Protein Family IF01799

Metagenome Isolate
228 Members
65 Samples
213 Scaffolds
188.22 Avg Length

🧬 Representative Sequence

ID
3300007143|Ga0104048_1022679|Ga0104048_10226791
Length
193 aa
Sequence
MTKEKKENLTLDRIILGIDPGTTIMGFGLIRVVNKQMEFIQLNELQLNKYDDHYTKLRRIFERTMELIETHCPDEIAIEAPFFGKNVQSMLKLGRAQGVAMAAGLSRGIPITEYEPKKIKMAITGNGNASKEQVAKMLQQLLGLKELPKNLDSTDGLAAAVCHFFNSGKTVVGKSYSGWDAFVKQNQDRVKK*

📊 Sample Types

Isolate 6.6%
Metagenome 93.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 29.7%
Kalotermitidae 21.9%
Unclassified 12.5%
Blattidae 6.2%
Drosophilidae 6.2%
Termopsidae 4.7%
Rhinotermitidae 4.7%
Passalidae 3.1%
Elmidae 3.1%
Nephropidae 1.6%
Daphniidae 1.6%
Cambaridae 1.6%
Formicidae 1.6%
Hodotermitidae 1.6%

🌳 Taxonomy

Archaea 0
Bacteria 211
Eukaryota 0
Viruses 0
Unclassified 17

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2838772460 Aquimarina sp. I32.4 Isolate Nephropidae
2 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
3 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
4 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
5 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
6 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
7 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
8 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
9 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
10 2904728850 Flavobacterium sp. xlx-214 Isolate
11 2811995047 Flavobacterium succinicans DD5b Isolate Daphniidae
12 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
13 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
14 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
15 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
16 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
17 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
18 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
19 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
20 2820778767 Unclassified Bacteroidetes Emb289P4bin10 Isolate Unclassified
21 2910930387 Dysgonomonas sp. 216 Isolate Blattidae
22 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
23 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
24 3300005307 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 1 gut Metagenome Drosophilidae
25 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
26 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
27 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
28 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
29 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
30 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
31 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
32 2864878056 Flavobacterium notoginsengisoli S00128 Isolate Elmidae
33 2864886855 Flavobacterium nitrogenifigens S00142 Isolate Elmidae
34 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
35 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
36 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
37 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
38 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
39 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
40 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
41 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
42 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
43 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
44 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
45 2958471994 Flavobacterium sp. xlx-221 Isolate Cambaridae
46 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
