012858 | Bacteria | 118084 |
| 80 | Ga0160436_1000047 | 3300012861 | Bacteria | 66204 |
| 81 | Ga0160436_1000355 | 3300012861 | Unclassified | 19468 |
| 82 | Ga0157631_138360 | 3300013007 | Bacteria | 3325 |
| 83 | Ga0466656_189955 | 3300042550 | Bacteria | 3174 |
| 84 | Ga0466711_430743 | 3300042615 | Bacteria | 12659 |
| 85 | Ga0466701_048593 | 3300042598 | Bacteria | 51470 |
| 86 | Ga0466730_079418 | 3300042625 | Bacteria | 679131 |
| 87 | Ga0466724_54120 | 3300042649 | Bacteria | 266943 |
| 88 | Ga0466725_245618 | 3300042654 | Bacteria | 1624 |
| 89 | JGI24705J35276_12236796 | 3300002504 | Bacteria | 8945 |
| 90 | CVPL005L_10005246 | 3300002938 | Unclassified | 19669 |
| 91 | Ga0102734_1000097 | 3300007129 | Bacteria | 28598 |
| 92 | Ga0103260_1000105 | 3300007139 | Bacteria | 21775 |
| 93 | Ga0102737_1002111 | 3300007142 | Bacteria | 5084 |
| 94 | Ga0102737_1006670 | 3300007142 | Unclassified | 2173 |
| 95 | Ga0104048_1023242 | 3300007143 | Unclassified | 1729 |
| 96 | Ga0104050_1026403 | 3300007153 | Bacteria | 4551 |
| 97 | Ga0103264_1000132 | 3300007188 | Bacteria | 42832 |
| 98 | Ga0103267_1000161 | 3300007190 | Bacteria | 45217 |
| 99 | Ga0160465_101182 | 3300012803 | Unclassified | 8162 |
| 100 | Ga0160466_102669 | 3300012809 | Unclassified | 3349 |
| 101 | Ga0160467_103411 | 3300012829 | Unclassified | 2703 |
| 102 | Ga0160472_104629 | 3300012839 | Unclassified | 2371 |
| 103 | Ga0160443_100163 | 3300012848 | Bacteria | 93816 |
| 104 | Ga0160430_100051 | 3300012852 | Bacteria | 124271 |
| 105 | Ga0160448_100071 | 3300012854 | Bacteria | 63703 |
| 106 | Ga0160435_1000245 | 3300012857 | Bacteria | 24971 |
| 107 | Ga0466710_348049 | 3300042613 | Bacteria | 1430 |
| 108 | Ga0466701_018829 | 3300042598 | Bacteria | 4956 |
| 109 | Ga0466701_026953 | 3300042598 | Unclassified | 4786 |
| 110 | Ga0466730_096842 | 3300042625 | Bacteria | 56272 |
| 111 | Ga0466724_52883 | 3300042649 | Bacteria | 459297 |
| 112 | Meta3P_1003308 | 3300002464 | Unclassified | 19770 |
| 113 | CVPL005W_1000474 | 3300002934 | Bacteria | 29568 |
| 114 | Ga0102740_1005947 | 3300007140 | Unclassified | 2693 |
| 115 | Ga0103264_1000862 | 3300007188 | Bacteria | 28172 |
| 116 | Ga0103267_1009203 | 3300007190 | Bacteria | 3144 |
| 117 | Ga0123357_10133076 | 3300009784 | Bacteria | 3087 |
| 118 | Ga0160465_100057 | 3300012803 | Bacteria | 126446 |
| 119 | Ga0160458_100879 | 3300012832 | Bacteria | 8279 |
| 120 | Ga0160444_100156 | 3300012841 | Bacteria | 68274 |
| 121 | Ga0160447_101490 | 3300012849 | Bacteria | 9074 |
| 122 | Ga0160447_106423 | 3300012849 | Bacteria | 3110 |
| 123 | Ga0160436_1000238 | 3300012861 | Bacteria | 26237 |
| 124 | Ga0466701_002615 | 3300042598 | Bacteria | 9375 |
| 125 | Ga0466701_006539 | 3300042598 | Bacteria | 166094 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | iso_pr_bacteria | 2880115952 | 2880120195 | 323 |
