Protein Family IF01842

Metagenome Isolate
181 Members
145 Samples
98 Scaffolds
251.24 Avg Length

🧬 Representative Sequence

ID
3300007188|Ga0103264_1000025|Ga0103264_100002511
Length
299 aa
Sequence
MSLRRLQFVCLNSGGNIYPDVYFLFVQYCVLPRACAAHADSINHAAGDVTGGQYVSGFHAVVARLRHAPASIKTLYVDVARRDKRMQTFVAQAQAAGVQPKFVAADRLDSLSKGLRHQGVIALAVAQPLATDIDACLDAVEQAGRTPLLLVLDGVTDPHNLGACLRTADAAGVHAVIAPRDRAVGLTNVVRRVACGAAETMPYFMVTNLARTLRHLKARDLWVIGTDDQASASLHQADLRRATAWVVGAEGAGMRRLTRETCDELVRIPMQGCVESLNVSVASAVCLYEAVRQRGDAG*

📊 Sample Types

Isolate 45.9%
Metagenome 54.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 25.8%
Formicidae 10.9%
Curculionidae 8.6%
Culicidae 7.8%
Elmidae 7.0%
Termitidae 7.0%
Armadillidiidae 4.7%
Kalotermitidae 3.9%
Drosophilidae 3.1%
Aphididae 2.3%
Apidae 1.6%
Psyllidae 1.6%
Palinuridae 1.6%
Cicadellidae 1.6%
Majidae 1.6%
Artemiidae 0.8%
Cixiidae 0.8%
Gryllidae 0.8%
Termopsidae 0.8%
Trigoniulidae 0.8%
Lysianassidae 0.8%
Aphalaridae 0.8%
Hodotermitidae 0.8%
Penaeidae 0.8%
Glossinidae 0.8%
Pseudococcidae 0.8%
Crambidae 0.8%
Calliphoridae 0.8%
Triozidae 0.8%

🌳 Taxonomy

Archaea 0
Bacteria 160
Eukaryota 0
Viruses 0
Unclassified 21

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2032320009 Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine Metagenome Curculionidae
2 2599185261 Thorsellia anophelis DSM 18579 Isolate Unclassified
3 2711768158 Vibrio coralliilyticus S2043 Isolate Unclassified
4 2850895757 Vibrio campbellii 170502 Isolate Unclassified
5 2864903489 Pseudomonas aeuginosa S00161 Isolate Elmidae
6 2870361953 Entomomonas moraniae QZS01 Isolate Apidae
7 2872471378 Vibrio owensii V180403 Isolate Unclassified
8 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
9 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
10 3300012818 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG Metagenome
11 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
12 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
13 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
14 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
15 8022439116 Vibrio sp. ArtGut-C1 Isolate Artemiidae
16 8062647588 Nissabacter archeti JGM97 Isolate Drosophilidae
17 2565956547 Candidatus Profftella armatura Isolate Psyllidae
18 2571042554 Vibrio owensii CAIM 1854 Isolate Palinuridae
19 2603880165 Burkholderiales A1 Isolate Unclassified
20 2603880172 Burkholderiales C Isolate Unclassified
21 2617270844 Dyella sp. HyOG Isolate Cixiidae
22 2864751016 Pseudomonas oryzihabitans S00005 Isolate Elmidae
23 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
24 2990166910 Pseudomonas typographi CA3A Isolate Curculionidae
25 3000478755 Entomomonas asaccharolytica F2A Isolate Gryllidae
26 3007478678 Pseudomonas sp. S37 Isolate Curculionidae
27 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
28 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
29 3300009457 Microbial communities of aphids from Cornus stolonifera in Ithaca, NY, USA - Anoecia oenotherae NM10041110_01 seqcov Metagenome
30 3300012803 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG Metagenome
31 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
32 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
33 637000219 Pseudomonas entomophila L48 Isolate Unclassified
34 8035326735 Pseudomonas prosekii A2-NA13 Isolate Curculionidae
35 2511231129 Vibrio sp. EJY3 Isolate Unclassified
36 2519899622 Pseudomonas sp. Ag1 Isolate Culicidae
37 2565956518 Vibrio pacinii DSM 19139 Isolate Unclassified
38 2864755708 Massilia timonae S00006 Isolate Elmidae
