Protein Family IF01706

Metagenome Isolate
205 Members
100 Samples
168 Scaffolds
381.63 Avg Length

🧬 Representative Sequence

ID
3300007129|Ga0102734_1003772|Ga0102734_10037723
Length
416 aa
Sequence
MNLEPFLQIMAERKAADLFIAAGFPPAAKIHGKLVPLTKAPLTEEQTRKAAYGIMTERQREEFDNSSECNFAIRSRAGRFRASAFIQQGSVSIVMRRIEEEIPNLEDLELPPIIQKLAMTRLGLILFVGGTGTGKSSSLAAMLGYRNQHSNGHIITIEDPIEFVHKHRNCIVNQREVGVDTESYDVALRNSLRQAPDVIMLGEIRSLKTMSYAMHFAESGHVCISTLHANSANQALERIINFFPADQKEQSLFDLSINLRAIIAQKLVPVKSGGRRAVIEIMLNTPLISDLIRKGEIADIKPIIAKSRTLGMQTFDQSLFALYKEDELTQEEAMSYADSPNDLRLMIKLDTDAGGEELKKAAEKFVLYQAPEEGEQKESGKISIKEMMKKSKSHNKGLAGIADNIKDLNITLADD*

📊 Sample Types

Isolate 18.1%
Metagenome 82.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 25.0%
Unclassified 22.9%
Kalotermitidae 14.6%
Elmidae 12.5%
Formicidae 5.2%
Rhinotermitidae 4.2%
Termopsidae 4.2%
Curculionidae 3.1%
Culicidae 3.1%
Armadillidiidae 2.1%
Hydrophilidae 2.1%
Hodotermitidae 1.0%

🌳 Taxonomy

Archaea 0
Bacteria 197
Eukaryota 0
Viruses 0
Unclassified 8

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2864812326 Chitinimonas taiwanensis S00057 Isolate Elmidae
2 2864859030 Chromobacterium alkanivorans S00115 Isolate Elmidae
3 2864960361 Comamonas odontotermitis S00229 Isolate Elmidae
4 2868169047 Comamonas aquatica S00077 Isolate Elmidae
5 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
6 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
7 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
8 8100461708 Delftia sp. S65 Isolate Curculionidae
9 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
10 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
11 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
12 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
13 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
14 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
15 2864826666 Acidovorax konjaci S00067 Isolate Elmidae
16 2873571580 Diaphorobacter sp. HDW4B Isolate Hydrophilidae
17 2820047982 Unclassified Proteobacteria Th196P3bin67 Isolate Unclassified
18 2820059968 Unclassified Proteobacteria Nt197P4bin23 Isolate Unclassified
19 2820131053 Unclassified Proteobacteria Emb289P3bin8 Isolate Unclassified
20 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
21 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
22 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
23 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
24 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
25 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
26 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
27 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
28 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
29 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
30 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
31 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
32 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
33 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
34 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
35 2864808494 Chitinimonas taiwanensis S00056 Isolate Elmidae
36 2571042003 Stenoxybacter acetivorans DSM 19021 Isolate Rhinotermitidae
