Protein Family IF01842
Metagenome
Isolate
181
Members
145
Samples
98
Scaffolds
251.24
Avg Length
Representative Sequence
- ID
- 3300007188|Ga0103264_1000025|Ga0103264_100002511
- Length
- 299 aa
- Sequence
- MSLRRLQFVCLNSGGNIYPDVYFLFVQYCVLPRACAAHADSINHAAGDVTGGQYVSGFHAVVARLRHAPASIKTLYVDVARRDKRMQTFVAQAQAAGVQPKFVAADRLDSLSKGLRHQGVIALAVAQPLATDIDACLDAVEQAGRTPLLLVLDGVTDPHNLGACLRTADAAGVHAVIAPRDRAVGLTNVVRRVACGAAETMPYFMVTNLARTLRHLKARDLWVIGTDDQASASLHQADLRRATAWVVGAEGAGMRRLTRETCDELVRIPMQGCVESLNVSVASAVCLYEAVRQRGDAG*
Sample Types
Isolate
45.9%
Metagenome
54.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
25.8%
Formicidae
10.9%
Curculionidae
8.6%
Culicidae
7.8%
Elmidae
7.0%
Termitidae
7.0%
Armadillidiidae
4.7%
Kalotermitidae
3.9%
Drosophilidae
3.1%
Aphididae
2.3%
Apidae
1.6%
Psyllidae
1.6%
Palinuridae
1.6%
Cicadellidae
1.6%
Majidae
1.6%
Artemiidae
0.8%
Cixiidae
0.8%
Gryllidae
0.8%
Termopsidae
0.8%
Trigoniulidae
0.8%
Lysianassidae
0.8%
Aphalaridae
0.8%
Hodotermitidae
0.8%
Penaeidae
0.8%
Glossinidae
0.8%
Pseudococcidae
0.8%
Crambidae
0.8%
Calliphoridae
0.8%
Triozidae
0.8%
Taxonomy
Archaea
0
Bacteria
160
Eukaryota
0
Viruses
0
Unclassified
21
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2032320009 | Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine | Metagenome | Curculionidae |
| 2 | 2599185261 | Thorsellia anophelis DSM 18579 | Isolate | Unclassified |
| 3 | 2711768158 | Vibrio coralliilyticus S2043 | Isolate | Unclassified |
| 4 | 2850895757 | Vibrio campbellii 170502 | Isolate | Unclassified |
| 5 | 2864903489 | Pseudomonas aeuginosa S00161 | Isolate | Elmidae |
| 6 | 2870361953 | Entomomonas moraniae QZS01 | Isolate | Apidae |
| 7 | 2872471378 | Vibrio owensii V180403 | Isolate | Unclassified |
| 8 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 9 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 10 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 11 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 12 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 13 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 14 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 15 | 8022439116 | Vibrio sp. ArtGut-C1 | Isolate | Artemiidae |
| 16 | 8062647588 | Nissabacter archeti JGM97 | Isolate | Drosophilidae |
| 17 | 2565956547 | Candidatus Profftella armatura | Isolate | Psyllidae |
| 18 | 2571042554 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 19 | 2603880165 | Burkholderiales A1 | Isolate | Unclassified |
| 20 | 2603880172 | Burkholderiales C | Isolate | Unclassified |
| 21 | 2617270844 | Dyella sp. HyOG | Isolate | Cixiidae |
| 22 | 2864751016 | Pseudomonas oryzihabitans S00005 | Isolate | Elmidae |
| 23 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 24 | 2990166910 | Pseudomonas typographi CA3A | Isolate | Curculionidae |
| 25 | 3000478755 | Entomomonas asaccharolytica F2A | Isolate | Gryllidae |
| 26 | 3007478678 | Pseudomonas sp. S37 | Isolate | Curculionidae |
| 27 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 28 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 29 | 3300009457 | Microbial communities of aphids from Cornus stolonifera in Ithaca, NY, USA - Anoecia oenotherae NM10041110_01 seqcov | Metagenome | |
| 30 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 31 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 32 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 33 | 637000219 | Pseudomonas entomophila L48 | Isolate | Unclassified |