39 2902896024 Pseudoalteromonas sp. S1612 Isolate Unclassified
40 2908136803 Vibrio owensii 1700302 Isolate Unclassified
41 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
42 3007473699 Pseudomonas sp. S30 Isolate Curculionidae
43 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
44 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
45 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
46 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
47 640963010 Vibrio harveyi HY01 Isolate Unclassified
48 8011329375 Pseudomonas sp. S31 Isolate Curculionidae
49 8011357093 Pseudomonas schmalbachii Milli4 Isolate Trigoniulidae
50 2065487013 Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm Metagenome
51 2501651205 Colwellia sp. MT41 Isolate Lysianassidae
52 2509601000 Secondary endosymbiont of Ctenarytaina eucalypti Thao2000 Isolate Aphalaridae
53 2597489903 Providencia sneebia DSM 19967 Isolate Drosophilidae
54 2654587515 Vibrio owensii CAIM 1854 Isolate Palinuridae
55 2773857880 Candidatus Profftella armatura YCPA Isolate Psyllidae
56 2858407585 Photobacterium swingsii DSM 24669 Isolate Unclassified
57 2864739902 Pseudomonas viridiflavia S00001 Isolate Elmidae
58 2864853652 Pseudomonas rhodesiae S00114 Isolate Elmidae
59 2912636047 Vibrio crassostreae 9CS106 Isolate Unclassified
60 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
61 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
62 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
63 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
64 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
65 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
66 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
67 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
68 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
69 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
70 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
71 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
72 8048928574 Photobacterium swingsii CECT 7576 Isolate Unclassified
73 2044078006 Dendroctonus frontalis bacterial communities from Mississippi, USA Metagenome Curculionidae
74 2585428048 Colwellia sp. NBT2012 Isolate
75 2684622551 Vibrio campbellii E1 Isolate Unclassified
76 2864745180 Pseudomonas rhodesiae S00002 Isolate Elmidae
77 2864847319 Pseudomonas alcaligenes S00099 Isolate Elmidae
78 2877638525 Vibrio campbellii 1114GL Isolate Penaeidae
79 2989793055 Vibrio atypicus DSM 25292 Isolate Unclassified
80 3300007141 Ant gut microbial communities from Cephalotes maculatus, Brazil Metagenome Formicidae
81 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
82 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
83 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
84 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
85 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
86 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
87 637000270 Sodalis glossinidius morsitans Isolate Glossinidae
88 649633028 Candidatus Blochmannia vafer BVAF Isolate Formicidae
89 8051461712 Vibrio vulnificus Vv002 Isolate
90 8052469819 Pseudomonas putida DZ-F23 Isolate
91 8076028257 Erwinia haradaeae ErCisplendens/pseudotsugae/3390 Isolate Aphididae
92 8076047169 Erwinia haradaeae ErCipseudotsugae/2889 Isolate Aphididae
93 2035918003 Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine Metagenome Curculionidae
94 2518285522 Photorhabdus khanii NC19 Isolate Unclassified
95 2521172698 Candidatus Blochmannia chromaiodes 640 Isolate Unclassified
