Protein Family IF01717
Metagenome
Isolate
454
Members
394
Samples
69
Scaffolds
377.36
Avg Length
Representative Sequence
- ID
- 3300007130|Ga0104042_1119507|Ga0104042_11195073
- Length
- 385 aa
- Sequence
- MFGENLFDYESLRFIWWVLIGVLCIGFAVTDGFDMGVGILARIIGKTDTDRRIMINAIAPHWDGNQVWLITAAGAIFAAWPTVYAAAFSGFYGAMILVLCALFFRPIGFDYRSKLESSRWRGMWDWGIFIGSFVPALVFGVAFGNLLLGVPFHFDDYLRLYYTGSLWQLLNPFGLLAGIVSLTMLITQGATYLQMRTTGELRLRTRTASQVSALVMMICFLVAGIWLVKGIDGYVLTSVLDPHAESNPLRKTVAHQAGAWLLNFNKAPVLWALPALGVVLPLLTILFSRLNRGALAFVSSSLTIACVILTAGITMFPFVMPSSTTPDVSLTMWDATSSLLTLRVMAVVACIFVPIVLLYTGWSYYKMFGRLDKNYIEDNKHSLY*
Sample Types
Isolate
84.8%
Metagenome
15.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Apidae
30.5%
Unclassified
27.1%
Drosophilidae
6.3%
Anthocoridae
5.5%
Muscidae
3.4%
Tenebrionidae
2.9%
Curculionidae
2.6%
Calliphoridae
2.4%
Chrysomelidae
1.8%
Culicidae
1.8%
Elmidae
1.6%
Aphididae
1.1%
Cerambycidae
1.1%
Palinuridae
0.8%
Pteromalidae
0.8%
Tephritidae
0.8%
Talitridae
0.8%
Termitidae
0.8%
Formicidae
0.5%
Pentatomidae
0.5%
Sarcophagidae
0.5%
Largidae
0.5%
Majidae
0.5%
Passalidae
0.5%
Scarabaeidae
0.3%
Ceratophyllidae
0.3%
Nephropidae
0.3%
Armadillidiidae
0.3%
Reduviidae
0.3%
Rhopalidae
0.3%
Penaeidae
0.3%
Glossinidae
0.3%
Carabidae
0.3%
Crambidae
0.3%
Hodotermitidae
0.3%
Psyllidae
0.3%
Daphniidae
0.3%
Thripidae
0.3%
Anthomyiidae
0.3%
Artemiidae
0.3%
Aleyrodidae
0.3%
Pseudococcidae
0.3%
Taxonomy
Archaea
0
Bacteria
440
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2971189173 | Yersinia pestis A-1249 | Isolate | Unclassified |
| 2 | 2998832060 | Enterobacteriaceae endosymbiont of Donacia proxima DproxSym | Isolate | Chrysomelidae |
| 3 | 3300000462 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Frischia SCG AB-598-I22 | Metagenome | Apidae |
| 4 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 5 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 6 | 3300009457 | Microbial communities of aphids from Cornus stolonifera in Ithaca, NY, USA - Anoecia oenotherae NM10041110_01 seqcov | Metagenome | |
| 7 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 8 | 2505679062 | Candidatus Schmidhempelia bombi Bimp | Isolate | Apidae |
| 9 | 2513020017 | Shimwellia blattae DSM 4481 | Isolate | Unclassified |
| 10 | 2571042554 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 11 | 2597489902 | Providencia rettgeri Dmel1 | Isolate | Drosophilidae |
| 12 | 2684622922 | Gilliamella apicola Ga_169 | Isolate | Unclassified |
| 13 | 2756170266 | Frischella perrara DSM 104328 | Isolate | Unclassified |
| 14 | 2785510746 | Gilliamella sp. ESL0441 | Isolate | Apidae |
| 15 | 2785510747 | Gilliamella sp. ESL0443 | Isolate | Apidae |
| 16 | 2836714267 | Shimwellia blattae NCTC10965 | Isolate | |
| 17 | 2836755666 | Arsenophonus nasoniae FIN | Isolate | Pteromalidae |
| 18 | 2837615801 | Gilliamella apicola ESL0177 | Isolate | Apidae |
| 19 | 2846386538 | Rahnella sp. AN3-3W3 | Isolate | Pentatomidae |
| 20 | 2846485327 | Gilliamella apicola AM4 | Isolate | Apidae |
| 21 | 2849471304 | Gilliamella apicola NO5 | Isolate | Apidae |
| 22 | 2864751016 | Pseudomonas oryzihabitans S00005 | Isolate | Elmidae |
| 23 | 2868883784 | Photobacterium leiognathi mandapamensis AJ-1a | Isolate | Unclassified |
| 24 | 2873643457 | Gilliamella apis A-4-12 | Isolate | Apidae |
| 25 | 2876011797 | Gilliamella apis NO16 | Isolate | Apidae |
| 26 | 2876022486 | Gilliamella apicola A8 | Isolate | Apidae |
| 27 | 2876027665 | Gilliamella apicola P54G | Isolate | Apidae |
| 28 | 2876358570 | Cronobacter sakazakii MOD1-Ls15g | Isolate | Calliphoridae |
| 29 | 2937387794 | Cronobacter turicensis MOD1-Sh41g | Isolate | Sarcophagidae |
| 30 | 2938192669 | Citrobacter sp. TSA-1 | Isolate | Unclassified |
| 31 | 8021546568 | Klebsiella sp. Kps | Isolate | Tephritidae |
| 32 | 8033368880 | Vibrio panuliri CAIM 1902 | Isolate | Palinuridae |
| 33 | 8065462725 | Tatumella sp. JGM100 | Isolate | Drosophilidae |
| 34 | 8065466226 | Tatumella sp. JGM130 | Isolate | Drosophilidae |
| 35 | 8065469765 | Tatumella sp. JGM16 | Isolate | Drosophilidae |
| 36 | 8071322446 | Escherichia coli PN122 | Isolate | Calliphoridae |
| 37 | 8088491222 | Gilliamella apicola ESL0178 | Isolate | Apidae |
| 38 | 8100171289 | Kosakonia sp. S42 | Isolate | Curculionidae |
| 39 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 40 | 8103002986 | Erwinia sp. S38 | Isolate | Curculionidae |