| 2 | 3300007143 | Ga0104048_1169394 | Ga0104048_11693942 | 329 |
| 3 | 3300012837 | Ga0160455_100406 | Ga0160455_10040612 | 365 |
| 4 | 3300007190 | Ga0103267_1000045 | Ga0103267_100004514 | 370 |
| 5 | 3300002938 | CVPL005L_10005246 | CVPL005L_100052468 | 372 |
| 6 | 3300007142 | Ga0102737_1000167 | Ga0102737_10001672 | 378 |
| 7 | 3300042652 | Ga0466708_151324 | Ga0466708_151324_387_1523 | 378 |
| 8 | iso_pr_bacteria | 2681813507 | 2684380805 | 378 |
| 9 | iso_pr_bacteria | 2918390780 | 2918391203 | 378 |
| 10 | 3300042598 | Ga0466701_010924 | Ga0466701_010924_118622_119761 | 379 |
| 11 | 3300042598 | Ga0466701_019111 | Ga0466701_019111_31021_32160 | 379 |
| 12 | 3300042598 | Ga0466701_049405 | Ga0466701_049405_157977_159116 | 379 |
| 13 | 3300042598 | Ga0466701_082567 | Ga0466701_082567_19636_20775 | 379 |
| 14 | 3300042625 | Ga0466730_024181 | Ga0466730_024181_25579_26718 | 379 |
| 15 | 3300042649 | Ga0466724_58610 | Ga0466724_58610_328252_329391 | 379 |
| 16 | 3300042649 | Ga0466724_69524 | Ga0466724_69524_861022_862161 | 379 |
| 17 | iso_pr_bacteria | 2529292732 | 2529757984 | 379 |
| 18 | iso_pr_bacteria | 2590828803 | 2592928288 | 379 |
| 19 | iso_pr_bacteria | 2687453786 | 2690173106 | 379 |
| 20 | iso_pr_bacteria | 2811995047 | 2812947518 | 379 |
| 21 | iso_pr_bacteria | 2847090942 | 2847091641 | 379 |
| 22 | iso_pr_bacteria | 2864788197 | 2864789219 | 379 |
| 23 | iso_pr_bacteria | 2864822740 | 2864824337 | 379 |
| 24 | iso_pr_bacteria | 2864831662 | 2864831987 | 379 |
| 25 | iso_pr_bacteria | 2864866972 | 2864868095 | 379 |
| 26 | iso_pr_bacteria | 2864882932 | 2864883344 | 379 |
| 27 | iso_pr_bacteria | 2864891731 | 2864892021 | 379 |
| 28 | iso_pr_bacteria | 2864923010 | 2864924031 | 379 |
| 29 | iso_pr_bacteria | 2864948220 | 2864950149 | 379 |
| 30 | iso_pr_bacteria | 2899132286 | 2899134624 | 379 |
| 31 | iso_pr_bacteria | 2904728850 | 2904729498 | 379 |
| 32 | iso_pr_bacteria | 2958471994 | 2958473877 | 379 |
| 33 | iso_pr_bacteria | 2998907766 | 2998909256 | 379 |
| 34 | iso_pr_bacteria | 8020009074 | 8020012448 | 379 |
| 35 | iso_pr_bacteria | 8114076984 | 8114080546 | 379 |
| 36 | 3300002464 | Meta3P_1003308 | Meta3P_10033082 | 380 |
| 37 | 3300007085 | Ga0104045_1019427 | Ga0104045_10194272 | 380 |
| 38 | 3300007150 | Ga0104019_1004109 | Ga0104019_100410913 | 380 |
| 39 | 3300007153 | Ga0104050_1026403 | Ga0104050_10264034 | 380 |
| 40 | 3300007153 | Ga0104050_1200471 | Ga0104050_12004712 | 380 |
| 41 | 3300007190 | Ga0103267_1000161 | Ga0103267_10001613 | 380 |
| 42 | 3300012828 | Ga0160431_100295 | Ga0160431_1002955 | 380 |
| 43 | 3300012848 | Ga0160443_100163 | Ga0160443_1001634 | 380 |
| 44 | 3300013007 | Ga0157631_138360 | Ga0157631_1383602 | 380 |
| 45 | 3300042598 | Ga0466701_002615 | Ga0466701_002615_4011_5153 | 380 |
| 46 | 3300042613 | Ga0466710_348049 | Ga0466710_348049_148_1290 | 380 |