47 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
48 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
49 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
50 2910949487 Dysgonomonas sp. 520 Isolate Blattidae
51 2910959314 Dysgonomonas sp. 511 Isolate Blattidae
52 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
53 3300007153 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut Metagenome Drosophilidae
54 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
55 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
56 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
57 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
58 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
59 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
60 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
61 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
62 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
63 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
64 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
65 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466697_172265 3300042611 Bacteria 5306
2 Ga0466705_157007 3300042612 Bacteria 6679
3 Ga0466735_018171 3300042624 Bacteria 4250
4 Ga0466735_056025 3300042624 Bacteria 1896
5 Ga0466709_389939 3300042648 Bacteria 3877
6 Ga0466708_016786 3300042652 Bacteria 8829
7 Ga0466708_176791 3300042652 Bacteria 38975
8 Ga0466727_024869 3300042655 Bacteria 2411
9 Ga0466727_322923 3300042655 Bacteria 4838
10 Ga0466715_051157 3300042616 Bacteria 50381
11 Ga0466715_332974 3300042616 Bacteria 9767
12 Ga0466718_121661 3300042617 Bacteria 1350
13 Ga0466728_030716 3300042620 Bacteria 7534
14 Ga0466728_262745 3300042620 Bacteria 20432
15 Ga0068305_10073993 3300005083 Bacteria 6876
16 Ga0104045_1008007 3300007085 Unclassified 2581
17 Ga0466692_119633 3300042591 Bacteria 108688
18 Ga0466693_203628 3300042592 Bacteria 2308
19 Ga0466691_023015 3300042593 Bacteria 13261
20 Ga0466691_037646 3300042593 Bacteria 9432
21 Ga0466694_351087 3300042594 Bacteria 2621
22 Ga0466696_352436 3300042596 Bacteria 3323
23 Ga0466696_379785 3300042596 Bacteria 15194
24 Ga0123357_10042199 3300009784 Bacteria 6203
25 Ga0123357_10108205 3300009784 Bacteria 3556
26 Ga0123354_10030612 3300010882 Bacteria 8449
27 Ga0466700_229482 3300042600 Bacteria 1385
28 Ga0466707_194915 3300042601 Bacteria 10556
29 Ga0466716_295477 3300042605 Bacteria 3606
30 Ga0466719_361408 3300042606 Bacteria 1567
31 Ga0466722_104373 3300042609 Bacteria 4820
32 Ga0466722_265423 3300042609 Bacteria 6286
33 Ga0466705_084401 3300042612 Bacteria 19488
34 Ga0466727_351836 3300042655 Bacteria 2906
35 Ga0466703_127125 3300042636 Bacteria 44060
36 Ga0466704_409426 3300042643 Bacteria 6093
37 Ga0466710_040696 3300042613 Bacteria 13162
38 Ga0466711_053448 3300042615 Bacteria 4600
39 Ga0466718_050736 3300042617 Bacteria 1543
40 IMNBL1DRAFT_c0001037 3300000062 Bacteria 21542
41 Ga0068305_10134251 3300005083 Unclassified 6686
42 Ga0104048_1168761 3300007143 Unclassified 2928
43 Ga0123357_10000516 3300009784 Bacteria 37764
44 Ga0466656_309631 3300042550 Bacteria 2697
45 Ga0466690_161857 3300042590 Bacteria 15085
46 Ga0466696_192414 3300042596 Unclassified 2027
47 Ga0466696_241827 3300042596 Bacteria 9775
48 Ga0466696_451467 3300042596 Bacteria 1729
49 Ga0123357_10154833 3300009784 Unclassified 2768
50 Ga0123353_10483559 3300010167 Bacteria 1811
51 Ga0466701_064663 3300042598 Bacteria 3900
52 Ga0466707_353315 3300042601 Bacteria 2198
53 Ga0466713_148662 3300042602 Bacteria 25209
54 Ga0466719_117183 3300042606 Bacteria 13535