| 41 | 8103008710 | Erwinia sp. S43 | Isolate | Curculionidae |
| 42 | 2967915117 | Cronobacter sakazakii MOD1-Lc10g | Isolate | Calliphoridae |
| 43 | 2979682021 | Cronobacter turicensis MOD1-Sh41s | Isolate | Sarcophagidae |
| 44 | 2997380424 | Vibrio parahaemolyticus MVP1 | Isolate | Unclassified |
| 45 | 2998829267 | Enterobacteriaceae endosymbiont of Macroplea mutica MmutSym | Isolate | Chrysomelidae |
| 46 | 3003178663 | Psychrobacter fulvigenes KC-40 | Isolate | Unclassified |
| 47 | 3003869270 | Paraburkholderia sp. PGU16 | Isolate | Largidae |
| 48 | 3004010258 | Citrobacter sp. JGM124 | Isolate | Drosophilidae |
| 49 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 50 | 3300007149 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut | Metagenome | Drosophilidae |
| 51 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 52 | 2511231129 | Vibrio sp. EJY3 | Isolate | Unclassified |
| 53 | 2524614872 | Arsenophonus nasoniae DSM 15247 | Isolate | Unclassified |
| 54 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 55 | 2565956518 | Vibrio pacinii DSM 19139 | Isolate | Unclassified |
| 56 | 2600255074 | Vibrio proteolyticus NBRC 13287 | Isolate | Unclassified |
| 57 | 2645727860 | Winslowiella iniecta B120 | Isolate | Aphididae |
| 58 | 2651870110 | Izhakiella capsodis N6PO6 | Isolate | Unclassified |
| 59 | 2693429575 | Vibrio parahaemolyticus ISF-54-12 | Isolate | Unclassified |
| 60 | 2703719240 | Serratia marcescens ano2 | Isolate | Unclassified |
| 61 | 2756170265 | Gilliamella apicola DSM 104097 | Isolate | Unclassified |
| 62 | 2834098943 | Gilliamella apis NO3 | Isolate | Apidae |
| 63 | 2843337836 | Gilliamella apicola N-12-12 | Isolate | Apidae |
| 64 | 2846480698 | Gilliamella apis N-G4 | Isolate | Apidae |
| 65 | 2846488152 | Gilliamella apicola Bim3-2 | Isolate | Apidae |
| 66 | 2849449383 | Gilliamella apicola WF3-4 | Isolate | Apidae |
| 67 | 2849458003 | Gilliamella apicola HK7 | Isolate | Apidae |
| 68 | 2849463436 | Gilliamella apicola A-8-12 | Isolate | Apidae |
| 69 | 2857876020 | Gilliamella apicola Nev6-6 | Isolate | Apidae |
| 70 | 2857881114 | Gilliamella apis N-G3 | Isolate | Apidae |
| 71 | 2868494745 | Gilliamella apis NO1 | Isolate | Apidae |
| 72 | 2870902796 | Gilliamella apicola GillExp13 | Isolate | Apidae |
| 73 | 2870915472 | Gilliamella apis A-TSA3 | Isolate | Apidae |
| 74 | 2871771314 | Pantoea sp. Ae16 | Isolate | Culicidae |
| 75 | 2873656248 | Gilliamella apicola A-1-24 | Isolate | Apidae |
| 76 | 2876016455 | Gilliamella apicola N6 | Isolate | Apidae |
| 77 | 2885046828 | Erwinia sp. OLCASP19 | Isolate | Anthocoridae |
| 78 | 2885054481 | Erwinia sp. OLMDSP33 | Isolate | Anthocoridae |
| 79 | 2902451016 | Photobacterium leiognathi mandapamensis ajapo.4.1 | Isolate | Unclassified |
| 80 | 2902896024 | Pseudoalteromonas sp. S1612 | Isolate | Unclassified |
| 81 | 2908136803 | Vibrio owensii 1700302 | Isolate | Unclassified |
| 82 | 2921842437 | Cronobacter sakazakii MOD1-Lc10s | Isolate | Calliphoridae |
| 83 | 2957730672 | Cronobacter sakazakii MOD1-Md70g | Isolate | Muscidae |
| 84 | 640963010 | Vibrio harveyi HY01 | Isolate | Unclassified |
| 85 | 648276708 | Pantoea sp. aB | Isolate | Unclassified |
| 86 | 8001394582 | Limnobaculum allomyrinae BWR-B9 | Isolate | Scarabaeidae |
| 87 | 8006199443 | Yersinia pestis M-1763 | Isolate | Ceratophyllidae |
| 88 | 8022345672 | Vibrio sp. 070316B | Isolate | Unclassified |
| 89 | 8033364368 | Vibrio panuliri LBS 2 | Isolate | Nephropidae |
| 90 | 8073124432 | Escherichia coli MOD1-EC294 | Isolate | Unclassified |
| 91 | 8074292191 | Tatumella sp. JGM94 | Isolate | Drosophilidae |
| 92 | 8088486376 | Gilliamella apis ESL0172 | Isolate | Apidae |
| 93 | 8101676404 | Providencia sp. JGM172 | Isolate | Drosophilidae |
| 94 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 95 | 2967924226 | Cronobacter malonaticus MOD1-Md25g | Isolate | Muscidae |
| 96 | 2970322301 | Cronobacter sakazakii MOD1-Md33g | Isolate | Muscidae |
| 97 | 2989793055 | Vibrio atypicus DSM 25292 | Isolate | Unclassified |
| 98 | 2996406003 | Serratia sp. OLJL1 | Isolate | Anthocoridae |
| 99 | 2999134321 | Enterobacteriaceae endosymbiont of Donacia piscatrix DpisSym | Isolate | Chrysomelidae |
| 100 | 3001462594 | Tatumella sp. JGM91 | Isolate | Drosophilidae |