| 47 | 3300042615 | Ga0466711_430743 | Ga0466711_430743_11403_12545 | 380 |
| 48 | 3300042652 | Ga0466708_424648 | Ga0466708_424648_146_1288 | 380 |
| 49 | 3300042654 | Ga0466725_332846 | Ga0466725_332846_17668_18810 | 380 |
| 50 | iso_pr_bacteria | 2718218155 | 2720328378 | 380 |
| 51 | iso_pr_bacteria | 2864878056 | 2864881616 | 380 |
| 52 | iso_pr_bacteria | 2864886855 | 2864890746 | 380 |
| 53 | iso_pr_bacteria | 2921902974 | 2921904833 | 380 |
| 54 | 3300002931 | CVPL010W_10004352 | CVPL010W_1000435210 | 381 |
| 55 | 3300005201 | Ga0072941_1322872 | Ga0072941_13228722 | 381 |
| 56 | 3300007080 | Ga0102735_1000182 | Ga0102735_10001824 | 381 |
| 57 | 3300007129 | Ga0102734_1000097 | Ga0102734_100009713 | 381 |
| 58 | 3300007140 | Ga0102740_1005947 | Ga0102740_10059472 | 381 |
| 59 | 3300007142 | Ga0102737_1000993 | Ga0102737_10009935 | 381 |
| 60 | 3300007143 | Ga0104048_1023242 | Ga0104048_10232422 | 381 |
| 61 | 3300007153 | Ga0104050_1001241 | Ga0104050_10012413 | 381 |
| 62 | 3300007190 | Ga0103267_1009203 | Ga0103267_10092032 | 381 |
| 63 | 3300007190 | Ga0103267_1018161 | Ga0103267_10181612 | 381 |
| 64 | 3300007192 | Ga0103268_1000260 | Ga0103268_10002601 | 381 |
| 65 | 3300042550 | Ga0466656_316316 | Ga0466656_316316_436_1581 | 381 |
| 66 | 3300042598 | Ga0466701_018829 | Ga0466701_018829_407_1555 | 382 |
| 67 | 3300007095 | Ga0102739_1000234 | Ga0102739_10002341 | 383 |
| 68 | 3300042612 | Ga0466705_300706 | Ga0466705_300706_4047_5201 | 384 |
| 69 | 3300042623 | Ga0466734_030513 | Ga0466734_030513_25281_26435 | 384 |
| 70 | 3300042654 | Ga0466725_230846 | Ga0466725_230846_1416_2570 | 384 |
| 71 | 3300042654 | Ga0466725_245618 | Ga0466725_245618_135_1289 | 384 |
| 72 | iso_pr_bacteria | 2511231129 | 2511733217 | 384 |
| 73 | iso_pr_bacteria | 2511231129 | 2511733630 | 384 |
| 74 | iso_pr_bacteria | 2531839005 | 2531869237 | 384 |
| 75 | iso_pr_bacteria | 2551306507 | 2553347535 | 384 |
| 76 | iso_pr_bacteria | 2551306507 | 2553347978 | 384 |
| 77 | iso_pr_bacteria | 2565956518 | 2566025280 | 384 |
| 78 | iso_pr_bacteria | 2571042430 | 2572513962 | 384 |
| 79 | iso_pr_bacteria | 2571042554 | 2572928117 | 384 |
| 80 | iso_pr_bacteria | 2600255074 | 2600846422 | 384 |
| 81 | iso_pr_bacteria | 2609459958 | 2610826866 | 384 |
| 82 | iso_pr_bacteria | 2627854002 | 2629834637 | 384 |
| 83 | iso_pr_bacteria | 2636415542 | 2636990980 | 384 |
| 84 | iso_pr_bacteria | 2636415586 | 2637164471 | 384 |
| 85 | iso_pr_bacteria | 2648501158 | 2648748170 | 384 |
| 86 | iso_pr_bacteria | 2648501820 | 2651397377 | 384 |
| 87 | iso_pr_bacteria | 2654587515 | 2654660193 | 384 |
| 88 | iso_pr_bacteria | 2663763317 | 2666535477 | 384 |
| 89 | iso_pr_bacteria | 2663763317 | 2666539345 | 384 |
| 90 | iso_pr_bacteria | 2667527830 | 2669649185 | 384 |
| 91 | iso_pr_bacteria | 2667527830 | 2669651860 | 384 |
| 92 | iso_pr_bacteria | 2667527887 | 2669891659 | 384 |
| 93 | iso_pr_bacteria | 2693429575 | 2693741421 | 384 |