55 Ga0466719_125031 3300042606 Bacteria 11764
56 Ga0466719_258503 3300042606 Bacteria 4142
57 Ga0466719_379318 3300042606 Bacteria 3079
58 Ga0466733_174530 3300042659 Bacteria 16715
59 Ga0466735_018793 3300042624 Bacteria 5909
60 Ga0466709_095978 3300042648 Bacteria 34809
61 Ga0466727_176346 3300042655 Bacteria 17609
62 Ga0466727_334302 3300042655 Bacteria 12824
63 Ga0466711_060092 3300042615 Unclassified 5120
64 Ga0466723_036383 3300042618 Bacteria 10790
65 Ga0466723_164166 3300042618 Bacteria 2791
66 Ga0466729_154471 3300042621 Bacteria 26996
67 2227638495 2225789004 Bacteria 11160
68 JGI24702J35022_10001587 3300002462 Bacteria 14068
69 JGI24702J35022_10040885 3300002462 Bacteria 2473
70 JGI24705J35276_12158470 3300002504 Bacteria 1219
71 JGI24699J35502_11133642 3300002509 Bacteria 12864
72 Ga0104048_1022679 3300007143 Bacteria 4310
73 Ga0466692_097478 3300042591 Bacteria 3033
74 Ga0466692_176056 3300042591 Bacteria 1916
75 Ga0466692_201555 3300042591 Unclassified 1539
76 Ga0466693_178234 3300042592 Bacteria 2002
77 Ga0466691_015459 3300042593 Bacteria 5696
78 Ga0466696_392853 3300042596 Bacteria 1622
79 Ga0123357_10025383 3300009784 Bacteria 7994
80 Ga0123357_10268687 3300009784 Bacteria 1787
81 Ga0123356_10423054 3300010049 Bacteria 1475
82 Ga0123354_10202706 3300010882 Unclassified 2174
83 Ga0466701_029840 3300042598 Bacteria 102818
84 Ga0466700_058225 3300042600 Bacteria 3305
85 Ga0466700_199670 3300042600 Bacteria 4193
86 Ga0466707_038429 3300042601 Bacteria 31367
87 Ga0466713_067679 3300042602 Bacteria 29895
88 Ga0466719_439434 3300042606 Bacteria 7674
89 Ga0466729_274368 3300042621 Unclassified 7544
90 Ga0466735_004173 3300042624 Bacteria 12455
91 Ga0466735_074801 3300042624 Bacteria 2334
92 Ga0466703_017186 3300042636 Bacteria 5189
93 Ga0466704_121098 3300042643 Bacteria 24308
94 Ga0466704_422608 3300042643 Bacteria 8471
95 Ga0466704_487466 3300042643 Bacteria 6161
96 Ga0466715_510538 3300042616 Bacteria 2232
97 Ga0466726_017819 3300042619 Bacteria 7967
98 Ga0466726_175041 3300042619 Bacteria 1887
99 JGI24699J35502_11134029 3300002509 Bacteria 25256
100 Ga0074308_1117999 3300005307 Unclassified 945
101 Ga0103265_1000034 3300007068 Bacteria 23271
102 Ga0466690_184736 3300042590 Bacteria 19485
103 Ga0466690_330752 3300042590 Bacteria 9285
104 Ga0466693_398054 3300042592 Bacteria 2670
105 Ga0466694_164679 3300042594 Bacteria 1063
106 Ga0466696_184153 3300042596 Bacteria 23807
107 Ga0466696_501557 3300042596 Unclassified 2898
108 Ga0123357_10025165 3300009784 Bacteria 8025
109 Ga0466701_036771 3300042598 Bacteria 249987
110 Ga0466707_369886 3300042601 Bacteria 5495
111 Ga0466713_129978 3300042602 Bacteria 70140
112 Ga0466716_152229 3300042605 Bacteria 6135
113 Ga0466716_171810 3300042605 Bacteria 8024
114 Ga0466719_211719 3300042606 Bacteria 1200
115 Ga0466722_256018 3300042609 Bacteria 3948
116 Ga0466697_056567 3300042611 Bacteria 485126
117 Ga0466734_169367 3300042623 Bacteria 2792
118 Ga0466734_170437 3300042623 Bacteria 2505
119 Ga0466735_091878 3300042624 Bacteria 1107
120 Ga0466735_139523 3300042624 Bacteria 1029
121 Ga0466703_029176 3300042636 Bacteria 3874
122 Ga0466708_141133 3300042652 Bacteria 11097
123 Ga0466710_327504 3300042613 Bacteria 1163
124 Ga0466715_051890 3300042616 Bacteria 8307
125 Ga0466715_145856 3300042616 Bacteria 12490
126 2227565210 2225789004 Bacteria 2676
127 2227567425 2225789004 Bacteria 2653
128 JGI24702J35022_10008903 3300002462 Bacteria 5660
129 JGI24699J35502_11132882 3300002509 Bacteria 7863
130 Ga0104050_1004133 3300007153 Unclassified 7415
131 Ga0466657_028641 3300042582 Bacteria 2100