37 2820062699 Unclassified Proteobacteria Nt197P4bin15 Isolate Unclassified
38 2820077244 Unclassified Proteobacteria Lab288P4bin72 Isolate Unclassified
39 2820152154 Unclassified Proteobacteria Cu122P5bin47 Isolate Unclassified
40 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
41 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
42 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
43 8100449422 Delftia sp. S66 Isolate Curculionidae
44 2864755708 Massilia timonae S00006 Isolate Elmidae
45 2820065746 Unclassified Proteobacteria Nt197P3bin56 Isolate Unclassified
46 2820084079 Unclassified Proteobacteria Lab288P4bin103 Isolate Unclassified
47 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
48 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
49 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
50 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
51 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
52 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
53 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
54 8100455565 Delftia sp. S67 Isolate Curculionidae
55 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
56 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
57 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
58 2864914039 Chromobacterium alkanivorans S00172 Isolate Elmidae
59 2864988360 Chromobacterium alkanivorans S00296 Isolate Elmidae
60 2820103659 Unclassified Proteobacteria Emb289P4bin67 Isolate Unclassified
61 2820121232 Unclassified Proteobacteria Emb289P4bin32 Isolate Unclassified
62 2820123897 Unclassified Proteobacteria Emb289P4bin18 Isolate Unclassified
63 2820164216 Unclassified Proteobacteria Cu122P1bin22 Isolate Unclassified
64 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
65 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
66 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
67 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
68 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
69 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
70 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
71 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
72 2864968865 Paucibacter oligotrophus S00239 Isolate Elmidae
73 2873565274 Diaphorobacter sp. HDW4A Isolate Hydrophilidae
74 2820089333 Unclassified Proteobacteria Lab288P3bin88 Isolate Unclassified
75 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
76 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
77 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
78 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
79 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
80 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
81 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
82 2864870719 Comamonas odontotermitis S00124 Isolate Elmidae
83 2864937364 Acidovorax soli S00198 Isolate Elmidae
84 2891720358 Azoarcus nasutitermitis CC-YHH838 Isolate Unclassified
85 2820042117 Unclassified Proteobacteria Th196P4bin58 Isolate Unclassified
86 2820050117 Unclassified Proteobacteria Th196P3bin129 Isolate Unclassified
87 2820086750 Unclassified Proteobacteria Lab288P3bin98 Isolate Unclassified