| 34 | 8035326735 | Pseudomonas prosekii A2-NA13 | Isolate | Curculionidae |
| 35 | 2511231129 | Vibrio sp. EJY3 | Isolate | Unclassified |
| 36 | 2519899622 | Pseudomonas sp. Ag1 | Isolate | Culicidae |
| 37 | 2565956518 | Vibrio pacinii DSM 19139 | Isolate | Unclassified |
| 38 | 2864755708 | Massilia timonae S00006 | Isolate | Elmidae |
| 39 | 2902896024 | Pseudoalteromonas sp. S1612 | Isolate | Unclassified |
| 40 | 2908136803 | Vibrio owensii 1700302 | Isolate | Unclassified |
| 41 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 42 | 3007473699 | Pseudomonas sp. S30 | Isolate | Curculionidae |
| 43 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 44 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 45 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 46 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 47 | 640963010 | Vibrio harveyi HY01 | Isolate | Unclassified |
| 48 | 8011329375 | Pseudomonas sp. S31 | Isolate | Curculionidae |
| 49 | 8011357093 | Pseudomonas schmalbachii Milli4 | Isolate | Trigoniulidae |
| 50 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 51 | 2501651205 | Colwellia sp. MT41 | Isolate | Lysianassidae |
| 52 | 2509601000 | Secondary endosymbiont of Ctenarytaina eucalypti Thao2000 | Isolate | Aphalaridae |
| 53 | 2597489903 | Providencia sneebia DSM 19967 | Isolate | Drosophilidae |
| 54 | 2654587515 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 55 | 2773857880 | Candidatus Profftella armatura YCPA | Isolate | Psyllidae |
| 56 | 2858407585 | Photobacterium swingsii DSM 24669 | Isolate | Unclassified |
| 57 | 2864739902 | Pseudomonas viridiflavia S00001 | Isolate | Elmidae |
| 58 | 2864853652 | Pseudomonas rhodesiae S00114 | Isolate | Elmidae |
| 59 | 2912636047 | Vibrio crassostreae 9CS106 | Isolate | Unclassified |
| 60 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 61 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 62 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 63 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 64 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 65 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 66 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 67 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 68 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 69 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 70 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 71 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 72 | 8048928574 | Photobacterium swingsii CECT 7576 | Isolate | Unclassified |
| 73 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 74 | 2585428048 | Colwellia sp. NBT2012 | Isolate | |
| 75 | 2684622551 | Vibrio campbellii E1 | Isolate | Unclassified |
| 76 | 2864745180 | Pseudomonas rhodesiae S00002 | Isolate | Elmidae |
| 77 | 2864847319 | Pseudomonas alcaligenes S00099 | Isolate | Elmidae |
| 78 | 2877638525 | Vibrio campbellii 1114GL | Isolate | Penaeidae |
| 79 | 2989793055 | Vibrio atypicus DSM 25292 | Isolate | Unclassified |
| 80 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 81 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 82 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 83 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 84 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 85 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 86 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 87 | 637000270 | Sodalis glossinidius morsitans | Isolate | Glossinidae |