132 Ga0466690_159683 3300042590 Bacteria 4437
133 Ga0466692_182601 3300042591 Bacteria 5348
134 Ga0466696_336173 3300042596 Bacteria 7232
135 Ga0123357_10389355 3300009784 Bacteria 1283
136 Ga0123356_10167849 3300010049 Bacteria 2201
137 Ga0123356_10261691 3300010049 Unclassified 1814
138 Ga0123356_11966749 3300010049 Bacteria 729
139 Ga0123353_10444555 3300010167 Bacteria 1911
140 Ga0123354_10062928 3300010882 Bacteria 5457
141 Ga0123354_10145273 3300010882 Bacteria 2907
142 Ga0466700_094231 3300042600 Bacteria 6040
143 Ga0466707_139371 3300042601 Bacteria 11636
144 Ga0466713_134751 3300042602 Bacteria 25892
145 Ga0466722_145294 3300042609 Bacteria 16440
146 Ga0466705_381693 3300042612 Bacteria 6883
147 Ga0466733_137759 3300042659 Bacteria 1717
148 Ga0466735_092940 3300042624 Bacteria 11195
149 Ga0466735_123543 3300042624 Bacteria 5219
150 Ga0466703_403993 3300042636 Bacteria 7111
151 Ga0466704_159234 3300042643 Bacteria 2370
152 Ga0466704_512887 3300042643 Bacteria 32913
153 Ga0466708_121931 3300042652 Bacteria 6038
154 Ga0466727_126733 3300042655 Bacteria 3918
155 Ga0466710_396433 3300042613 Bacteria 9234
156 Ga0466711_035612 3300042615 Bacteria 1750
157 Ga0466711_069341 3300042615 Bacteria 69315
158 Ga0466711_106532 3300042615 Bacteria 6085
159 Ga0466729_106410 3300042621 Bacteria 6208
160 2227239128 2225789004 Bacteria 7254
161 2227577118 2225789004 Bacteria 2550
162 IMNBL1DRAFT_c0021035 3300000062 Bacteria 2622
163 JGI24702J35022_10005248 3300002462 Bacteria 7596
164 JGI24702J35022_10024217 3300002462 Bacteria 3280
165 Ga0123357_10000658 3300009784 Bacteria 34456
166 Ga0466690_242016 3300042590 Bacteria 6738
167 Ga0466696_034053 3300042596 Bacteria 2941
168 Ga0466696_316510 3300042596 Bacteria 1868
169 Ga0466696_401770 3300042596 Bacteria 6239
170 Ga0123356_11622544 3300010049 Bacteria 801
171 Ga0123354_10144380 3300010882 Bacteria 2923
172 Ga0123354_10165935 3300010882 Bacteria 2596
173 Ga0466701_035122 3300042598 Bacteria 8308
174 Ga0466700_044713 3300042600 Bacteria 11766
175 Ga0466707_135985 3300042601 Bacteria 9923
176 Ga0466707_219271 3300042601 Bacteria 3698
177 Ga0466707_281895 3300042601 Bacteria 3877
178 Ga0466713_080837 3300042602 Bacteria 14389
179 Ga0466716_379137 3300042605 Bacteria 10862
180 Ga0466719_239832 3300042606 Bacteria 5925
181 Ga0466698_026479 3300042610 Bacteria 2043
182 Ga0466735_181240 3300042624 Bacteria 5198
183 Ga0466735_206468 3300042624 Bacteria 2327
184 Ga0466703_069360 3300042636 Bacteria 5378
185 Ga0466726_203345 3300042619 Bacteria 4851
186 Ga0466726_416036 3300042619 Bacteria 2006
187 2227601574 2225789004 Bacteria 2333
188 IMNBL1DRAFT_c0000734 3300000062 Bacteria 25991
189 Ga0068305_10230162 3300005083 Bacteria 6898
190 Ga0466693_383077 3300042592 Unclassified 1053
191 Ga0466691_150273 3300042593 Bacteria 1891
192 Ga0123357_10109595 3300009784 Bacteria 3527
193 Ga0466700_285303 3300042600 Unclassified 6790
194 Ga0466700_287722 3300042600 Bacteria 5900
195 Ga0466713_041413 3300042602 Bacteria 7528
196 Ga0466716_360782 3300042605 Bacteria 9012
197 Ga0466735_197225 3300042624 Bacteria 5022
198 Ga0466735_210297 3300042624 Bacteria 4874
199 Ga0466703_115731 3300042636 Bacteria 18685
200 Ga0466704_017264 3300042643 Bacteria 18794
201 Ga0466709_415777 3300042648 Bacteria 5248
202 Ga0466727_052853 3300042655 Bacteria 1200
203 Ga0466727_205369 3300042655 Bacteria 6688
204 Ga0466705_477897 3300042612 Bacteria 1022
205 JGI24699J35502_11133259 3300002509 Bacteria 9499
206 Ga0068305_10355616 3300005083 Unclassified 3656
207 Ga0466696_249291 3300042596 Bacteria 1830