| 101 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 102 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 103 | 2189573031 | Gamma-1 phylotype from Apis mellifera gut collected at the Carl Hayden Bee Research Center, Tucson, AZ. | Metagenome | Apidae |
| 104 | 2510065003 | Arsenophonus triatominarum ArT | Isolate | Reduviidae |
| 105 | 2556921622 | Terasakiella pusilla DSM 6293 | Isolate | Unclassified |
| 106 | 2588253732 | Klebsiella pneumoniae pneumoniae KP5-1 | Isolate | Pentatomidae |
| 107 | 2609459925 | Vibrio nigripulchritudo SO65 | Isolate | Unclassified |
| 108 | 2627853677 | Vibrio nigripulchritudo FTn2 | Isolate | Unclassified |
| 109 | 2684622551 | Vibrio campbellii E1 | Isolate | Unclassified |
| 110 | 2731957638 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 111 | 2824588292 | Yokenella regensburgei WCD67 | Isolate | Rhopalidae |
| 112 | 2840797934 | Gilliamella apicola Choc5-1 | Isolate | Apidae |
| 113 | 2846472545 | Gilliamella sp. N-W3 | Isolate | Apidae |
| 114 | 2846475167 | Gilliamella apicola N-G5 | Isolate | Apidae |
| 115 | 2846493360 | Gilliamella apis N-G1 | Isolate | Apidae |
| 116 | 2847708326 | Serratia liquefaciens P2ACOL2 | Isolate | Cerambycidae |
| 117 | 2848339753 | Ephemeroptericola cinctiostellae F02 | Isolate | Unclassified |
| 118 | 2854132136 | Gilliamella apicola wkB292 | Isolate | Apidae |
| 119 | 2856068565 | Cronobacter sakazakii MOD1-Md35s | Isolate | Muscidae |
| 120 | 2857888719 | Gilliamella apicola N-15-12 | Isolate | Apidae |
| 121 | 2864791955 | Aeromonas veronii S00030 | Isolate | Elmidae |
| 122 | 2870908367 | Gilliamella apis NO13 | Isolate | Apidae |
| 123 | 2870910722 | Gilliamella apicola wkB112 | Isolate | Apidae |
| 124 | 2873648542 | Gilliamella apicola NO10 | Isolate | Apidae |
| 125 | 2873653628 | Gilliamella apicola App6-5 | Isolate | Apidae |
| 126 | 2874504452 | Serratia marcescens ADJS-2C_Purple | Isolate | Unclassified |
| 127 | 2875320051 | Vibrio parahaemolyticus 160807 | Isolate | Unclassified |
| 128 | 2876014139 | Gilliamella apicola wkB18 | Isolate | Apidae |
| 129 | 2877638525 | Vibrio campbellii 1114GL | Isolate | Penaeidae |
| 130 | 2877647439 | Vibrio parahaemolyticus R13 | Isolate | Unclassified |
| 131 | 2885058212 | Erwinia sp. OLTSP20 | Isolate | Anthocoridae |
| 132 | 2896925746 | Vibrio nigripulchritudo SFn27 | Isolate | Unclassified |
| 133 | 2902469402 | Photobacterium lucens CAIM 1937 | Isolate | Unclassified |
| 134 | 637000270 | Sodalis glossinidius morsitans | Isolate | Glossinidae |
| 135 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 136 | 8022096067 | Vibrio sp. SALL6 | Isolate | Unclassified |
| 137 | 8022116796 | Vibrio sp. T3Y01 | Isolate | Unclassified |
| 138 | 8051461712 | Vibrio vulnificus Vv002 | Isolate | |
| 139 | 8060845732 | Vibrio vulnificus Vv006 | Isolate | |
| 140 | 8071343737 | Escherichia coli PN119 | Isolate | Calliphoridae |
| 141 | 8074288691 | Tatumella sp. JGM82 | Isolate | Drosophilidae |
| 142 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
| 143 | 2999134809 | Enterobacteriaceae endosymbiont of Donacia crassipes DcraSym | Isolate | Chrysomelidae |
| 144 | 3003878002 | Paraburkholderia sp. PGU19 | Isolate | Largidae |
| 145 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 146 | 3300005318 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut | Metagenome | Drosophilidae |
| 147 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 148 | 3300007733 | Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean | Metagenome | |
| 149 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 150 | 2510065002 | Arsenophonus sp. ArN | Isolate | Pteromalidae |
| 151 | 2515154049 | Candidatus Gilliamella apicola wkB30 | Isolate | Apidae |
| 152 | 2519899623 | Enterobacter sp. Ag1 | Isolate | Culicidae |
| 153 | 2528768159 | Alteromonadaceae bacterium Bs31 | Isolate | Unclassified |
| 154 | 2531839005 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 155 | 2537561600 | Salmonella enterica enterica sv. Newport CVM 19443 | Isolate | Unclassified |
| 156 | 2551306520 | Aliivibrio logei ATCC 35077 | Isolate | Majidae |
| 157 | 2554235022 | Vibrio parahaemolyticus v110 | Isolate | |
| 158 | 2585427711 | Candidatus Schmidhempelia bombi Bimp | Isolate | Apidae |