88 2820157249 Unclassified Proteobacteria Cu122P4bin11 Isolate Unclassified
89 2820161938 Unclassified Proteobacteria Cu122P3bin14 Isolate Unclassified
90 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
91 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
92 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
93 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
94 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
95 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
96 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
97 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
98 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
99 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
100 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0102734_1003772 3300007129 Bacteria 3856
2 Ga0103268_1004392 3300007192 Bacteria 2867
3 Ga0466657_120452 3300042582 Bacteria 2151
4 Ga0466657_287738 3300042582 Bacteria 27899
5 Ga0466697_255061 3300042611 Bacteria 3333
6 Ga0466712_063124 3300042614 Bacteria 1415
7 Ga0466711_384001 3300042615 Bacteria 14197
8 Ga0466723_161728 3300042618 Bacteria 22290
9 Ga0466728_134467 3300042620 Bacteria 20390
10 Ga0466728_392551 3300042620 Bacteria 4827
11 Ga0123354_10000002 3300010882 Bacteria 317342
12 Ga0466731_322894 3300042622 Bacteria 3440
13 Ga0466734_010816 3300042623 Bacteria 2399
14 Ga0466730_008869 3300042625 Bacteria 313970
15 Ga0466703_011291 3300042636 Bacteria 72818
16 Ga0466703_164149 3300042636 Bacteria 3094
17 Ga0466709_149723 3300042648 Bacteria 12767
18 Ga0466707_364354 3300042601 Bacteria 1417
19 Ga0466719_052539 3300042606 Bacteria 15950
20 Ga0466719_449246 3300042606 Bacteria 3181
21 Ga0466719_489382 3300042606 Unclassified 1776
22 Ga0466722_094205 3300042609 Bacteria 2795
23 Ga0466722_120794 3300042609 Bacteria 1882
24 Ga0466697_053404 3300042611 Bacteria 1908
25 JGI24702J35022_10000628 3300002462 Bacteria 21521
26 Ga0123357_10000009 3300009784 Bacteria 204245
27 Ga0160455_100051 3300012837 Bacteria 249063
28 Ga0466657_248399 3300042582 Bacteria 9181
29 Ga0466657_272357 3300042582 Bacteria 12531
30 Ga0466657_296952 3300042582 Bacteria 25234
31 Ga0466690_012085 3300042590 Bacteria 20404
32 Ga0466697_122255 3300042611 Bacteria 3971
33 Ga0466705_105450 3300042612 Bacteria 12741
34 Ga0466732_094350 3300042656 Bacteria 2842
35 Ga0466710_029876 3300042613 Bacteria 3705
36 Ga0466710_146058 3300042613 Bacteria 18610
37 Ga0466712_041405 3300042614 Bacteria 4759
38 Ga0466715_249410 3300042616 Bacteria 31894
39 Ga0466723_100869 3300042618 Bacteria 18431
40 Ga0466729_285013 3300042621 Bacteria 2822
41 Ga0466734_080560 3300042623 Bacteria 12255
42 Ga0466734_103526 3300042623 Unclassified 87559
43 Ga0466730_086547 3300042625 Bacteria 310448
44 Ga0466703_313613 3300042636 Unclassified 1782
45 Ga0466709_369313 3300042648 Bacteria 5684
46 Ga0466708_158547 3300042652 Bacteria 10728
47 Ga0466725_409024 3300042654 Bacteria 23019
48 Ga0466701_029854 3300042598 Bacteria 12533
49 Ga0466719_558241 3300042606 Bacteria 1582
50 JGI24705J35276_12234579 3300002504 Bacteria 5646
51 Ga0102735_1000123 3300007080 Bacteria 20218
52 Ga0466657_004786 3300042582 Bacteria 6761
53 Ga0466657_097439 3300042582 Bacteria 29468