96 2582581321 Oceanospirillum multiglobuliferum ATCC 33336 Isolate Unclassified
97 2585427605 Colwellia sp. MT2012 Isolate
98 2648501856 Candidatus Baumannia cicadellinicola BGSS Isolate Cicadellidae
99 2687453753 Burkholderiales bacterium B_Cag25 Isolate Unclassified
100 2791355471 Vibrio bivalvicida 605 Isolate Unclassified
101 2838140227 Dyella sp. OAE510 Isolate Unclassified
102 2873884416 Photobacterium sanguinicancri Mj110 CAIM 1827 Isolate Majidae
103 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
104 3006225627 Vibrio sp. Hep-1b-8 Isolate Unclassified
105 3006242587 Vibrio sp. RE86 Isolate Unclassified
106 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
107 3300007106 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut Metagenome Drosophilidae
108 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
109 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
110 637000057 Candidatus Blochmannia pennsylvanicus BPEN Isolate Formicidae
111 650716016 Candidatus Moranella endobia PCIT Isolate Pseudococcidae
112 8048923410 Photobacterium sanguinicancri CECT 7579 Isolate Unclassified
113 2528768159 Alteromonadaceae bacterium Bs31 Isolate Unclassified
114 2551306520 Aliivibrio logei ATCC 35077 Isolate Majidae
115 2648501158 Vibrio hepatarius DSM 19134 Isolate Unclassified
116 2718217844 Candidatus Baumannia cicadellinicola B-GSS Isolate Cicadellidae
117 2835335304 Rahnella sp. Larv3_ips Isolate Curculionidae
118 2855798354 Achromobacter insolitus AR476-2 Isolate Crambidae
119 2864926767 Pseudomonas nitritireducens S00179 Isolate Elmidae
120 2986970932 Candidatus Fukatsuia symbiotica 5D Isolate Unclassified
121 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Formicidae
122 3300007733 Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean Metagenome
123 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
124 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
125 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
126 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
127 8035422605 Pseudomonas monteilii CY06 Isolate
128 8076031980 Erwinia haradaeae ErCikochiana/2762 Isolate Aphididae
129 2731957969 Proteus mirabilis Wood Isolate Calliphoridae
130 2833478085 Oceanospirillum multiglobuliferum ATCC 33336 Isolate Unclassified
131 2864944480 Pseudomonas fluvialis S00202 Isolate Elmidae
132 2902438364 Photobacterium damselae Hep-2a-11 Isolate Unclassified
133 2892972412 Sodalis-like symbiont of Bactericera trigonica IL Isolate Triozidae
134 2987233858 Stutzerimonas stutzeri AR9-4 Isolate Unclassified
135 2997878596 Pseudomonas bohemica IA9 Isolate Unclassified
136 3300002464 Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 Metagenome Culicidae
137 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Formicidae
138 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
139 3300009461 Microbial communities of aphids from Rhamnus cathartica in Ottawa, Ontario, CA - Aphis nasturtii CNC#HEM071789 seqcov Metagenome
140 3300012806 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG Metagenome
141 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
142 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
143 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
144 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
145 8035321120 Pseudomonas prosekii A2-NA12 Isolate Curculionidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0160432_101343 3300012818 Unclassified 8233
2 Ga0160441_100005 3300012825 Bacteria 613537