| 88 | 649633028 | Candidatus Blochmannia vafer BVAF | Isolate | Formicidae |
| 89 | 8051461712 | Vibrio vulnificus Vv002 | Isolate | |
| 90 | 8052469819 | Pseudomonas putida DZ-F23 | Isolate | |
| 91 | 8076028257 | Erwinia haradaeae ErCisplendens/pseudotsugae/3390 | Isolate | Aphididae |
| 92 | 8076047169 | Erwinia haradaeae ErCipseudotsugae/2889 | Isolate | Aphididae |
| 93 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 94 | 2518285522 | Photorhabdus khanii NC19 | Isolate | Unclassified |
| 95 | 2521172698 | Candidatus Blochmannia chromaiodes 640 | Isolate | Unclassified |
| 96 | 2582581321 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 97 | 2585427605 | Colwellia sp. MT2012 | Isolate | |
| 98 | 2648501856 | Candidatus Baumannia cicadellinicola BGSS | Isolate | Cicadellidae |
| 99 | 2687453753 | Burkholderiales bacterium B_Cag25 | Isolate | Unclassified |
| 100 | 2791355471 | Vibrio bivalvicida 605 | Isolate | Unclassified |
| 101 | 2838140227 | Dyella sp. OAE510 | Isolate | Unclassified |
| 102 | 2873884416 | Photobacterium sanguinicancri Mj110 CAIM 1827 | Isolate | Majidae |
| 103 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 104 | 3006225627 | Vibrio sp. Hep-1b-8 | Isolate | Unclassified |
| 105 | 3006242587 | Vibrio sp. RE86 | Isolate | Unclassified |
| 106 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 107 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 108 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 109 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 110 | 637000057 | Candidatus Blochmannia pennsylvanicus BPEN | Isolate | Formicidae |
| 111 | 650716016 | Candidatus Moranella endobia PCIT | Isolate | Pseudococcidae |
| 112 | 8048923410 | Photobacterium sanguinicancri CECT 7579 | Isolate | Unclassified |
| 113 | 2528768159 | Alteromonadaceae bacterium Bs31 | Isolate | Unclassified |
| 114 | 2551306520 | Aliivibrio logei ATCC 35077 | Isolate | Majidae |
| 115 | 2648501158 | Vibrio hepatarius DSM 19134 | Isolate | Unclassified |
| 116 | 2718217844 | Candidatus Baumannia cicadellinicola B-GSS | Isolate | Cicadellidae |
| 117 | 2835335304 | Rahnella sp. Larv3_ips | Isolate | Curculionidae |
| 118 | 2855798354 | Achromobacter insolitus AR476-2 | Isolate | Crambidae |
| 119 | 2864926767 | Pseudomonas nitritireducens S00179 | Isolate | Elmidae |
| 120 | 2986970932 | Candidatus Fukatsuia symbiotica 5D | Isolate | Unclassified |
| 121 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 122 | 3300007733 | Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean | Metagenome | |
| 123 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 124 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 125 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 126 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 127 | 8035422605 | Pseudomonas monteilii CY06 | Isolate | |
| 128 | 8076031980 | Erwinia haradaeae ErCikochiana/2762 | Isolate | Aphididae |
| 129 | 2731957969 | Proteus mirabilis Wood | Isolate | Calliphoridae |
| 130 | 2833478085 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 131 | 2864944480 | Pseudomonas fluvialis S00202 | Isolate | Elmidae |
| 132 | 2902438364 | Photobacterium damselae Hep-2a-11 | Isolate | Unclassified |
| 133 | 2892972412 | Sodalis-like symbiont of Bactericera trigonica IL | Isolate | Triozidae |