54 Ga0466657_227720 3300042582 Bacteria 11721
55 Ga0466711_118320 3300042615 Bacteria 6218
56 Ga0466711_501732 3300042615 Bacteria 3213
57 Ga0466715_340002 3300042616 Bacteria 4969
58 Ga0123357_10094547 3300009784 Unclassified 3879
59 Ga0123356_10013546 3300010049 Bacteria 7864
60 Ga0466729_229351 3300042621 Bacteria 5366
61 Ga0466734_081323 3300042623 Bacteria 6770
62 Ga0466734_141953 3300042623 Bacteria 1890
63 Ga0466735_028014 3300042624 Bacteria 2168
64 Ga0466703_341173 3300042636 Bacteria 4970
65 Ga0466724_26857 3300042649 Bacteria 91347
66 Ga0466708_077242 3300042652 Bacteria 14262
67 Ga0466725_128406 3300042654 Bacteria 6224
68 Ga0466701_027330 3300042598 Bacteria 79527
69 Ga0466701_039976 3300042598 Bacteria 327114
70 Ga0466713_026884 3300042602 Bacteria 64226
71 JGI24705J35276_12238748 3300002504 Bacteria 51303
72 Ga0103264_1000228 3300007188 Bacteria 54643
73 Ga0123357_10000446 3300009784 Bacteria 39827
74 Ga0160468_100534 3300012819 Bacteria 14896
75 Ga0160472_101561 3300012839 Bacteria 6461
76 Ga0466692_124694 3300042591 Bacteria 12687
77 Ga0466695_055939 3300042595 Bacteria 12334
78 Ga0466696_016270 3300042596 Bacteria 6053
79 Ga0466701_000899 3300042598 Bacteria 4630
80 Ga0466701_004422 3300042598 Bacteria 11947
81 Ga0466705_084923 3300042612 Bacteria 13395
82 Ga0466710_075596 3300042613 Bacteria 4332
83 Ga0466710_091764 3300042613 Bacteria 10549
84 Ga0466726_248809 3300042619 Bacteria 15197
85 Ga0123354_10104192 3300010882 Bacteria 3807
86 Ga0466724_27476 3300042649 Bacteria 555291
87 Ga0466708_092921 3300042652 Bacteria 15843
88 Ga0466708_138327 3300042652 Bacteria 16274
89 Ga0466708_212407 3300042652 Bacteria 33471
90 Ga0466707_175155 3300042601 Bacteria 29163
91 Ga0466707_237624 3300042601 Bacteria 3697
92 Ga0466717_102427 3300042604 Bacteria 13013
93 Ga0466719_185332 3300042606 Bacteria 2807
94 Ga0466697_030720 3300042611 Bacteria 6724
95 Ga0103267_1001501 3300007190 Bacteria 5809
96 Ga0160472_103641 3300012839 Bacteria 2968
97 Ga0160447_107668 3300012849 Bacteria 2669
98 Ga0466690_099297 3300042590 Bacteria 8294
99 Ga0466693_084945 3300042592 Bacteria 2581
100 Ga0466691_023612 3300042593 Bacteria 17170
101 Ga0466691_032545 3300042593 Bacteria 5119
102 Ga0466733_178438 3300042659 Bacteria 4867
103 Ga0466726_053798 3300042619 Bacteria 5537
104 Ga0466703_006343 3300042636 Bacteria 1729
105 Ga0466704_132280 3300042643 Bacteria 33822
106 Ga0466725_127442 3300042654 Bacteria 7081
107 Ga0466725_375239 3300042654 Bacteria 27664
108 Ga0466701_018022 3300042598 Bacteria 1893
109 Ga0466707_209029 3300042601 Bacteria 4552
110 Ga0466707_293290 3300042601 Bacteria 6686
111 Ga0466716_346187 3300042605 Bacteria 2974
112 Ga0466719_116381 3300042606 Bacteria 6101
113 Ga0466719_546594 3300042606 Bacteria 14451
114 Ga0068305_10272096 3300005083 Bacteria 1320
115 Ga0072941_1029212 3300005201 Bacteria 3469
116 Ga0160452_100138 3300012834 Bacteria 89167
117 Ga0466692_032468 3300042591 Bacteria 5269
118 Ga0466692_190209 3300042591 Bacteria 13472
119 Ga0466695_287312 3300042595 Bacteria 4958
120 Ga0466710_095007 3300042613 Bacteria 4314
121 Ga0466715_355522 3300042616 Bacteria 36627
122 Ga0466729_053950 3300042621 Bacteria 6335
123 Ga0123353_10162492 3300010167 Bacteria 3554