208 Ga0466696_394657 3300042596 Bacteria 6367
209 Ga0123357_10004228 3300009784 Bacteria 16758
210 Ga0123357_10005111 3300009784 Bacteria 15639
211 Ga0123356_10754060 3300010049 Unclassified 1143
212 Ga0466706_221023 3300042599 Bacteria 3876
213 Ga0466707_111222 3300042601 Bacteria 14094

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300007085 Ga0104045_1008007 Ga0104045_10080073 169
2 3300007153 Ga0104050_1004133 Ga0104050_10041336 169
3 iso_pr_bacteria 2811995047 2812946678 170
4 3300042609 Ga0466722_265423 Ga0466722_265423_886_1422 178
5 3300042596 Ga0466696_501557 Ga0466696_501557_255_794 179
6 3300042615 Ga0466711_106532 Ga0466711_106532_1549_2097 182
7 3300042593 Ga0466691_037646 Ga0466691_037646_759_1313 184
8 3300042598 Ga0466701_036771 Ga0466701_036771_208038_208592 184
9 3300042620 Ga0466728_030716 Ga0466728_030716_2049_2603 184
10 3300042624 Ga0466735_056025 Ga0466735_056025_908_1462 184
11 3300042648 Ga0466709_095978 Ga0466709_095978_526_1080 184
12 3300042659 Ga0466733_174530 Ga0466733_174530_14156_14710 184
13 iso_pr_bacteria 2864878056 2864878916 184
14 iso_pr_bacteria 2864886855 2864887396 184
15 2225789004 2227239128 2227677856 185
16 3300005307 Ga0074308_1117999 Ga0074308_11179991 185
17 3300007143 Ga0104048_1168761 Ga0104048_11687613 185
18 3300042591 Ga0466692_182601 Ga0466692_182601_4459_5016 185
19 3300042591 Ga0466692_201555 Ga0466692_201555_830_1387 185
20 3300042594 Ga0466694_351087 Ga0466694_351087_2046_2603 185
21 3300042596 Ga0466696_316510 Ga0466696_316510_242_799 185
22 3300042598 Ga0466701_029840 Ga0466701_029840_58849_59406 185
23 3300042600 Ga0466700_044713 Ga0466700_044713_8183_8740 185
24 3300042600 Ga0466700_229482 Ga0466700_229482_81_638 185
25 3300042600 Ga0466700_285303 Ga0466700_285303_588_1145 185
26 3300042600 Ga0466700_287722 Ga0466700_287722_3447_4004 185
27 3300042601 Ga0466707_111222 Ga0466707_111222_4217_4774 185
28 3300042601 Ga0466707_135985 Ga0466707_135985_1753_2310 185
29 3300042602 Ga0466713_148662 Ga0466713_148662_11145_11702 185
30 3300042605 Ga0466716_152229 Ga0466716_152229_4273_4830 185
31 3300042609 Ga0466722_256018 Ga0466722_256018_1931_2488 185
32 3300042610 Ga0466698_026479 Ga0466698_026479_360_917 185
33 3300042612 Ga0466705_381693 Ga0466705_381693_4124_4681 185
34 3300042621 Ga0466729_106410 Ga0466729_106410_2365_2922 185
35 3300042621 Ga0466729_154471 Ga0466729_154471_17906_18463 185
36 3300042624 Ga0466735_092940 Ga0466735_092940_537_1094 185
37 3300042624 Ga0466735_123543 Ga0466735_123543_1619_2176 185
38 3300042624 Ga0466735_210297 Ga0466735_210297_2500_3057 185
39 3300042636 Ga0466703_017186 Ga0466703_017186_2429_2986 185
40 3300042636 Ga0466703_029176 Ga0466703_029176_2647_3204 185
41 3300042636 Ga0466703_127125 Ga0466703_127125_24681_25238 185
42 3300042648 Ga0466709_415777 Ga0466709_415777_4191_4748 185
43 3300042655 Ga0466727_024869 Ga0466727_024869_724_1281 185
44 3300042655 Ga0466727_052853 Ga0466727_052853_102_659 185
45 3300042659 Ga0466733_137759 Ga0466733_137759_803_1360 185
46 iso_pr_bacteria 2838772460 2838774623 185
47 iso_pr_bacteria 2904728850 2904731407 185
48 iso_pr_bacteria 2958471994 2958474399 185
49 2225789004 2227565210 2228106218 186
50 2225789004 2227567425 2228110001 186
51 2225789004 2227577118 2228126236 186
52 2225789004 2227601574 2228167636 186
53 2225789004 2227638495 2228226640 186
54 3300000062 IMNBL1DRAFT_c0021035 IMNBL1DRAFT_00210352 186
55 3300002462 JGI24702J35022_10040885 JGI24702J35022_100408853 186
56 3300009784 Ga0123357_10000658 Ga0123357_1000065831 186