| 94 | iso_pr_bacteria | 2693429575 | 2693744111 | 384 |
| 95 | iso_pr_bacteria | 2700989396 | 2702439104 | 384 |
| 96 | iso_pr_bacteria | 2700989396 | 2702439557 | 384 |
| 97 | iso_pr_bacteria | 2711768158 | 2712479312 | 384 |
| 98 | iso_pr_bacteria | 2731957638 | 2732532947 | 384 |
| 99 | iso_pr_bacteria | 2785510762 | 2785801509 | 384 |
| 100 | iso_pr_bacteria | 2785510762 | 2785802697 | 384 |
| 101 | iso_pr_bacteria | 2791355471 | 2794376737 | 384 |
| 102 | iso_pr_bacteria | 2791355473 | 2794385794 | 384 |
| 103 | iso_pr_bacteria | 2850895757 | 2850900172 | 384 |
| 104 | iso_pr_bacteria | 2855798354 | 2855800922 | 384 |
| 105 | iso_pr_bacteria | 2858407585 | 2858411505 | 384 |
| 106 | iso_pr_bacteria | 2860776474 | 2860780230 | 384 |
| 107 | iso_pr_bacteria | 2860776474 | 2860781353 | 384 |
| 108 | iso_pr_bacteria | 2864761044 | 2864763569 | 384 |
| 109 | iso_pr_bacteria | 2872471378 | 2872475997 | 384 |
| 110 | iso_pr_bacteria | 2873884416 | 2873886103 | 384 |
| 111 | iso_pr_bacteria | 2875320051 | 2875323582 | 384 |
| 112 | iso_pr_bacteria | 2875320051 | 2875324746 | 384 |
| 113 | iso_pr_bacteria | 2877638525 | 2877643135 | 384 |
| 114 | iso_pr_bacteria | 2877647439 | 2877650725 | 384 |
| 115 | iso_pr_bacteria | 2877647439 | 2877651845 | 384 |
| 116 | iso_pr_bacteria | 2880115952 | 2880120692 | 384 |
| 117 | iso_pr_bacteria | 2896925746 | 2896926715 | 384 |
| 118 | iso_pr_bacteria | 2908136803 | 2908140965 | 384 |
| 119 | iso_pr_bacteria | 2912570088 | 2912573908 | 384 |
| 120 | iso_pr_bacteria | 2912570088 | 2912574393 | 384 |
| 121 | iso_pr_bacteria | 2989793055 | 2989794880 | 384 |
| 122 | iso_pr_bacteria | 2997380424 | 2997383893 | 384 |
| 123 | iso_pr_bacteria | 2997380424 | 2997385009 | 384 |
| 124 | iso_pr_bacteria | 3006225627 | 3006227677 | 384 |
| 125 | iso_pr_bacteria | 3006242587 | 3006246282 | 384 |
| 126 | iso_pr_bacteria | 640963010 | 641028129 | 384 |
| 127 | iso_pr_bacteria | 8008122225 | 8008125773 | 384 |
| 128 | iso_pr_bacteria | 8022087107 | 8022087136 | 384 |
| 129 | iso_pr_bacteria | 8022096067 | 8022096735 | 384 |
| 130 | iso_pr_bacteria | 8022096067 | 8022096991 | 384 |
| 131 | iso_pr_bacteria | 8022439116 | 8022439803 | 384 |
| 132 | iso_pr_bacteria | 8022439116 | 8022441597 | 384 |
| 133 | iso_pr_bacteria | 8033364368 | 8033365636 | 384 |
| 134 | iso_pr_bacteria | 8033368880 | 8033369221 | 384 |
| 135 | iso_pr_bacteria | 8042061949 | 8042065082 | 384 |
| 136 | iso_pr_bacteria | 8048923410 | 8048927230 | 384 |
| 137 | iso_pr_bacteria | 8048928574 | 8048932903 | 384 |
| 138 | iso_pr_bacteria | 8051461712 | 8051464605 | 384 |
| 139 | iso_pr_bacteria | 8051534459 | 8051538326 | 384 |
| 140 | iso_pr_bacteria | 8051551332 | 8051553377 | 384 |
| 141 | iso_pr_bacteria | 8060845732 | 8060849386 | 384 |
| 142 | 3300007188 | Ga0103264_1000355 | Ga0103264_100035527 | 385 |