124 Ga0160466_102546 3300012809 Bacteria 3520
125 Ga0466708_397330 3300042652 Bacteria 3215
126 Ga0466727_195436 3300042655 Bacteria 5829
127 Ga0466706_206485 3300042599 Bacteria 5606
128 Ga0466700_062728 3300042600 Bacteria 2041
129 Ga0466707_073003 3300042601 Bacteria 1602
130 Ga0466717_230984 3300042604 Bacteria 7136
131 Ga0466716_040701 3300042605 Bacteria 7384
132 Ga0466722_154034 3300042609 Bacteria 3068
133 Ga0466722_261346 3300042609 Bacteria 18889
134 JGI24702J35022_10030939 3300002462 Bacteria 2870
135 Ga0160459_100048 3300012831 Bacteria 189455
136 Ga0466692_167406 3300042591 Bacteria 107532
137 Ga0466733_208575 3300042659 Bacteria 5904
138 Ga0466715_144729 3300042616 Bacteria 1378
139 Ga0123353_10000514 3300010167 Bacteria 47868
140 Ga0123354_10011126 3300010882 Bacteria 13885
141 Ga0123354_10046483 3300010882 Bacteria 6630
142 Ga0466703_320420 3300042636 Bacteria 23900
143 Ga0466703_431331 3300042636 Unclassified 4185
144 Ga0466709_408176 3300042648 Bacteria 55853
145 Ga0466708_039324 3300042652 Bacteria 18031
146 Ga0466708_400330 3300042652 Bacteria 6857
147 Ga0466725_003617 3300042654 Bacteria 5537
148 Ga0466725_195637 3300042654 Bacteria 58825
149 Ga0466717_045276 3300042604 Bacteria 2180
150 Ga0466717_302216 3300042604 Bacteria 6416
151 Ga0466722_037049 3300042609 Bacteria 7525
152 Ga0466722_179047 3300042609 Bacteria 2000
153 JGI24696J40584_12936920 3300002834 Unclassified 1591
154 Ga0068302_10156433 3300005071 Bacteria 3071
155 Ga0072941_1029213 3300005201 Unclassified 6848
156 Ga0123357_10001248 3300009784 Bacteria 26720
157 Ga0160430_101264 3300012852 Unclassified 9819
158 Ga0466657_160367 3300042582 Bacteria 1702
159 Ga0466690_210430 3300042590 Bacteria 39724
160 Ga0466694_407445 3300042594 Bacteria 4439
161 Ga0466710_249192 3300042613 Bacteria 63183
162 Ga0466715_036071 3300042616 Bacteria 24043
163 Ga0466729_016426 3300042621 Bacteria 23520
164 Ga0123356_10005504 3300010049 Bacteria 12887
165 Ga0466704_305396 3300042643 Bacteria 13952
166 Ga0466727_179157 3300042655 Bacteria 29827
167 Ga0466701_057210 3300042598 Bacteria 6983
168 Ga0466719_145905 3300042606 Bacteria 12080

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042598 Ga0466701_000899 Ga0466701_000899_3660_4613 317
2 3300042636 Ga0466703_313613 Ga0466703_313613_760_1752 330
3 3300042636 Ga0466703_431331 Ga0466703_431331_3163_4155 330
4 3300005201 Ga0072941_1029213 Ga0072941_10292132 351
5 3300042600 Ga0466700_062728 Ga0466700_062728_837_1946 369
6 3300042618 Ga0466723_161728 Ga0466723_161728_4810_5919 369
7 3300002462 JGI24702J35022_10000628 JGI24702J35022_1000062824 370
8 3300002462 JGI24702J35022_10030939 JGI24702J35022_100309391 370
9 3300010167 Ga0123353_10000514 Ga0123353_1000051420 373
10 3300042609 Ga0466722_154034 Ga0466722_154034_1241_2410 373
11 3300042614 Ga0466712_063124 Ga0466712_063124_115_1281 374
12 3300042590 Ga0466690_210430 Ga0466690_210430_2690_3817 375
13 iso_pr_bacteria 2820123897 2820124836 377
14 iso_pr_bacteria 2891720358 2891723340 377
15 3300009784 Ga0123357_10000009 Ga0123357_1000000966 378
16 3300042582 Ga0466657_004786 Ga0466657_004786_4007_5143 378
17 3300042582 Ga0466657_120452 Ga0466657_120452_142_1278 378