57 3300009784 Ga0123357_10108205 Ga0123357_101082053 186
58 3300009784 Ga0123357_10154833 Ga0123357_101548333 186
59 3300010167 Ga0123353_10483559 Ga0123353_104835592 186
60 3300042590 Ga0466690_161857 Ga0466690_161857_11795_12355 186
61 3300042590 Ga0466690_184736 Ga0466690_184736_12941_13501 186
62 3300042590 Ga0466690_242016 Ga0466690_242016_2926_3486 186
63 3300042592 Ga0466693_203628 Ga0466693_203628_1698_2258 186
64 3300042593 Ga0466691_150273 Ga0466691_150273_204_764 186
65 3300042594 Ga0466694_164679 Ga0466694_164679_23_583 186
66 3300042596 Ga0466696_241827 Ga0466696_241827_6012_6572 186
67 3300042596 Ga0466696_249291 Ga0466696_249291_189_749 186
68 3300042596 Ga0466696_352436 Ga0466696_352436_302_862 186
69 3300042596 Ga0466696_394657 Ga0466696_394657_5676_6236 186
70 3300042596 Ga0466696_401770 Ga0466696_401770_672_1232 186
71 3300042601 Ga0466707_038429 Ga0466707_038429_5116_5676 186
72 3300042601 Ga0466707_281895 Ga0466707_281895_2850_3410 186
73 3300042601 Ga0466707_369886 Ga0466707_369886_3122_3682 186
74 3300042602 Ga0466713_134751 Ga0466713_134751_9994_10554 186
75 3300042605 Ga0466716_171810 Ga0466716_171810_884_1444 186
76 3300042606 Ga0466719_125031 Ga0466719_125031_257_817 186
77 3300042606 Ga0466719_239832 Ga0466719_239832_44_604 186
78 3300042606 Ga0466719_258503 Ga0466719_258503_1256_1816 186
79 3300042606 Ga0466719_361408 Ga0466719_361408_987_1547 186
80 3300042606 Ga0466719_379318 Ga0466719_379318_2359_2919 186
81 3300042609 Ga0466722_104373 Ga0466722_104373_4230_4790 186
82 3300042612 Ga0466705_084401 Ga0466705_084401_16127_16687 186
83 3300042612 Ga0466705_157007 Ga0466705_157007_5498_6058 186
84 3300042612 Ga0466705_477897 Ga0466705_477897_247_807 186
85 3300042615 Ga0466711_069341 Ga0466711_069341_60876_61436 186
86 3300042616 Ga0466715_051890 Ga0466715_051890_3159_3719 186
87 3300042616 Ga0466715_145856 Ga0466715_145856_11137_11697 186
88 3300042617 Ga0466718_050736 Ga0466718_050736_569_1129 186
89 3300042617 Ga0466718_121661 Ga0466718_121661_673_1233 186
90 3300042618 Ga0466723_164166 Ga0466723_164166_1584_2144 186
91 3300042619 Ga0466726_017819 Ga0466726_017819_603_1163 186
92 3300042619 Ga0466726_416036 Ga0466726_416036_441_1001 186
93 3300042621 Ga0466729_274368 Ga0466729_274368_4735_5295 186
94 3300042624 Ga0466735_004173 Ga0466735_004173_4788_5348 186
95 3300042624 Ga0466735_018171 Ga0466735_018171_932_1492 186
96 3300042624 Ga0466735_091878 Ga0466735_091878_257_817 186
97 3300042624 Ga0466735_197225 Ga0466735_197225_2225_2785 186
98 3300042636 Ga0466703_069360 Ga0466703_069360_4630_5190 186
99 3300042636 Ga0466703_115731 Ga0466703_115731_14204_14764 186
100 3300042643 Ga0466704_017264 Ga0466704_017264_2581_3141 186
101 3300042643 Ga0466704_121098 Ga0466704_121098_16955_17515 186
102 3300042643 Ga0466704_159234 Ga0466704_159234_25_585 186
103 3300042643 Ga0466704_487466 Ga0466704_487466_1003_1563 186
104 3300042648 Ga0466709_389939 Ga0466709_389939_2551_3111 186
105 3300042652 Ga0466708_121931 Ga0466708_121931_5312_5872 186
106 3300042652 Ga0466708_141133 Ga0466708_141133_4994_5554 186
107 3300042652 Ga0466708_176791 Ga0466708_176791_22012_22572 186
108 3300042655 Ga0466727_126733 Ga0466727_126733_2538_3098 186
109 3300042655 Ga0466727_176346 Ga0466727_176346_10760_11320 186
110 3300042655 Ga0466727_322923 Ga0466727_322923_3995_4555 186
111 3300042655 Ga0466727_334302 Ga0466727_334302_11546_12106 186
112 3300042655 Ga0466727_351836 Ga0466727_351836_1313_1873 186
113 iso_pr_bacteria 2820778767 2820780344 186
114 iso_pr_bacteria 2940195863 2940198565 186
115 3300000062 IMNBL1DRAFT_c0000734 IMNBL1DRAFT_000073428 187