| 159 | 2588253791 | Yokenella regensburgei F. Haas DC-1, ATCC 49455 | Isolate | Unclassified |
| 160 | 2648501158 | Vibrio hepatarius DSM 19134 | Isolate | Unclassified |
| 161 | 2648501209 | Winslowiella iniecta B149 | Isolate | Aphididae |
| 162 | 2663763317 | Vibrio parahaemolyticus ISF-94-1 | Isolate | Unclassified |
| 163 | 2703719239 | Serratia marcescens ano1 | Isolate | Unclassified |
| 164 | 2778261153 | Escherichia coli MOD1-EC286 | Isolate | Unclassified |
| 165 | 2835335304 | Rahnella sp. Larv3_ips | Isolate | Curculionidae |
| 166 | 2854141978 | Gilliamella apicola A-12-12 | Isolate | Apidae |
| 167 | 2854147632 | Gilliamella apicola wkB195 | Isolate | Apidae |
| 168 | 2857878760 | Gilliamella apicola Gris1-4 | Isolate | Apidae |
| 169 | 2859315706 | Serratia sp. 3ACOL1 | Isolate | Cerambycidae |
| 170 | 2868489326 | Gilliamella apicola N10 | Isolate | Apidae |
| 171 | 2868499409 | Gilliamella apicola N-9-4 | Isolate | Apidae |
| 172 | 2870913170 | Gilliamella apis A-TSA2 | Isolate | Apidae |
| 173 | 2870920129 | Gilliamella apicola wkB108 | Isolate | Apidae |
| 174 | 2873633977 | Gilliamella apicola wkB178 | Isolate | Apidae |
| 175 | 2873638493 | Gilliamella apicola wkB72 | Isolate | Apidae |
| 176 | 2873651485 | Gilliamella apicola Choc4-2 | Isolate | Apidae |
| 177 | 2876025319 | Gilliamella apis NO12 | Isolate | Apidae |
| 178 | 2876334352 | Cronobacter sakazakii MOD1-Md6g | Isolate | Muscidae |
| 179 | 2885050628 | Erwinia sp. OLMTSP26 | Isolate | Anthocoridae |
| 180 | 2885061987 | Erwinia sp. OLFS4 | Isolate | Anthocoridae |
| 181 | 2885065815 | Erwinia sp. OAMSP11 | Isolate | Anthocoridae |
| 182 | 2889908211 | Bowmanella denitrificans JL63 | Isolate | Unclassified |
| 183 | 2898991528 | Erwinia sp. OLMDLW33 | Isolate | Anthocoridae |
| 184 | 2912570088 | Vibrio parahaemolyticus CHN25 | Isolate | |
| 185 | 2961206375 | Serratia sp. OMLW3 | Isolate | Anthocoridae |
| 186 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 187 | 651285005 | Serratia symbiotica Tuscon | Isolate | Aphididae |
| 188 | 8004285568 | Serratia sp. OLHL2 | Isolate | Anthocoridae |
| 189 | 8004541719 | Serratia marcescens KZ19 | Isolate | Apidae |
| 190 | 8004582426 | Serratia sp. OSPLW9 | Isolate | Anthocoridae |
| 191 | 8051551332 | Vibrio vulnificus Vv003 | Isolate | |
| 192 | 8088493931 | Gilliamella apis K-MP18 | Isolate | Apidae |
| 193 | 2970335472 | Cronobacter muytjensii MOD1-Md1s | Isolate | Muscidae |
| 194 | 2977727922 | Cronobacter sakazakii MOD1-Md33s | Isolate | Muscidae |
| 195 | 2978102237 | Serratia fonticola AeS1 | Isolate | Culicidae |
| 196 | 2987233858 | Stutzerimonas stutzeri AR9-4 | Isolate | Unclassified |
| 197 | 3007994558 | Escherichia alba B35 | Isolate | Tenebrionidae |
| 198 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 199 | 3300007224 | Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut | Metagenome | Unclassified |
| 200 | 3300009461 | Microbial communities of aphids from Rhamnus cathartica in Ottawa, Ontario, CA - Aphis nasturtii CNC#HEM071789 seqcov | Metagenome | |
| 201 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 202 | 2515154034 | Frischella perrara PEB0191 | Isolate | Apidae |
| 203 | 2551306531 | Enterobacter hormaechei YT2 | Isolate | Tenebrionidae |
| 204 | 2630968947 | Frischella perrara PEB0191 | Isolate | Apidae |
| 205 | 2648501820 | Vibrio nigripulchritudo BLFn1 | Isolate | Unclassified |
| 206 | 2667527830 | Vibrio parahaemolyticus ISF-29-3 | Isolate | Unclassified |
| 207 | 2681813507 | Insolitispirillum peregrinum integrum DSM 11589 | Isolate | Unclassified |
| 208 | 2700989396 | Vibrio parahaemolyticus ISF-77-01 | Isolate | Unclassified |
| 209 | 2731957969 | Proteus mirabilis Wood | Isolate | Calliphoridae |
| 210 | 2744054871 | Candidatus Arsenophonus triatominarum ATi | Isolate | Unclassified |
| 211 | 2756170277 | Enterobacillus tribolii DSM 103736 | Isolate | Unclassified |
| 212 | 2785510744 | Gilliamella sp. ESL0405 | Isolate | Apidae |
| 213 | 2785510745 | Gilliamella sp. ESL0407 | Isolate | Apidae |
| 214 | 2785510762 | Vibrio parahaemolyticus VP14 | Isolate | Unclassified |
| 215 | 2833053935 | Buttiauxella sp. 3AFRM03 | Isolate | Cerambycidae |
| 216 | 2833478085 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 217 | 2837516909 | Rahnella bruchi DSM 27398 | Isolate | Unclassified |