18 3300042582 Ga0466657_160367 Ga0466657_160367_328_1464 378
19 3300042582 Ga0466657_248399 Ga0466657_248399_5966_7102 378
20 3300042582 Ga0466657_272357 Ga0466657_272357_10957_12093 378
21 3300042582 Ga0466657_296952 Ga0466657_296952_3482_4618 378
22 3300042590 Ga0466690_099297 Ga0466690_099297_3737_4873 378
23 3300042591 Ga0466692_032468 Ga0466692_032468_28_1164 378
24 3300042591 Ga0466692_124694 Ga0466692_124694_2296_3432 378
25 3300042592 Ga0466693_084945 Ga0466693_084945_523_1659 378
26 3300042593 Ga0466691_032545 Ga0466691_032545_3600_4736 378
27 3300042594 Ga0466694_407445 Ga0466694_407445_595_1731 378
28 3300042595 Ga0466695_055939 Ga0466695_055939_7325_8461 378
29 3300042595 Ga0466695_287312 Ga0466695_287312_2916_4052 378
30 3300042598 Ga0466701_018022 Ga0466701_018022_514_1650 378
31 3300042598 Ga0466701_027330 Ga0466701_027330_20637_21773 378
32 3300042598 Ga0466701_057210 Ga0466701_057210_2911_4047 378
33 3300042601 Ga0466707_175155 Ga0466707_175155_16294_17430 378
34 3300042601 Ga0466707_209029 Ga0466707_209029_2941_4077 378
35 3300042601 Ga0466707_237624 Ga0466707_237624_2370_3506 378
36 3300042601 Ga0466707_293290 Ga0466707_293290_3077_4213 378
37 3300042602 Ga0466713_026884 Ga0466713_026884_61929_63065 378
38 3300042604 Ga0466717_045276 Ga0466717_045276_931_2067 378
39 3300042604 Ga0466717_102427 Ga0466717_102427_4586_5722 378
40 3300042604 Ga0466717_230984 Ga0466717_230984_2933_4069 378
41 3300042605 Ga0466716_040701 Ga0466716_040701_6050_7186 378
42 3300042606 Ga0466719_116381 Ga0466719_116381_2130_3266 378
43 3300042606 Ga0466719_546594 Ga0466719_546594_10624_11760 378
44 3300042609 Ga0466722_037049 Ga0466722_037049_5176_6312 378
45 3300042609 Ga0466722_094205 Ga0466722_094205_1487_2623 378
46 3300042609 Ga0466722_120794 Ga0466722_120794_574_1710 378
47 3300042609 Ga0466722_179047 Ga0466722_179047_275_1411 378
48 3300042609 Ga0466722_261346 Ga0466722_261346_7106_8242 378
49 3300042611 Ga0466697_030720 Ga0466697_030720_2189_3325 378
50 3300042611 Ga0466697_122255 Ga0466697_122255_2291_3427 378
51 3300042612 Ga0466705_084923 Ga0466705_084923_4240_5376 378
52 3300042612 Ga0466705_105450 Ga0466705_105450_9138_10274 378
53 3300042613 Ga0466710_029876 Ga0466710_029876_2434_3570 378
54 3300042613 Ga0466710_075596 Ga0466710_075596_2610_3746 378
55 3300042613 Ga0466710_095007 Ga0466710_095007_1093_2229 378
56 3300042613 Ga0466710_146058 Ga0466710_146058_9487_10623 378
57 3300042613 Ga0466710_249192 Ga0466710_249192_53056_54192 378
58 3300042615 Ga0466711_118320 Ga0466711_118320_1439_2575 378
59 3300042616 Ga0466715_144729 Ga0466715_144729_32_1168 378
60 3300042619 Ga0466726_248809 Ga0466726_248809_7557_8693 378
61 3300042620 Ga0466728_392551 Ga0466728_392551_3522_4658 378
62 3300042621 Ga0466729_053950 Ga0466729_053950_4832_5968 378
63 3300042621 Ga0466729_229351 Ga0466729_229351_523_1659 378
64 3300042621 Ga0466729_285013 Ga0466729_285013_1499_2635 378
65 3300042622 Ga0466731_322894 Ga0466731_322894_156_1292 378
66 3300042623 Ga0466734_010816 Ga0466734_010816_981_2117 378
67 3300042623 Ga0466734_080560 Ga0466734_080560_9874_11010 378
68 3300042623 Ga0466734_103526 Ga0466734_103526_16447_17583 378
69 3300042623 Ga0466734_141953 Ga0466734_141953_699_1835 378