| 143 | 3300010882 | Ga0123354_10038867 | Ga0123354_100388675 | 385 |
| 144 | 3300012803 | Ga0160465_100057 | Ga0160465_10005794 | 385 |
| 145 | 3300012803 | Ga0160465_101182 | Ga0160465_1011822 | 385 |
| 146 | 3300012805 | Ga0160464_100004 | Ga0160464_100004332 | 385 |
| 147 | 3300012809 | Ga0160466_102669 | Ga0160466_1026692 | 385 |
| 148 | 3300012819 | Ga0160468_101149 | Ga0160468_1011494 | 385 |
| 149 | 3300012824 | Ga0160469_100160 | Ga0160469_10016064 | 385 |
| 150 | 3300012825 | Ga0160441_105015 | Ga0160441_1050152 | 385 |
| 151 | 3300012832 | Ga0160458_100879 | Ga0160458_1008794 | 385 |
| 152 | 3300012839 | Ga0160472_104629 | Ga0160472_1046292 | 385 |
| 153 | 3300012847 | Ga0160445_100066 | Ga0160445_10006620 | 385 |
| 154 | 3300012848 | Ga0160443_100154 | Ga0160443_1001542 | 385 |
| 155 | 3300012849 | Ga0160447_106423 | Ga0160447_1064232 | 385 |
| 156 | 3300012857 | Ga0160435_1005668 | Ga0160435_10056682 | 385 |
| 157 | 3300042604 | Ga0466717_072754 | Ga0466717_072754_792_1949 | 385 |
| 158 | iso_pr_bacteria | 2501651205 | 2501713451 | 385 |
| 159 | iso_pr_bacteria | 2585427605 | 2585887616 | 385 |
| 160 | iso_pr_bacteria | 2585428048 | 2587692316 | 385 |
| 161 | iso_pr_bacteria | 2671180705 | 2673871013 | 385 |
| 162 | iso_pr_bacteria | 2820059968 | 2820061431 | 385 |
| 163 | iso_pr_bacteria | 2843904799 | 2843905760 | 385 |
| 164 | iso_pr_bacteria | 2864764899 | 2864765779 | 385 |
| 165 | iso_pr_bacteria | 2864768727 | 2864770507 | 385 |
| 166 | iso_pr_bacteria | 2864777284 | 2864778170 | 385 |
| 167 | iso_pr_bacteria | 2864791955 | 2864793877 | 385 |
| 168 | iso_pr_bacteria | 2864796242 | 2864799284 | 385 |
| 169 | iso_pr_bacteria | 2889908211 | 2889909054 | 385 |
| 170 | iso_pr_bacteria | 2902896024 | 2902897421 | 385 |
| 171 | iso_pr_bacteria | 2902916284 | 2902916742 | 385 |
| 172 | 3300002504 | JGI24705J35276_12236796 | JGI24705J35276_122367964 | 386 |
| 173 | 3300002938 | CVPL005L_10001082 | CVPL005L_1000108231 | 386 |
| 174 | 3300042598 | Ga0466701_006539 | Ga0466701_006539_91712_92872 | 386 |
| 175 | 3300042649 | Ga0466724_54120 | Ga0466724_54120_74933_76093 | 386 |
| 176 | iso_pr_bacteria | 2518285616 | 2518644063 | 386 |
| 177 | iso_pr_bacteria | 2603880170 | 2606027102 | 386 |
| 178 | iso_pr_bacteria | 2687453742 | 2689988875 | 386 |
| 179 | iso_pr_bacteria | 2687453753 | 2690036996 | 386 |
| 180 | iso_pr_bacteria | 2864831662 | 2864832410 | 386 |
| 181 | iso_pr_bacteria | 2864859030 | 2864862612 | 386 |
| 182 | iso_pr_bacteria | 2864914039 | 2864917609 | 386 |
| 183 | iso_pr_bacteria | 2864988360 | 2864991658 | 386 |
| 184 | iso_pr_bacteria | 2891720358 | 2891721863 | 386 |
| 185 | 3300002934 | CVPL005W_1000164 | CVPL005W_100016425 | 387 |
| 186 | 3300002934 | CVPL005W_1000257 | CVPL005W_100025714 | 387 |
| 187 | 3300002934 | CVPL005W_1000408 | CVPL005W_100040811 | 387 |
| 188 | 3300005307 | Ga0074308_1018184 | Ga0074308_10181844 | 387 |