| 134 | 2987233858 | Stutzerimonas stutzeri AR9-4 | Isolate | Unclassified |
| 135 | 2997878596 | Pseudomonas bohemica IA9 | Isolate | Unclassified |
| 136 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 137 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 138 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 139 | 3300009461 | Microbial communities of aphids from Rhamnus cathartica in Ottawa, Ontario, CA - Aphis nasturtii CNC#HEM071789 seqcov | Metagenome | |
| 140 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 141 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 142 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 143 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 144 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 145 | 8035321120 | Pseudomonas prosekii A2-NA12 | Isolate | Curculionidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0160432_101343 | 3300012818 | Unclassified | 8233 |
| 2 | Ga0160441_100005 | 3300012825 | Bacteria | 613537 |
| 3 | Ga0160467_103252 | 3300012829 | Bacteria | 2868 |
| 4 | Ga0160433_100156 | 3300012846 | Bacteria | 58077 |
| 5 | Ga0160447_100675 | 3300012849 | Unclassified | 14912 |
| 6 | Ga0160457_1000966 | 3300012858 | Unclassified | 9597 |
| 7 | Ga0466657_282375 | 3300042582 | Bacteria | 1650 |
| 8 | FGTW_contig30416 | 2065487013 | Bacteria | 72901 |
| 9 | Ga0103266_1000340 | 3300007067 | Bacteria | 10898 |
| 10 | Ga0102740_1000051 | 3300007140 | Bacteria | 33567 |
| 11 | Ga0102737_1004880 | 3300007142 | Bacteria | 2764 |
| 12 | Ga0105005_1289292 | 3300007505 | Unclassified | 1428 |
| 13 | Ga0466731_086588 | 3300042622 | Bacteria | 4627 |
| 14 | Ga0466724_05744 | 3300042649 | Unclassified | 4262 |
| 15 | Ga0466708_027360 | 3300042652 | Bacteria | 17977 |
| 16 | Ga0466708_234502 | 3300042652 | Bacteria | 3763 |
| 17 | Ga0160435_1000267 | 3300012857 | Bacteria | 23629 |
| 18 | Ga0123353_10111050 | 3300010167 | Bacteria | 4416 |
| 19 | DPO_contig00176 | 2032320009 | Bacteria | 3839 |
| 20 | DPOL_contig03395 | 2035918003 | Bacteria | 31473 |
| 21 | Ga0102737_1000042 | 3300007142 | Bacteria | 36771 |
| 22 | Ga0466709_178238 | 3300042648 | Bacteria | 5058 |
| 23 | Ga0466725_160438 | 3300042654 | Bacteria | 10980 |
| 24 | Ga0466727_302331 | 3300042655 | Bacteria | 5738 |
| 25 | Ga0466697_211595 | 3300042611 | Bacteria | 2572 |
| 26 | Ga0160467_102802 | 3300012829 | Bacteria | 3437 |
| 27 | Ga0160459_100004 | 3300012831 | Bacteria | 605685 |
| 28 | Ga0160430_117545 | 3300012852 | Bacteria | 1040 |
| 29 | Ga0160466_100939 | 3300012809 | Bacteria | 10265 |
| 30 | Ga0466706_194262 | 3300042599 | Bacteria | 2314 |
| 31 | Ga0063521_1000030 | 3300003973 | Bacteria | 121116 |
| 32 | Ga0063521_1000869 | 3300003973 | Unclassified | 10230 |
| 33 | Ga0103261_1001120 | 3300007083 | Unclassified | 6065 |
| 34 | Ga0102740_1000449 | 3300007140 | Bacteria | 11414 |
| 35 | Ga0103264_1001004 | 3300007188 | Bacteria | 18322 |
| 36 | Ga0466734_147711 | 3300042623 | Bacteria | 2990 |
| 37 | Ga0466730_022005 | 3300042625 | Bacteria | 3213 |
| 38 | Ga0466724_04536 | 3300042649 | Bacteria | 7714 |
| 39 | Ga0160443_116240 | 3300012848 | Unclassified | 803 |
| 40 | Ga0160436_1025116 | 3300012861 | Unclassified | 1073 |
| 41 | Ga0123353_10371859 | 3300010167 | Bacteria | 2142 |
| 42 | Ga0160471_100173 | 3300012812 | Unclassified | 23759 |
| 43 | Ga0466701_076263 | 3300042598 | Bacteria | 44102 |
| 44 | DPO_contig00179 | 2032320009 | Unclassified | 4140 |