| 218 | 2841260384 | Providencia alcalifaciens Dmel2 | Isolate | Drosophilidae |
| 219 | 2843334863 | Gilliamella apicola A-2-24 | Isolate | Apidae |
| 220 | 2846490831 | Gilliamella apis ESL0172 | Isolate | Apidae |
| 221 | 2849446820 | Gilliamella apicola Bif1-4 | Isolate | Apidae |
| 222 | 2849468476 | Gilliamella apicola N-28 | Isolate | Apidae |
| 223 | 2854129949 | Gilliamella apis M1-2G | Isolate | Apidae |
| 224 | 2854137290 | Gilliamella apicola Imp1-6 | Isolate | Apidae |
| 225 | 2854139540 | Gilliamella apicola Imp1-1 | Isolate | Apidae |
| 226 | 2857883421 | Gilliamella apicola N2 | Isolate | Apidae |
| 227 | 2857891623 | Gilliamella apicola wkB171 | Isolate | Apidae |
| 228 | 2868486652 | Gilliamella sp. N-G2 | Isolate | Apidae |
| 229 | 2868506828 | Gilliamella apicola App4-10 | Isolate | Apidae |
| 230 | 2870897478 | Gilliamella apicola A-7-12 | Isolate | Apidae |
| 231 | 2870900452 | Gilliamella apis NO14 | Isolate | Apidae |
| 232 | 2873640908 | Gilliamella apicola wkB308 | Isolate | Apidae |
| 233 | 2878947168 | Serratia marcescens ADJS-2D_White | Isolate | Unclassified |
| 234 | 2885043073 | Erwinia sp. OLSSP12 | Isolate | Anthocoridae |
| 235 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 236 | 2902438364 | Photobacterium damselae Hep-2a-11 | Isolate | Unclassified |
| 237 | 2937735258 | Serratia marcescens KZ11 | Isolate | Apidae |
| 238 | 2961247850 | Serratia sp. OLAL2 | Isolate | Anthocoridae |
| 239 | 8004307473 | Serratia sp. OLIL2 | Isolate | Anthocoridae |
| 240 | 8004571736 | Serratia sp. OLDL1 | Isolate | Anthocoridae |
| 241 | 8008122225 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 242 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 243 | 8042061949 | Vibrio harveyi Hep-2a-10 | Isolate | Unclassified |
| 244 | 8100181737 | Kosakonia sp. S58 | Isolate | Curculionidae |
| 245 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 246 | 2970791725 | Serratia sp. OLBL1 | Isolate | Anthocoridae |
| 247 | 2977691992 | Cronobacter malonaticus MOD1-Md27g | Isolate | Muscidae |
| 248 | 2977745872 | Cronobacter sakazakii MOD1-Md1g | Isolate | Muscidae |
| 249 | 2996467878 | Serratia sp. OLFL2 | Isolate | Anthocoridae |
| 250 | 3300000461 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-P17 | Metagenome | Apidae |
| 251 | 3300000473 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-I20 | Metagenome | Apidae |
| 252 | 3300000490 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-L16 | Metagenome | Apidae |
| 253 | 3300005309 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 1 gut | Metagenome | Drosophilidae |
| 254 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 255 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 256 | 2512047046 | Secondary Endosymbiont of Heteropsylla cubana | Isolate | Psyllidae |
| 257 | 2515154047 | Candidatus Gilliamella apicola wkB1 | Isolate | Apidae |
| 258 | 2531839602 | Shimwellia blattae NBRC 105725 | Isolate | Unclassified |
| 259 | 2574179716 | Serratia sp. DD3 | Isolate | Daphniidae |
| 260 | 2597489903 | Providencia sneebia DSM 19967 | Isolate | Drosophilidae |
| 261 | 2609459958 | Vibrio nigripulchritudo Wn13 | Isolate | Unclassified |
| 262 | 2630968716 | Vibrio nigripulchritudo AM115 | Isolate | Unclassified |
| 263 | 2636415542 | Vibrio nigripulchritudo SFn135 | Isolate | Unclassified |
| 264 | 2654587515 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 265 | 2684622921 | Frischella perrara Fp_167 | Isolate | Unclassified |
| 266 | 2684622923 | Gilliamella apicola Ga_172 | Isolate | Unclassified |
| 267 | 2684622925 | Gilliamella apicola Ga_178 | Isolate | Unclassified |
| 268 | 2684622926 | Gilliamella apicola Ga_182 | Isolate | Unclassified |
| 269 | 2718217944 | Serratia marcescens AS1 | Isolate | Culicidae |
| 270 | 2765235945 | Kosakonia cowanii Esp_Z | Isolate | Culicidae |
| 271 | 2833532623 | Frischella perrara ESL0167 | Isolate | Apidae |
| 272 | 2840795165 | Gilliamella apicola N-22 | Isolate | Apidae |
| 273 | 2844251356 | Photobacterium leiognathi mandapamensis ajapo.3.1 | Isolate | Unclassified |
| 274 | 2846483029 | Gilliamella apis AM1 | Isolate | Apidae |
| 275 | 2849466174 | Gilliamella apis P83G | Isolate | Apidae |
| 276 | 2854134697 | Gilliamella apicola Fer4-1 | Isolate | Apidae |
| 277 | 2854144746 | Gilliamella apicola NO6 | Isolate | Apidae |