70 3300042624 Ga0466735_028014 Ga0466735_028014_824_1960 378
71 3300042625 Ga0466730_008869 Ga0466730_008869_94804_95940 378
72 3300042625 Ga0466730_086547 Ga0466730_086547_287211_288347 378
73 3300042636 Ga0466703_006343 Ga0466703_006343_310_1446 378
74 3300042636 Ga0466703_011291 Ga0466703_011291_21480_22616 378
75 3300042636 Ga0466703_164149 Ga0466703_164149_891_2027 378
76 3300042636 Ga0466703_341173 Ga0466703_341173_1114_2250 378
77 3300042643 Ga0466704_132280 Ga0466704_132280_6014_7150 378
78 3300042648 Ga0466709_149723 Ga0466709_149723_5947_7083 378
79 3300042648 Ga0466709_369313 Ga0466709_369313_130_1266 378
80 3300042648 Ga0466709_408176 Ga0466709_408176_49974_51110 378
81 3300042649 Ga0466724_26857 Ga0466724_26857_79669_80805 378
82 3300042649 Ga0466724_27476 Ga0466724_27476_203851_204987 378
83 3300042652 Ga0466708_077242 Ga0466708_077242_6389_7525 378
84 3300042652 Ga0466708_158547 Ga0466708_158547_3936_5072 378
85 3300042654 Ga0466725_128406 Ga0466725_128406_2915_4051 378
86 3300042654 Ga0466725_375239 Ga0466725_375239_22325_23461 378
87 3300042654 Ga0466725_409024 Ga0466725_409024_20762_21898 378
88 3300042655 Ga0466727_179157 Ga0466727_179157_9684_10820 378
89 3300042659 Ga0466733_178438 Ga0466733_178438_1022_2158 378
90 iso_pr_bacteria 2820042117 2820042865 378
91 iso_pr_bacteria 2820059968 2820062600 378
92 iso_pr_bacteria 2820062699 2820063282 378
93 iso_pr_bacteria 2820065746 2820067257 378
94 iso_pr_bacteria 2820084079 2820085697 378
95 iso_pr_bacteria 2820086750 2820088210 378
96 iso_pr_bacteria 2820089333 2820090608 378
97 iso_pr_bacteria 2820103659 2820104665 378
98 iso_pr_bacteria 2820121232 2820122560 378
99 iso_pr_bacteria 2820131053 2820131157 378
100 iso_pr_bacteria 2820152154 2820152384 378
101 iso_pr_bacteria 2864755708 2864759879 378
102 iso_pr_bacteria 2864808494 2864810285 378
103 iso_pr_bacteria 2864812326 2864814118 378
104 iso_pr_bacteria 2864826666 2864830305 378
105 iso_pr_bacteria 2864859030 2864860024 378
106 iso_pr_bacteria 2864870719 2864874122 378
107 iso_pr_bacteria 2864914039 2864914941 378
108 iso_pr_bacteria 2864937364 2864940888 378
109 iso_pr_bacteria 2864960361 2864963773 378
110 iso_pr_bacteria 2864968865 2864972134 378
111 iso_pr_bacteria 2864988360 2864989262 378
112 iso_pr_bacteria 2868169047 2868170765 378
113 iso_pr_bacteria 2873565274 2873569423 378
114 iso_pr_bacteria 2873571580 2873573310 378
115 iso_pr_bacteria 8100449422 8100449645 378
116 iso_pr_bacteria 8100455565 8100455818 378
117 iso_pr_bacteria 8100461708 8100467784 378
118 3300002504 JGI24705J35276_12234579 JGI24705J35276_122345797 379
119 3300002504 JGI24705J35276_12238748 JGI24705J35276_122387485 379
120 3300002834 JGI24696J40584_12936920 JGI24696J40584_129369201 379
121 3300005071 Ga0068302_10156433 Ga0068302_101564332 379
122 3300005083 Ga0068305_10272096 Ga0068305_102720961 379
123 3300009784 Ga0123357_10000446 Ga0123357_100004467 379
124 3300009784 Ga0123357_10001248 Ga0123357_100012484 379
125 3300010049 Ga0123356_10005504 Ga0123356_100055045 379
126 3300010049 Ga0123356_10013546 Ga0123356_100135465 379
127 3300010167 Ga0123353_10162492 Ga0123353_101624923 379
128 3300010882 Ga0123354_10011126 Ga0123354_100111264 379