| 45 | CVPL005W_1000600 | 3300002934 | Bacteria | 13446 |
| 46 | Ga0104041_1124458 | 3300007106 | Bacteria | 892 |
| 47 | Ga0103264_1000025 | 3300007188 | Bacteria | 95049 |
| 48 | Ga0103264_1004397 | 3300007188 | Bacteria | 6621 |
| 49 | Ga0127645_101935 | 3300009461 | Bacteria | 16578 |
| 50 | Ga0466731_181431 | 3300042622 | Unclassified | 4645 |
| 51 | Ga0466703_322716 | 3300042636 | Bacteria | 29409 |
| 52 | Ga0160468_107435 | 3300012819 | Bacteria | 1148 |
| 53 | Ga0160430_106427 | 3300012852 | Unclassified | 2513 |
| 54 | Ga0160465_102528 | 3300012803 | Unclassified | 3942 |
| 55 | SPBB_contig11148 | 2044078006 | Unclassified | 20115 |
| 56 | FGTW_contig30498 | 2065487013 | Bacteria | 21601 |
| 57 | CVPL005W_1000780 | 3300002934 | Bacteria | 10903 |
| 58 | Ga0072941_1306966 | 3300005201 | Bacteria | 14990 |
| 59 | Ga0102736_1002759 | 3300007052 | Bacteria | 6437 |
| 60 | Ga0103268_1000521 | 3300007192 | Bacteria | 11518 |
| 61 | Ga0105524_102019 | 3300007733 | Bacteria | 2695 |
| 62 | Ga0466724_21140 | 3300042649 | Unclassified | 4765 |
| 63 | Ga0160447_115451 | 3300012849 | Bacteria | 1413 |
| 64 | Ga0466691_046900 | 3300042593 | Bacteria | 5963 |
| 65 | Ga0160470_100065 | 3300012813 | Bacteria | 151122 |
| 66 | Ga0063521_1001008 | 3300003973 | Unclassified | 8957 |
| 67 | Ga0103261_1001598 | 3300007083 | Bacteria | 4934 |
| 68 | Ga0102734_1015286 | 3300007129 | Bacteria | 1855 |
| 69 | Ga0103264_1000010 | 3300007188 | Bacteria | 126108 |
| 70 | Ga0103264_1001758 | 3300007188 | Bacteria | 9620 |
| 71 | Ga0466725_154110 | 3300042654 | Bacteria | 8901 |
| 72 | Ga0160470_100737 | 3300012813 | Unclassified | 10353 |
| 73 | Ga0160453_102845 | 3300012814 | Bacteria | 3939 |
| 74 | Ga0160443_109416 | 3300012848 | Bacteria | 1150 |
| 75 | Ga0160434_104772 | 3300012850 | Bacteria | 2255 |
| 76 | Ga0160448_104634 | 3300012854 | Bacteria | 3783 |
| 77 | Ga0160442_105130 | 3300012806 | Unclassified | 1326 |
| 78 | HBC_ctgsDRAFT_1000144 | 3300000333 | Bacteria | 17282 |
| 79 | CVPL010W_10006825 | 3300002931 | Bacteria | 11517 |
| 80 | Ga0102735_1000021 | 3300007080 | Bacteria | 54507 |
| 81 | Ga0103264_1001303 | 3300007188 | Bacteria | 14176 |
| 82 | Ga0466734_075935 | 3300042623 | Bacteria | 14561 |
| 83 | Ga0466734_131298 | 3300042623 | Bacteria | 1530 |
| 84 | Ga0466703_175258 | 3300042636 | Bacteria | 10089 |
| 85 | Ga0160453_100036 | 3300012814 | Bacteria | 166547 |
| 86 | Ga0160455_100140 | 3300012837 | Bacteria | 90464 |
| 87 | Ga0160447_108038 | 3300012849 | Bacteria | 2567 |
| 88 | Ga0466701_089861 | 3300042598 | Bacteria | 71855 |
| 89 | SPBB_contig11632 | 2044078006 | Unclassified | 10809 |
| 90 | Meta3P_1003519 | 3300002464 | Unclassified | 26411 |
| 91 | CVPL005W_1000553 | 3300002934 | Bacteria | 14191 |
| 92 | Ga0102738_1000182 | 3300007141 | Bacteria | 14527 |
| 93 | Ga0103264_1000021 | 3300007188 | Bacteria | 137150 |
| 94 | Ga0103264_1000032 | 3300007188 | Bacteria | 148835 |
| 95 | Ga0127657_103045 | 3300009457 | Bacteria | 31964 |
| 96 | Ga0466715_439749 | 3300042616 | Bacteria | 2494 |
| 97 | Ga0466734_070317 | 3300042623 | Bacteria | 3999 |
| 98 | Ga0466730_045061 | 3300042625 | Bacteria | 1840 |
Family Sequences
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF08032 | GO:0008168 | methyltransferase activity | MF |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.74 | 0.82 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.