3 Ga0160467_103252 3300012829 Bacteria 2868
4 Ga0160433_100156 3300012846 Bacteria 58077
5 Ga0160447_100675 3300012849 Unclassified 14912
6 Ga0160457_1000966 3300012858 Unclassified 9597
7 Ga0466657_282375 3300042582 Bacteria 1650
8 FGTW_contig30416 2065487013 Bacteria 72901
9 Ga0103266_1000340 3300007067 Bacteria 10898
10 Ga0102740_1000051 3300007140 Bacteria 33567
11 Ga0102737_1004880 3300007142 Bacteria 2764
12 Ga0105005_1289292 3300007505 Unclassified 1428
13 Ga0466731_086588 3300042622 Bacteria 4627
14 Ga0466724_05744 3300042649 Unclassified 4262
15 Ga0466708_027360 3300042652 Bacteria 17977
16 Ga0466708_234502 3300042652 Bacteria 3763
17 Ga0160435_1000267 3300012857 Bacteria 23629
18 Ga0123353_10111050 3300010167 Bacteria 4416
19 DPO_contig00176 2032320009 Bacteria 3839
20 DPOL_contig03395 2035918003 Bacteria 31473
21 Ga0102737_1000042 3300007142 Bacteria 36771
22 Ga0466709_178238 3300042648 Bacteria 5058
23 Ga0466725_160438 3300042654 Bacteria 10980
24 Ga0466727_302331 3300042655 Bacteria 5738
25 Ga0466697_211595 3300042611 Bacteria 2572
26 Ga0160467_102802 3300012829 Bacteria 3437
27 Ga0160459_100004 3300012831 Bacteria 605685
28 Ga0160430_117545 3300012852 Bacteria 1040
29 Ga0160466_100939 3300012809 Bacteria 10265
30 Ga0466706_194262 3300042599 Bacteria 2314
31 Ga0063521_1000030 3300003973 Bacteria 121116
32 Ga0063521_1000869 3300003973 Unclassified 10230
33 Ga0103261_1001120 3300007083 Unclassified 6065
34 Ga0102740_1000449 3300007140 Bacteria 11414
35 Ga0103264_1001004 3300007188 Bacteria 18322
36 Ga0466734_147711 3300042623 Bacteria 2990
37 Ga0466730_022005 3300042625 Bacteria 3213
38 Ga0466724_04536 3300042649 Bacteria 7714
39 Ga0160443_116240 3300012848 Unclassified 803
40 Ga0160436_1025116 3300012861 Unclassified 1073
41 Ga0123353_10371859 3300010167 Bacteria 2142
42 Ga0160471_100173 3300012812 Unclassified 23759
43 Ga0466701_076263 3300042598 Bacteria 44102
44 DPO_contig00179 2032320009 Unclassified 4140
45 CVPL005W_1000600 3300002934 Bacteria 13446
46 Ga0104041_1124458 3300007106 Bacteria 892
47 Ga0103264_1000025 3300007188 Bacteria 95049
48 Ga0103264_1004397 3300007188 Bacteria 6621
49 Ga0127645_101935 3300009461 Bacteria 16578
50 Ga0466731_181431 3300042622 Unclassified 4645
51 Ga0466703_322716 3300042636 Bacteria 29409
52 Ga0160468_107435 3300012819 Bacteria 1148
53 Ga0160430_106427 3300012852 Unclassified 2513
54 Ga0160465_102528 3300012803 Unclassified 3942
55 SPBB_contig11148 2044078006 Unclassified 20115
56 FGTW_contig30498 2065487013 Bacteria 21601
57 CVPL005W_1000780 3300002934 Bacteria 10903
58 Ga0072941_1306966 3300005201 Bacteria 14990
59 Ga0102736_1002759 3300007052 Bacteria 6437
60 Ga0103268_1000521 3300007192 Bacteria 11518
61 Ga0105524_102019 3300007733 Bacteria 2695
62 Ga0466724_21140 3300042649 Unclassified 4765
63 Ga0160447_115451 3300012849 Bacteria 1413
64 Ga0466691_046900 3300042593 Bacteria 5963
65 Ga0160470_100065 3300012813 Bacteria 151122
66 Ga0063521_1001008 3300003973 Unclassified 8957
67 Ga0103261_1001598 3300007083 Bacteria 4934
68 Ga0102734_1015286 3300007129 Bacteria 1855
69 Ga0103264_1000010 3300007188 Bacteria 126108
70 Ga0103264_1001758 3300007188 Bacteria 9620
71 Ga0466725_154110 3300042654 Bacteria 8901
72 Ga0160470_100737 3300012813 Unclassified 10353
73 Ga0160453_102845 3300012814 Bacteria 3939
74 Ga0160443_109416 3300012848 Bacteria 1150
75 Ga0160434_104772 3300012850 Bacteria 2255
76 Ga0160448_104634 3300012854 Bacteria 3783
77 Ga0160442_105130 3300012806 Unclassified 1326
78 HBC_ctgsDRAFT_1000144 3300000333 Bacteria 17282