| 189 | 3300007052 | Ga0102736_1004668 | Ga0102736_10046682 | 387 |
| 190 | 3300007085 | Ga0104045_1004264 | Ga0104045_10042644 | 387 |
| 191 | 3300007129 | Ga0102734_1002060 | Ga0102734_10020603 | 387 |
| 192 | 3300007142 | Ga0102737_1002111 | Ga0102737_10021113 | 387 |
| 193 | 3300007142 | Ga0102737_1006670 | Ga0102737_10066702 | 387 |
| 194 | 3300007143 | Ga0104048_1003060 | Ga0104048_10030603 | 387 |
| 195 | 3300007153 | Ga0104050_1000671 | Ga0104050_10006712 | 387 |
| 196 | 3300007188 | Ga0103264_1000007 | Ga0103264_10000076 | 387 |
| 197 | 3300007188 | Ga0103264_1000132 | Ga0103264_100013210 | 387 |
| 198 | 3300007188 | Ga0103264_1000153 | Ga0103264_100015315 | 387 |
| 199 | 3300009784 | Ga0123357_10133076 | Ga0123357_101330763 | 387 |
| 200 | iso_pr_bacteria | 2864847319 | 2864848050 | 387 |
| 201 | iso_pr_bacteria | 2864903489 | 2864908442 | 387 |
| 202 | iso_pr_bacteria | 2864926767 | 2864928231 | 387 |
| 203 | iso_pr_bacteria | 2864944480 | 2864946830 | 387 |
| 204 | iso_pr_bacteria | 8011357093 | 8011361508 | 387 |
| 205 | 2035918003 | DPOL_contig02311 | DPOLB_1331490 | 388 |
| 206 | 2044078006 | SPBB_contig03388 | SPBB_773630 | 388 |
| 207 | 3300042582 | Ga0466657_152672 | Ga0466657_152672_133_1299 | 388 |
| 208 | 3300042592 | Ga0466693_061076 | Ga0466693_061076_1715_2881 | 388 |
| 209 | 3300042598 | Ga0466701_016134 | Ga0466701_016134_3073_4239 | 388 |
| 210 | 3300042598 | Ga0466701_022073 | Ga0466701_022073_43186_44352 | 388 |
| 211 | 3300042598 | Ga0466701_026953 | Ga0466701_026953_704_1870 | 388 |
| 212 | 3300042598 | Ga0466701_045669 | Ga0466701_045669_82472_83638 | 388 |
| 213 | 3300042598 | Ga0466701_048593 | Ga0466701_048593_48704_49870 | 388 |
| 214 | 3300042598 | Ga0466701_050125 | Ga0466701_050125_49796_50962 | 388 |
| 215 | 3300042625 | Ga0466730_022941 | Ga0466730_022941_148622_149788 | 388 |
| 216 | 3300042625 | Ga0466730_036904 | Ga0466730_036904_982_2148 | 388 |
| 217 | 3300042625 | Ga0466730_055459 | Ga0466730_055459_2233_3399 | 388 |
| 218 | 3300042625 | Ga0466730_096842 | Ga0466730_096842_40158_41324 | 388 |
| 219 | 3300042649 | Ga0466724_46819 | Ga0466724_46819_15012_16178 | 388 |
| 220 | 3300042649 | Ga0466724_52883 | Ga0466724_52883_119487_120653 | 388 |
| 221 | 3300042649 | Ga0466724_59820 | Ga0466724_59820_36226_37392 | 388 |
| 222 | iso_pr_bacteria | 2524614573 | 2524998831 | 388 |
| 223 | iso_pr_bacteria | 2582581321 | 2585352670 | 388 |
| 224 | iso_pr_bacteria | 2833478085 | 2833478174 | 388 |
| 225 | iso_pr_bacteria | 2864826666 | 2864827195 | 388 |
| 226 | iso_pr_bacteria | 2864870719 | 2864874674 | 388 |
| 227 | iso_pr_bacteria | 2864937364 | 2864943118 | 388 |
| 228 | iso_pr_bacteria | 2868169047 | 2868169913 | 388 |
| 229 | iso_pr_bacteria | 2873565274 | 2873567151 | 388 |
| 230 | iso_pr_bacteria | 2873571580 | 2873576326 | 388 |
| 231 | iso_pr_bacteria | 8100449422 | 8100455360 | 388 |