116 3300000062 IMNBL1DRAFT_c0001037 IMNBL1DRAFT_000103711 187
117 3300002462 JGI24702J35022_10001587 JGI24702J35022_100015878 187
118 3300002504 JGI24705J35276_12158470 JGI24705J35276_121584702 187
119 3300005083 Ga0068305_10073993 Ga0068305_100739936 187
120 3300005083 Ga0068305_10134251 Ga0068305_101342512 187
121 3300005083 Ga0068305_10230162 Ga0068305_102301626 187
122 3300009784 Ga0123357_10004228 Ga0123357_1000422811 187
123 3300010049 Ga0123356_11622544 Ga0123356_116225441 187
124 3300042550 Ga0466656_309631 Ga0466656_309631_45_608 187
125 3300042591 Ga0466692_119633 Ga0466692_119633_21547_22110 187
126 3300042591 Ga0466692_176056 Ga0466692_176056_231_794 187
127 3300042596 Ga0466696_034053 Ga0466696_034053_247_810 187
128 3300042596 Ga0466696_184153 Ga0466696_184153_839_1402 187
129 3300042596 Ga0466696_192414 Ga0466696_192414_900_1463 187
130 3300042596 Ga0466696_392853 Ga0466696_392853_652_1215 187
131 3300042596 Ga0466696_451467 Ga0466696_451467_518_1081 187
132 3300042598 Ga0466701_064663 Ga0466701_064663_2220_2783 187
133 3300042600 Ga0466700_058225 Ga0466700_058225_258_821 187
134 3300042601 Ga0466707_139371 Ga0466707_139371_4328_4891 187
135 3300042602 Ga0466713_067679 Ga0466713_067679_19510_20073 187
136 3300042602 Ga0466713_080837 Ga0466713_080837_9843_10406 187
137 3300042606 Ga0466719_439434 Ga0466719_439434_5785_6348 187
138 3300042609 Ga0466722_145294 Ga0466722_145294_13424_13987 187
139 3300042611 Ga0466697_056567 Ga0466697_056567_58199_58762 187
140 3300042613 Ga0466710_040696 Ga0466710_040696_7147_7710 187
141 3300042613 Ga0466710_396433 Ga0466710_396433_8347_8910 187
142 3300042616 Ga0466715_051157 Ga0466715_051157_38291_38854 187
143 3300042624 Ga0466735_018793 Ga0466735_018793_1757_2320 187
144 3300042624 Ga0466735_074801 Ga0466735_074801_23_586 187
145 3300042624 Ga0466735_206468 Ga0466735_206468_896_1459 187
146 iso_pr_bacteria 2910930387 2910931391 187
147 iso_pr_bacteria 2910949487 2910952375 187
148 iso_pr_bacteria 2910959314 2910961131 187
149 iso_pr_bacteria 2967483437 2967484174 187
150 3300005083 Ga0068305_10355616 Ga0068305_103556165 188
151 3300007068 Ga0103265_1000034 Ga0103265_10000347 188
152 3300010882 Ga0123354_10165935 Ga0123354_101659352 188
153 3300042592 Ga0466693_178234 Ga0466693_178234_1055_1621 188
154 3300042592 Ga0466693_383077 Ga0466693_383077_380_946 188
155 3300042592 Ga0466693_398054 Ga0466693_398054_2047_2613 188
156 3300042598 Ga0466701_035122 Ga0466701_035122_7673_8239 188
157 3300042599 Ga0466706_221023 Ga0466706_221023_2522_3088 188
158 3300042600 Ga0466700_199670 Ga0466700_199670_3070_3636 188
159 3300042605 Ga0466716_295477 Ga0466716_295477_2321_2887 188
160 3300042619 Ga0466726_175041 Ga0466726_175041_1235_1801 188
161 3300042623 Ga0466734_169367 Ga0466734_169367_873_1439 188
162 iso_pr_bacteria 2820759988 2820760505 188
163 iso_pr_bacteria 2820762746 2820762904 188
164 3300002462 JGI24702J35022_10024217 JGI24702J35022_100242171 189
165 3300002509 JGI24699J35502_11132882 JGI24699J35502_111328822 189
166 3300002509 JGI24699J35502_11133259 JGI24699J35502_111332595 189
167 3300002509 JGI24699J35502_11133642 JGI24699J35502_111336425 189
168 3300002509 JGI24699J35502_11134029 JGI24699J35502_111340299 189
169 3300009784 Ga0123357_10000516 Ga0123357_100005169 189
170 3300009784 Ga0123357_10005111 Ga0123357_1000511110 189
171 3300009784 Ga0123357_10025165 Ga0123357_100251655 189
172 3300009784 Ga0123357_10025383 Ga0123357_100253833 189
173 3300009784 Ga0123357_10042199 Ga0123357_100421993 189
174 3300009784 Ga0123357_10389355 Ga0123357_103893551 189