79 CVPL010W_10006825 3300002931 Bacteria 11517
80 Ga0102735_1000021 3300007080 Bacteria 54507
81 Ga0103264_1001303 3300007188 Bacteria 14176
82 Ga0466734_075935 3300042623 Bacteria 14561
83 Ga0466734_131298 3300042623 Bacteria 1530
84 Ga0466703_175258 3300042636 Bacteria 10089
85 Ga0160453_100036 3300012814 Bacteria 166547
86 Ga0160455_100140 3300012837 Bacteria 90464
87 Ga0160447_108038 3300012849 Bacteria 2567
88 Ga0466701_089861 3300042598 Bacteria 71855
89 SPBB_contig11632 2044078006 Unclassified 10809
90 Meta3P_1003519 3300002464 Unclassified 26411
91 CVPL005W_1000553 3300002934 Bacteria 14191
92 Ga0102738_1000182 3300007141 Bacteria 14527
93 Ga0103264_1000021 3300007188 Bacteria 137150
94 Ga0103264_1000032 3300007188 Bacteria 148835
95 Ga0127657_103045 3300009457 Bacteria 31964
96 Ga0466715_439749 3300042616 Bacteria 2494
97 Ga0466734_070317 3300042623 Bacteria 3999
98 Ga0466730_045061 3300042625 Bacteria 1840

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300012818 Ga0160432_101343 Ga0160432_1013437 229
2 3300002934 CVPL005W_1000553 CVPL005W_10005537 242
3 3300007080 Ga0102735_1000021 Ga0102735_10000216 244
4 3300007188 Ga0103264_1000010 Ga0103264_100001062 244
5 3300042593 Ga0466691_046900 Ga0466691_046900_3251_3985 244
6 3300042616 Ga0466715_439749 Ga0466715_439749_1393_2127 244
7 iso_pr_bacteria 2599185261 2599815899 244
8 3300012825 Ga0160441_100005 Ga0160441_10000521 245
9 3300012837 Ga0160455_100140 Ga0160455_10014021 245
10 iso_pr_bacteria 2565956518 2566027387 245
11 iso_pr_bacteria 2597489903 2597926786 245
12 iso_pr_bacteria 2648501158 2648750911 245
13 iso_pr_bacteria 2711768158 2712478909 245
14 iso_pr_bacteria 2791355471 2794374870 245
15 iso_pr_bacteria 2855798354 2855802159 245
16 iso_pr_bacteria 2858407585 2858410280 245
17 iso_pr_bacteria 2873884416 2873887861 245
18 iso_pr_bacteria 2892972412 2892975444 245
19 iso_pr_bacteria 2989793055 2989797014 245
20 iso_pr_bacteria 3006225627 3006226663 245
21 iso_pr_bacteria 3006242587 3006243690 245
22 iso_pr_bacteria 637000270 637852273 245
23 iso_pr_bacteria 650716016 651012210 245
24 iso_pr_bacteria 8048923410 8048926597 245
25 iso_pr_bacteria 8048928574 8048931787 245
26 iso_pr_bacteria 8076028257 8076028355 245
27 iso_pr_bacteria 8076047169 8076047270 245
28 3300007733 Ga0105524_102019 Ga0105524_1020194 246
29 3300009457 Ga0127657_103045 Ga0127657_1030453 246
30 3300009461 Ga0127645_101935 Ga0127645_1019351 246
31 iso_pr_bacteria 2912636047 2912636087 246
32 iso_pr_bacteria 8062647588 8062651239 246
33 3300007188 Ga0103264_1001004 Ga0103264_100100420 247
34 3300042652 Ga0466708_234502 Ga0466708_234502_124_867 247
35 iso_pr_bacteria 2511231129 2511732374 247
36 iso_pr_bacteria 2521172698 2521990467 247
37 iso_pr_bacteria 2528768159 2529057003 247
38 iso_pr_bacteria 2551306520 2553401242 247
39 iso_pr_bacteria 2571042554 2572926606 247
40 iso_pr_bacteria 2617270844 2617735261 247
41 iso_pr_bacteria 2654587515 2654662455 247
42 iso_pr_bacteria 2684622551 2684821241 247
43 iso_pr_bacteria 2731957969 2734001937 247
44 iso_pr_bacteria 2835335304 2835336218 247
45 iso_pr_bacteria 2838140227 2838142118 247
46 iso_pr_bacteria 2850895757 2850898730 247
47 iso_pr_bacteria 2864755708 2864757877 247
48 iso_pr_bacteria 2872471378 2872474797 247
49 iso_pr_bacteria 2877638525 2877640796 247
50 iso_pr_bacteria 2902438364 2902441129 247
51 iso_pr_bacteria 2902896024 2902896663 247
52 iso_pr_bacteria 2908136803 2908137090 247
53 iso_pr_bacteria 2986970932 2986974016 247
54 iso_pr_bacteria 637000057 637672524 247
55 iso_pr_bacteria 637000219 638003797 247