| 278 | 2854149989 | Gilliamella apis A-TSA1 | Isolate | Apidae |
| 279 | 2857870431 | Gilliamella apicola A-7-24 | Isolate | Apidae |
| 280 | 2857873190 | Gilliamella apicola Nev5-1 | Isolate | Apidae |
| 281 | 2857886120 | Gilliamella apicola Bim1-2 | Isolate | Apidae |
| 282 | 2858407585 | Photobacterium swingsii DSM 24669 | Isolate | Unclassified |
| 283 | 2864764899 | Aeromonas fluvialis S00019 | Isolate | Elmidae |
| 284 | 2864768727 | Aeromonas veronii S00020 | Isolate | Elmidae |
| 285 | 2868492035 | Gilliamella apicola Occ4-3 | Isolate | Apidae |
| 286 | 2874434233 | Serratia marcescens ADJS-2C_Red | Isolate | Unclassified |
| 287 | 2876019154 | Gilliamella apicola ESL0182 | Isolate | Apidae |
| 288 | 2876030618 | Gilliamella apicola HK2 | Isolate | Apidae |
| 289 | 2880115952 | Vibrio parahaemolyticus PB1937 | Isolate | Unclassified |
| 290 | 2900349738 | Photobacterium lucens CAIM 1938 | Isolate | Unclassified |
| 291 | 2912636047 | Vibrio crassostreae 9CS106 | Isolate | Unclassified |
| 292 | 2961232173 | Serratia sp. OLLOLW30 | Isolate | Anthocoridae |
| 293 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 294 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 295 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 296 | 8048928574 | Photobacterium swingsii CECT 7576 | Isolate | Unclassified |
| 297 | 8100176769 | Kosakonia sp. S57 | Isolate | Curculionidae |
| 298 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 299 | 2965197371 | Serratia sp. OLCL1 | Isolate | Anthocoridae |
| 300 | 2998827899 | Enterobacteriaceae endosymbiont of Donacia cincticornis DcincSym | Isolate | Chrysomelidae |
| 301 | 2998831142 | Enterobacteriaceae endosymbiont of Macroplea appendiculata MappSym | Isolate | Chrysomelidae |
| 302 | 3001459110 | Tatumella sp. JGM118 | Isolate | Drosophilidae |
| 303 | 3300000459 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Frischia SCG AB-598-C04 | Metagenome | Apidae |
| 304 | 3300007130 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut | Metagenome | Drosophilidae |
| 305 | 2507262057 | Enterobacteriaceae bacterium FGI 57 | Isolate | Unclassified |
| 306 | 2551306516 | Enterobacter hormaechei YT3 | Isolate | Tenebrionidae |
| 307 | 2571042430 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 308 | 2599185261 | Thorsellia anophelis DSM 18579 | Isolate | Unclassified |
| 309 | 2627854002 | Vibrio nigripulchritudo ENn2 | Isolate | Unclassified |
| 310 | 2711768158 | Vibrio coralliilyticus S2043 | Isolate | Unclassified |
| 311 | 2837618715 | Gilliamella apicola Aw-17 | Isolate | Apidae |
| 312 | 2841195917 | Gilliamella apicola wkB7 | Isolate | Apidae |
| 313 | 2841821538 | Psychrobacter sp. YP14 | Isolate | Unclassified |
| 314 | 2846495668 | Gilliamella apicola ESL0178 | Isolate | Apidae |
| 315 | 2849452216 | Gilliamella apicola AW11 | Isolate | Apidae |
| 316 | 2849455045 | Gilliamella apicola NO8 | Isolate | Apidae |
| 317 | 2850895757 | Vibrio campbellii 170502 | Isolate | Unclassified |
| 318 | 2860776474 | Vibrio parahaemolyticus R14 | Isolate | Unclassified |
| 319 | 2868504459 | Gilliamella apis NO4 | Isolate | Apidae |
| 320 | 2870917785 | Gilliamella apis NO15 | Isolate | Apidae |
| 321 | 2871760914 | Pantoea ananatis PANS 01-2 | Isolate | Thripidae |
| 322 | 2872471378 | Vibrio owensii V180403 | Isolate | Unclassified |
| 323 | 2873636219 | Gilliamella apicola App2-1 | Isolate | Apidae |
| 324 | 2876033458 | Gilliamella apicola AM6 | Isolate | Apidae |
| 325 | 2876036378 | Gilliamella apicola Choc3-5 | Isolate | Apidae |
| 326 | 2878462549 | Gilliamella apicola Occ3-1 | Isolate | Apidae |
| 327 | 2878464769 | Gilliamella apis ESL0169 | Isolate | Apidae |
| 328 | 2921816052 | Cronobacter sakazakii MOD1-Anth48g | Isolate | Anthomyiidae |
| 329 | 2922113941 | Serratia sp. OLEL1 | Isolate | Anthocoridae |
| 330 | 2937427229 | Cronobacter malonaticus MOD1-Md99g | Isolate | Muscidae |
| 331 | 2937751072 | Serratia sp. OLMTLW26 | Isolate | Anthocoridae |
| 332 | 2958255616 | Serratia marcescens TM | Isolate | |
| 333 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 334 | 8001059720 | Tenebrionicola larvae YMB-R22 | Isolate | Tenebrionidae |
| 335 | 8022087107 | Vibrio sp. OULL4 | Isolate | Unclassified |
| 336 | 8022439116 | Vibrio sp. ArtGut-C1 | Isolate | Artemiidae |
| 337 | 8062647588 | Nissabacter archeti JGM97 | Isolate | Drosophilidae |