175 3300010049 Ga0123356_10167849 Ga0123356_101678492 189
176 3300010049 Ga0123356_10261691 Ga0123356_102616912 189
177 3300010049 Ga0123356_10754060 Ga0123356_107540601 189
178 3300010049 Ga0123356_11966749 Ga0123356_119667491 189
179 3300010167 Ga0123353_10444555 Ga0123353_104445552 189
180 3300010882 Ga0123354_10030612 Ga0123354_100306127 189
181 3300010882 Ga0123354_10062928 Ga0123354_100629282 189
182 3300010882 Ga0123354_10202706 Ga0123354_102027062 189
183 3300042593 Ga0466691_015459 Ga0466691_015459_154_723 189
184 3300042602 Ga0466713_041413 Ga0466713_041413_3687_4256 189
185 3300042611 Ga0466697_172265 Ga0466697_172265_2353_2922 189
186 3300042616 Ga0466715_510538 Ga0466715_510538_152_721 189
187 3300002462 JGI24702J35022_10005248 JGI24702J35022_100052482 190
188 3300009784 Ga0123357_10268687 Ga0123357_102686872 190
189 3300042624 Ga0466735_139523 Ga0466735_139523_248_820 190
190 3300042624 Ga0466735_181240 Ga0466735_181240_663_1235 190
191 3300042590 Ga0466690_159683 Ga0466690_159683_3718_4293 191
192 3300042596 Ga0466696_336173 Ga0466696_336173_408_983 191
193 3300042596 Ga0466696_379785 Ga0466696_379785_2925_3500 191
194 3300042600 Ga0466700_094231 Ga0466700_094231_2871_3446 191
195 3300042601 Ga0466707_194915 Ga0466707_194915_4585_5160 191
196 3300042601 Ga0466707_219271 Ga0466707_219271_2233_2808 191
197 3300042601 Ga0466707_353315 Ga0466707_353315_1306_1881 191
198 3300042602 Ga0466713_129978 Ga0466713_129978_20351_20926 191
199 3300042615 Ga0466711_053448 Ga0466711_053448_3988_4563 191
200 3300042615 Ga0466711_060092 Ga0466711_060092_413_988 191
201 3300042618 Ga0466723_036383 Ga0466723_036383_2530_3105 191
202 3300042620 Ga0466728_262745 Ga0466728_262745_9455_10030 191
203 3300002462 JGI24702J35022_10008903 JGI24702J35022_100089035 192
204 3300010882 Ga0123354_10144380 Ga0123354_101443803 192
205 3300007143 Ga0104048_1022679 Ga0104048_10226791 193
206 3300042582 Ga0466657_028641 Ga0466657_028641_270_851 193
207 3300042605 Ga0466716_360782 Ga0466716_360782_6400_6981 193
208 3300042605 Ga0466716_379137 Ga0466716_379137_7876_8457 193
209 3300042615 Ga0466711_035612 Ga0466711_035612_788_1369 193
210 3300010049 Ga0123356_10423054 Ga0123356_104230542 194
211 3300042616 Ga0466715_332974 Ga0466715_332974_1602_2186 194
212 3300042655 Ga0466727_205369 Ga0466727_205369_160_744 194
213 3300042593 Ga0466691_023015 Ga0466691_023015_8917_9504 195
214 3300042619 Ga0466726_203345 Ga0466726_203345_4002_4592 196
215 3300042643 Ga0466704_422608 Ga0466704_422608_5343_5933 196
216 3300009784 Ga0123357_10109595 Ga0123357_101095953 197
217 3300042623 Ga0466734_170437 Ga0466734_170437_51_647 198
218 3300042606 Ga0466719_211719 Ga0466719_211719_511_1113 200
219 3300042636 Ga0466703_403993 Ga0466703_403993_6363_6965 200
220 iso_pr_bacteria 2820757377 2820758395 200
221 3300042606 Ga0466719_117183 Ga0466719_117183_7759_8376 205
222 3300042643 Ga0466704_409426 Ga0466704_409426_2937_3560 207
223 3300042590 Ga0466690_330752 Ga0466690_330752_509_1135 208
224 3300042591 Ga0466692_097478 Ga0466692_097478_696_1322 208
225 3300042643 Ga0466704_512887 Ga0466704_512887_20491_21132 213
226 3300010882 Ga0123354_10145273 Ga0123354_101452732 216
227 3300042652 Ga0466708_016786 Ga0466708_016786_6301_6954 217
228 3300042613 Ga0466710_327504 Ga0466710_327504_175_978 267

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02075 RuvC Crossover junction endodeoxyribonuclease RuvC 15 163 0.98

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.8 0.86 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.