56 iso_pr_bacteria 640963010 641029937 247
57 iso_pr_bacteria 8051461712 8051465126 247
58 3300003973 Ga0063521_1000869 Ga0063521_10008694 248
59 3300007083 Ga0103261_1001120 Ga0103261_10011203 248
60 3300010167 Ga0123353_10111050 Ga0123353_101110502 248
61 3300012812 Ga0160471_100173 Ga0160471_1001733 248
62 3300012831 Ga0160459_100004 Ga0160459_10000445 248
63 3300012850 Ga0160434_104772 Ga0160434_1047722 248
64 3300042598 Ga0466701_076263 Ga0466701_076263_42840_43586 248
65 3300042598 Ga0466701_089861 Ga0466701_089861_70578_71324 248
66 3300042599 Ga0466706_194262 Ga0466706_194262_359_1105 248
67 3300042611 Ga0466697_211595 Ga0466697_211595_236_982 248
68 3300042622 Ga0466731_086588 Ga0466731_086588_1890_2636 248
69 3300042622 Ga0466731_181431 Ga0466731_181431_1865_2611 248
70 3300042623 Ga0466734_070317 Ga0466734_070317_357_1103 248
71 3300042623 Ga0466734_131298 Ga0466734_131298_689_1435 248
72 3300042623 Ga0466734_147711 Ga0466734_147711_741_1487 248
73 3300042625 Ga0466730_022005 Ga0466730_022005_1153_1899 248
74 3300042625 Ga0466730_045061 Ga0466730_045061_617_1363 248
75 3300042649 Ga0466724_04536 Ga0466724_04536_6574_7320 248
76 3300042649 Ga0466724_05744 Ga0466724_05744_387_1133 248
77 3300042649 Ga0466724_21140 Ga0466724_21140_881_1627 248
78 3300042654 Ga0466725_160438 Ga0466725_160438_191_937 248
79 iso_pr_bacteria 2565956547 2566132049 248
80 iso_pr_bacteria 2648501856 2651561137 248
81 iso_pr_bacteria 2773857880 2774725017 248
82 iso_pr_bacteria 2864903489 2864906312 248
83 iso_pr_bacteria 2990166910 2990169260 248
84 iso_pr_bacteria 3007473699 3007477039 248
85 iso_pr_bacteria 3007478678 3007481883 248
86 iso_pr_bacteria 649633028 649854370 248
87 iso_pr_bacteria 8011329375 8011332997 248
88 iso_pr_bacteria 8022439116 8022442264 248
89 iso_pr_bacteria 8035422605 8035425294 248
90 iso_pr_bacteria 8052469819 8052474265 248
91 iso_pr_bacteria 8076031980 8076032089 248
92 3300002934 CVPL005W_1000780 CVPL005W_10007807 249
93 3300005201 Ga0072941_1306966 Ga0072941_13069665 249
94 3300010167 Ga0123353_10371859 Ga0123353_103718592 249
95 3300012803 Ga0160465_102528 Ga0160465_1025282 249
96 3300012814 Ga0160453_100036 Ga0160453_10003651 249
97 3300012814 Ga0160453_102845 Ga0160453_1028451 249
98 3300012846 Ga0160433_100156 Ga0160433_10015636 249
99 3300012852 Ga0160430_117545 Ga0160430_1175452 249
100 iso_pr_bacteria 2603880165 2606014485 249
101 iso_pr_bacteria 3000478755 3000480330 249
102 3300002931 CVPL010W_10006825 CVPL010W_100068254 250
103 3300003973 Ga0063521_1000030 Ga0063521_100003031 250
104 3300012819 Ga0160468_107435 Ga0160468_1074352 250
105 3300012848 Ga0160443_109416 Ga0160443_1094162 250
106 iso_pr_bacteria 2687453753 2690039183 250
107 iso_pr_bacteria 2864751016 2864753580 250
108 iso_pr_bacteria 2864944480 2864944770 250
109 iso_pr_bacteria 2870361953 2870362896 250
110 2032320009 DPO_contig00179 DPOB_207930 251
111 2044078006 SPBB_contig11148 SPBB_140230 251
112 2044078006 SPBB_contig11632 SPBB_641290 251
113 3300000333 HBC_ctgsDRAFT_1000144 HBC_ctgsDRAFT_10001448 251
114 3300007083 Ga0103261_1001598 Ga0103261_10015985 251
115 3300007129 Ga0102734_1015286 Ga0102734_10152862 251
116 3300007188 Ga0103264_1001758 Ga0103264_10017587 251
117 3300042636 Ga0466703_322716 Ga0466703_322716_3345_4142 251
118 iso_pr_bacteria 2501651205 2501715666 251
119 iso_pr_bacteria 2519899622 2520392369 251
120 iso_pr_bacteria 2585427605 2585889646 251
121 iso_pr_bacteria 2585428048 2587694347 251
122 iso_pr_bacteria 2864926767 2864932336 251