| 232 | iso_pr_bacteria | 8100455565 | 8100461347 | 388 |
| 233 | iso_pr_bacteria | 8100461708 | 8100464772 | 388 |
| 234 | 3300002931 | CVPL010W_10002900 | CVPL010W_1000290011 | 389 |
| 235 | 3300007139 | Ga0103260_1000105 | Ga0103260_100010511 | 389 |
| 236 | 3300007140 | Ga0102740_1009577 | Ga0102740_10095771 | 389 |
| 237 | 3300012809 | Ga0160466_100037 | Ga0160466_10003791 | 389 |
| 238 | 3300012824 | Ga0160469_100115 | Ga0160469_10011591 | 389 |
| 239 | 3300012828 | Ga0160431_100056 | Ga0160431_1000562 | 389 |
| 240 | 3300012829 | Ga0160467_103411 | Ga0160467_1034113 | 389 |
| 241 | 3300012846 | Ga0160433_100154 | Ga0160433_10015414 | 389 |
| 242 | 3300012852 | Ga0160430_100051 | Ga0160430_10005191 | 389 |
| 243 | 3300012852 | Ga0160430_108847 | Ga0160430_1088472 | 389 |
| 244 | 3300042550 | Ga0466656_189955 | Ga0466656_189955_1357_2526 | 389 |
| 245 | 3300042608 | Ga0466721_195240 | Ga0466721_195240_274_1443 | 389 |
| 246 | iso_pr_bacteria | 8065497608 | 8065498706 | 389 |
| 247 | 3300007188 | Ga0103264_1000862 | Ga0103264_10008627 | 390 |
| 248 | 3300012857 | Ga0160435_1000245 | Ga0160435_10002456 | 393 |
| 249 | 3300012841 | Ga0160444_100156 | Ga0160444_10015626 | 394 |
| 250 | 3300012849 | Ga0160447_101490 | Ga0160447_1014902 | 394 |
| 251 | 3300012850 | Ga0160434_100091 | Ga0160434_1000915 | 394 |
| 252 | 3300012854 | Ga0160448_100071 | Ga0160448_10007141 | 394 |
| 253 | 3300012861 | Ga0160436_1000238 | Ga0160436_100023811 | 394 |
| 254 | 3300012861 | Ga0160436_1000355 | Ga0160436_10003557 | 394 |
| 255 | 3300012861 | Ga0160436_1000047 | Ga0160436_100004741 | 396 |
| 256 | 3300012858 | Ga0160457_1000092 | Ga0160457_100009226 | 397 |
| 257 | iso_pr_bacteria | 2864960361 | 2864964324 | 398 |
| 258 | 3300012812 | Ga0160471_100689 | Ga0160471_1006895 | 404 |
| 259 | 3300012813 | Ga0160470_103196 | Ga0160470_1031962 | 404 |
| 260 | 3300002934 | CVPL005W_1000474 | CVPL005W_100047416 | 406 |
| 261 | 3300007083 | Ga0103261_1000226 | Ga0103261_10002267 | 409 |
| 262 | 3300042625 | Ga0466730_079418 | Ga0466730_079418_497420_498649 | 409 |
| 263 | 3300007188 | Ga0103264_1000208 | Ga0103264_100020853 | 412 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00441 | Acyl-CoA_dh_1 | Acyl-CoA dehydrogenase, C-terminal domain | 208 | 358 | 0.99 |
| PF02771 | Acyl-CoA_dh_N | Acyl-CoA dehydrogenase, N-terminal domain | 6 | 116 | 0.97 |
| PF08028 | Acyl-CoA_dh_2 | Acyl-CoA dehydrogenase, C-terminal domain | 225 | 345 | 0.91 |
| PF02770 | Acyl-CoA_dh_M | Acyl-CoA dehydrogenase, middle domain | 122 | 172 | 0.89 |
| PF22924 | ACOX_C_alpha1 | Acyl-CoA oxidase, C-alpha1 domain | 252 | 356 | 0.82 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00441 | GO:0016627 | oxidoreductase activity, acting on the CH-CH group of donors | MF |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.6 | 0.66 | Medium |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.