| 338 | 8071333649 | Escherichia coli PN108 | Isolate | Calliphoridae |
| 339 | 8071338694 | Escherichia coli PN87 | Isolate | Calliphoridae |
| 340 | 8102982778 | Erwinia sp. S63 | Isolate | Curculionidae |
| 341 | 8116627632 | Vibrio penaeicida NBRC 15640 | Isolate | Unclassified |
| 342 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 343 | 2978161719 | Serratia marcescens KZ2 | Isolate | Apidae |
| 344 | 2999138033 | Enterobacteriaceae endosymbiont of Donacia provostii DprovSym | Isolate | Chrysomelidae |
| 345 | 3000861951 | Budvicia diplopodorum D9 | Isolate | |
| 346 | 3004364956 | Cronobacter sakazakii MOD1-Md5s | Isolate | Muscidae |
| 347 | 3006225627 | Vibrio sp. Hep-1b-8 | Isolate | Unclassified |
| 348 | 3006242587 | Vibrio sp. RE86 | Isolate | Unclassified |
| 349 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 350 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 351 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 352 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 353 | 2515154048 | Candidatus Gilliamella apicola wkB11 | Isolate | Apidae |
| 354 | 2518285522 | Photorhabdus khanii NC19 | Isolate | Unclassified |
| 355 | 2528768011 | Serratia symbiotica SCt-VLC | Isolate | Aphididae |
| 356 | 2547132185 | Enterobacter cancerogenus YZ1 | Isolate | Tenebrionidae |
| 357 | 2551306507 | Vibrio parahaemolyticus PCV08-7 | Isolate | Unclassified |
| 358 | 2582581321 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 359 | 2619619082 | Pantoea agglomerans SL1_M5 | Isolate | Unclassified |
| 360 | 2636415586 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 361 | 2667527887 | Vibrio harveyi LMG 4044 | Isolate | Unclassified |
| 362 | 2684622924 | Gilliamella apicola Ga_177 | Isolate | Unclassified |
| 363 | 2778261152 | Escherichia coli MOD1-EC284 | Isolate | Unclassified |
| 364 | 2791355471 | Vibrio bivalvicida 605 | Isolate | Unclassified |
| 365 | 2791355473 | Vibrio barjaei 3062 | Isolate | Unclassified |
| 366 | 2822856742 | Enterobacter cancerogenus CR-Eb1 | Isolate | Unclassified |
| 367 | 2838840603 | Gilliamella apicola A-9-12 | Isolate | Apidae |
| 368 | 2843904799 | Shewanella khirikhana TH2012 | Isolate | Unclassified |
| 369 | 2846477985 | Gilliamella apicola Fer1-1 | Isolate | Apidae |
| 370 | 2848317263 | Arsenophonus endosymbiont of Aleurodicus floccissimus ARAF | Isolate | Aleyrodidae |
| 371 | 2849460838 | Gilliamella apicola Gris3-2 | Isolate | Apidae |
| 372 | 2850131454 | Providencia rettgeri NVIT03 | Isolate | Pteromalidae |
| 373 | 2854127928 | Gilliamella apicola Choc6-1 | Isolate | Apidae |
| 374 | 2857868033 | Gilliamella apis P62G | Isolate | Apidae |
| 375 | 2864777284 | Aeromonas hydrophila S00023 | Isolate | Elmidae |
| 376 | 2864796242 | Aeromonas hydrophilia S00040 | Isolate | Elmidae |
| 377 | 2868497104 | Gilliamella apis A-TSA4 | Isolate | Apidae |
| 378 | 2870905362 | Gilliamella apicola Nev3-1 | Isolate | Apidae |
| 379 | 2873645950 | Gilliamella apicola Fer2-1 | Isolate | Apidae |
| 380 | 2873884416 | Photobacterium sanguinicancri Mj110 CAIM 1827 | Isolate | Majidae |
| 381 | 2874880541 | Enterobacter hormaechei E3442 | Isolate | Unclassified |
| 382 | 2964846109 | Cronobacter sakazakii MOD1-Md5g | Isolate | Muscidae |
| 383 | 2964859436 | Cronobacter sakazakii MOD1-Md40g | Isolate | Muscidae |
| 384 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 385 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 386 | 650716016 | Candidatus Moranella endobia PCIT | Isolate | Pseudococcidae |
| 387 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 388 | 8021540981 | Klebsiella sp. Kpp | Isolate | Tephritidae |
| 389 | 8028002147 | Enterobacter sp. 10-1 | Isolate | Cerambycidae |
| 390 | 8048923410 | Photobacterium sanguinicancri CECT 7579 | Isolate | Unclassified |
| 391 | 8051534459 | Vibrio vulnificus Vv004 | Isolate | |
| 392 | 8088488961 | Gilliamella apis ESL0169 | Isolate | Apidae |
| 393 | 8099192374 | Erwinia typographi IC4 | Isolate | Curculionidae |
| 394 | 8110023836 | Enterobacterales bacterium BIT-L3 | Isolate | Tenebrionidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | SCG598P17_11875 | 3300000461 | Unclassified | 33876 |
| 2 | SCG598I22_11884 | 3300000462 | Bacteria | 91970 |
| 3 | Ga0063521_1001508 | 3300003973 | Unclassified | 6276 |