123 iso_pr_bacteria 2987233858 2987235174 251
124 iso_pr_bacteria 8011357093 8011359413 251
125 2032320009 DPO_contig00176 DPOB_203720 252
126 3300002464 Meta3P_1003519 Meta3P_100351916 252
127 3300007505 Ga0105005_1289292 Ga0105005_12892921 252
128 3300012813 Ga0160470_100065 Ga0160470_10006517 252
129 3300012848 Ga0160443_116240 Ga0160443_1162401 252
130 3300012849 Ga0160447_108038 Ga0160447_1080383 252
131 3300012852 Ga0160430_106427 Ga0160430_1064271 252
132 iso_pr_bacteria 2864847319 2864851997 252
133 iso_pr_bacteria 2997878596 2997881037 252
134 2065487013 FGTW_contig30498 FGTW_01036000 253
135 3300012849 Ga0160447_100675 Ga0160447_10067510 253
136 iso_pr_bacteria 2864739902 2864742218 253
137 iso_pr_bacteria 8035321120 8035322465 253
138 iso_pr_bacteria 8035326735 8035330712 253
139 3300007052 Ga0102736_1002759 Ga0102736_10027595 254
140 3300007140 Ga0102740_1000051 Ga0102740_100005124 254
141 3300007142 Ga0102737_1004880 Ga0102737_10048802 254
142 3300007188 Ga0103264_1000032 Ga0103264_100003279 254
143 3300012806 Ga0160442_105130 Ga0160442_1051302 254
144 3300012813 Ga0160470_100737 Ga0160470_1007378 254
145 3300012849 Ga0160447_115451 Ga0160447_1154512 254
146 3300012854 Ga0160448_104634 Ga0160448_1046342 254
147 3300012857 Ga0160435_1000267 Ga0160435_100026720 254
148 iso_pr_bacteria 2864745180 2864746670 254
149 iso_pr_bacteria 2864853652 2864856755 254
150 3300007188 Ga0103264_1001303 Ga0103264_10013035 255
151 3300012858 Ga0160457_1000966 Ga0160457_10009668 255
152 3300007106 Ga0104041_1124458 Ga0104041_11244581 256
153 3300007188 Ga0103264_1000021 Ga0103264_100002134 256
154 3300007188 Ga0103264_1004397 Ga0103264_10043974 256
155 3300012809 Ga0160466_100939 Ga0160466_1009398 256
156 3300012829 Ga0160467_102802 Ga0160467_1028022 256
157 3300012829 Ga0160467_103252 Ga0160467_1032522 256
158 3300012861 Ga0160436_1025116 Ga0160436_10251161 256
159 3300042623 Ga0466734_075935 Ga0466734_075935_13436_14206 256
160 3300042652 Ga0466708_027360 Ga0466708_027360_13324_14094 256
161 iso_pr_bacteria 2509601000 2509601485 257
162 3300007192 Ga0103268_1000521 Ga0103268_10005212 258
163 3300042582 Ga0466657_282375 Ga0466657_282375_860_1636 258
164 3300042654 Ga0466725_154110 Ga0466725_154110_4563_5339 258
165 3300007067 Ga0103266_1000340 Ga0103266_10003405 259
166 iso_pr_bacteria 2718217844 2719022862 259
167 iso_pr_bacteria 2518285522 2518343488 261
168 3300042655 Ga0466727_302331 Ga0466727_302331_2340_3128 262
169 3300042636 Ga0466703_175258 Ga0466703_175258_756_1553 265
170 3300002934 CVPL005W_1000600 CVPL005W_10006005 266
171 3300007142 Ga0102737_1000042 Ga0102737_100004213 266
172 3300007140 Ga0102740_1000449 Ga0102740_10004496 267
173 2035918003 DPOL_contig03395 DPOLB_1677030 271
174 3300003973 Ga0063521_1001008 Ga0063521_10010083 272
175 3300007141 Ga0102738_1000182 Ga0102738_10001826 272
176 iso_pr_bacteria 2603880172 2606033516 273
177 2065487013 FGTW_contig30416 FGTW_00368630 278
178 iso_pr_bacteria 2582581321 2585351848 282
179 iso_pr_bacteria 2833478085 2833480673 282
180 3300042648 Ga0466709_178238 Ga0466709_178238_1016_1876 286
181 3300007188 Ga0103264_1000025 Ga0103264_100002511 299

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00588 SpoU_methylase SpoU rRNA Methylase family 148 288 0.97
PF08032 SpoU_sub_bind RNA 2'-O ribose methyltransferase substrate binding 54 124 0.96

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF08032 GO:0008168 methyltransferase activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.74 0.82 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.