| 4 | Ga0466724_44677 | 3300042649 | Bacteria | 154239 |
| 5 | Ga0265387_1000080 | 3300024582 | Bacteria | 28612 |
| 6 | Ga0466701_026331 | 3300042598 | Bacteria | 4969 |
| 7 | Ga0466706_079539 | 3300042599 | Unclassified | 2489 |
| 8 | Ga0466707_165779 | 3300042601 | Bacteria | 177707 |
| 9 | Ga0466713_103029 | 3300042602 | Bacteria | 264074 |
| 10 | Ga0562375_0007 | 3300056856 | Bacteria | 1880046 |
| 11 | HBC_ctgsDRAFT_1000973 | 3300000333 | Unclassified | 6218 |
| 12 | HBC_ctgsDRAFT_1001322 | 3300000333 | Bacteria | 5395 |
| 13 | HBC_ctgsDRAFT_1013486 | 3300000333 | Unclassified | 1968 |
| 14 | CVPL010L_1000239 | 3300002932 | Bacteria | 31601 |
| 15 | Ga0063521_1000007 | 3300003973 | Bacteria | 219071 |
| 16 | Ga0063521_1004542 | 3300003973 | Bacteria | 3280 |
| 17 | Ga0074278_146873 | 3300005721 | Bacteria | 6696 |
| 18 | Ga0105524_100661 | 3300007733 | Bacteria | 8013 |
| 19 | Ga0466730_046425 | 3300042625 | Unclassified | 24639 |
| 20 | Ga0466701_078985 | 3300042598 | Bacteria | 40412 |
| 21 | gam1t_NODE_471792_length=55024_GC=33_7_Contigs=1 | 2189573031 | Bacteria | 55024 |
| 22 | Meta3P_1000048 | 3300002464 | Bacteria | 60398 |
| 23 | Ga0063521_1000099 | 3300003973 | Bacteria | 69359 |
| 24 | Ga0063521_1000181 | 3300003973 | Bacteria | 46094 |
| 25 | Ga0104040_1142487 | 3300007149 | Unclassified | 2717 |
| 26 | Ga0104147_1026895 | 3300007224 | Bacteria | 3187 |
| 27 | Ga0160436_1001035 | 3300012861 | Bacteria | 8291 |
| 28 | Ga0466701_020286 | 3300042598 | Bacteria | 64466 |
| 29 | Ga0562377_0001 | 3300056842 | Bacteria | 5082480 |
| 30 | Ga0562377_0343 | 3300056842 | Bacteria | 90909 |
| 31 | Ga0104040_1041471 | 3300007149 | Bacteria | 3517 |
| 32 | Ga0127657_106903 | 3300009457 | Bacteria | 12078 |
| 33 | Ga0127645_134819 | 3300009461 | Unclassified | 3171 |
| 34 | Ga0562378_0298 | 3300056814 | Bacteria | 103487 |
| 35 | gam1t_NODE_608056_length=128205_GC=35_0_Contigs=2 | 2189573031 | Bacteria | 128215 |
| 36 | IMNBL1DRAFT_c0002757 | 3300000062 | Bacteria | 11944 |
| 37 | Ga0068305_10326312 | 3300005083 | Unclassified | 4508 |
| 38 | Ga0466724_68450 | 3300042649 | Bacteria | 17226 |
| 39 | Ga0316159_10001 | 3300030930 | Bacteria | 1642808 |
| 40 | Ga0466706_263232 | 3300042599 | Bacteria | 2335 |
| 41 | Ga0562375_0815 | 3300056856 | Bacteria | 53098 |
| 42 | DPOL_contig13533 | 2035918003 | Unclassified | 6429 |
| 43 | FGTW_contig07744 | 2065487013 | Bacteria | 13295 |
| 44 | FGTW_contig30413 | 2065487013 | Bacteria | 84057 |
| 45 | SCG598I20_12288 | 3300000473 | Bacteria | 21227 |
| 46 | CVPL010L_1000271 | 3300002932 | Unclassified | 13458 |
| 47 | Ga0074306_1117392 | 3300005309 | Bacteria | 6086 |
| 48 | Ga0074278_112256 | 3300005721 | Bacteria | 128215 |
| 49 | Ga0104050_1026163 | 3300007153 | Bacteria | 6421 |
| 50 | Ga0160455_100013 | 3300012837 | Bacteria | 536068 |
| 51 | FGTW_contig31990 | 2065487013 | Bacteria | 3057 |
| 52 | gam1t_NODE_293249_length=6686_GC=34_5_Contigs=2 | 2189573031 | Unclassified | 6696 |
| 53 | 2227080781 | 2225789004 | Bacteria | 168264 |
| 54 | Meta3P_1000778 | 3300002464 | Bacteria | 34894 |
| 55 | Ga0074188_1000329 | 3300005318 | Bacteria | 7492 |
| 56 | Ga0466730_022877 | 3300042625 | Bacteria | 2958 |
| 57 | Ga0466724_19274 | 3300042649 | Bacteria | 102437 |
| 58 | Ga0562379_0001 | 3300056790 | Bacteria | 4904077 |
| 59 | Ga0562376_0001 | 3300056857 | Bacteria | 4828905 |
| 60 | SCG598C04_12254 | 3300000459 | Unclassified | 1956 |
| 61 | SCG598L16_135307 | 3300000490 | Bacteria | 25069 |
| 62 | Ga0063521_1000179 | 3300003973 | Bacteria | 46734 |
| 63 | Ga0104041_1032522 | 3300007106 | Bacteria | 4714 |
| 64 | Ga0104042_1119507 | 3300007130 | Bacteria | 3545 |
| 65 | Ga0105005_1026470 | 3300007505 | Bacteria | 12938 |
| 66 | Ga0105553_1038764 | 3300007767 | Bacteria | 7604 |
| 67 | Ga0466724_07192 | 3300042649 | Unclassified | 23261 |
| 68 | Ga0466713_016250 | 3300042602 | Bacteria | 7448 |
| 69 | Ga0466713_062613 | 3300042602 | Bacteria | 238473 |
Family Sequences
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02322 | Cyt_bd_oxida_II | Cytochrome bd terminal oxidase subunit II | 12 | 367 | 0.95 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02322 | GO:0016020 | membrane | CC |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.92 | 0.92 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.