129 3300010882 Ga0123354_10046483 Ga0123354_100464836 379
130 3300010882 Ga0123354_10104192 Ga0123354_101041922 379
131 3300012809 Ga0160466_102546 Ga0160466_1025462 379
132 3300012819 Ga0160468_100534 Ga0160468_1005349 379
133 3300012831 Ga0160459_100048 Ga0160459_10004828 379
134 3300012834 Ga0160452_100138 Ga0160452_10013844 379
135 3300012839 Ga0160472_101561 Ga0160472_1015611 379
136 3300012839 Ga0160472_103641 Ga0160472_1036413 379
137 3300012849 Ga0160447_107668 Ga0160447_1076683 379
138 3300012852 Ga0160430_101264 Ga0160430_1012647 379
139 3300042643 Ga0466704_305396 Ga0466704_305396_5484_6623 379
140 3300042652 Ga0466708_138327 Ga0466708_138327_9569_10738 379
141 3300042654 Ga0466725_195637 Ga0466725_195637_24055_25194 379
142 3300042659 Ga0466733_208575 Ga0466733_208575_163_1302 379
143 3300042582 Ga0466657_227720 Ga0466657_227720_2449_3591 380
144 3300042596 Ga0466696_016270 Ga0466696_016270_1268_2410 380
145 3300042616 Ga0466715_036071 Ga0466715_036071_16505_17647 380
146 3300042655 Ga0466727_195436 Ga0466727_195436_500_1645 381
147 3300042654 Ga0466725_003617 Ga0466725_003617_1126_2274 382
148 iso_pr_bacteria 2571042003 2571062234 383
149 3300012837 Ga0160455_100051 Ga0160455_100051178 385
150 3300042605 Ga0466716_346187 Ga0466716_346187_1544_2701 385
151 3300042656 Ga0466732_094350 Ga0466732_094350_1434_2591 385
152 3300042582 Ga0466657_097439 Ga0466657_097439_23929_25089 386
153 3300042611 Ga0466697_053404 Ga0466697_053404_351_1514 387
154 3300042615 Ga0466711_384001 Ga0466711_384001_5877_7040 387
155 3300042619 Ga0466726_053798 Ga0466726_053798_3646_4809 387
156 iso_pr_bacteria 2820047982 2820049528 387
157 iso_pr_bacteria 2820050117 2820050373 387
158 3300042591 Ga0466692_167406 Ga0466692_167406_31192_32358 388
159 3300042601 Ga0466707_364354 Ga0466707_364354_106_1272 388
160 3300042606 Ga0466719_052539 Ga0466719_052539_7896_9062 388
161 3300042606 Ga0466719_489382 Ga0466719_489382_236_1402 388
162 3300042606 Ga0466719_558241 Ga0466719_558241_236_1402 388
163 3300042614 Ga0466712_041405 Ga0466712_041405_1074_2240 388
164 3300042615 Ga0466711_501732 Ga0466711_501732_1865_3031 388
165 3300042621 Ga0466729_016426 Ga0466729_016426_13198_14364 388
166 3300042652 Ga0466708_092921 Ga0466708_092921_7318_8484 388
167 3300042652 Ga0466708_212407 Ga0466708_212407_14966_16132 388
168 3300042652 Ga0466708_400330 Ga0466708_400330_4019_5185 388
169 3300005201 Ga0072941_1029212 Ga0072941_10292122 389
170 3300042598 Ga0466701_039976 Ga0466701_039976_10533_11702 389
171 3300042601 Ga0466707_073003 Ga0466707_073003_97_1266 389
172 3300042652 Ga0466708_397330 Ga0466708_397330_382_1554 390
173 3300042590 Ga0466690_012085 Ga0466690_012085_6225_7400 391
174 3300042593 Ga0466691_023612 Ga0466691_023612_5487_6662 391
175 3300042606 Ga0466719_145905 Ga0466719_145905_6750_7925 391
176 3300042616 Ga0466715_340002 Ga0466715_340002_3712_4887 391
177 3300042618 Ga0466723_100869 Ga0466723_100869_16657_17832 391
178 3300042620 Ga0466728_134467 Ga0466728_134467_15437_16612 391
179 3300042636 Ga0466703_320420 Ga0466703_320420_1110_2288 392
180 3300042598 Ga0466701_004422 Ga0466701_004422_9263_10447 394
181 3300042598 Ga0466701_029854 Ga0466701_029854_1607_2791 394
182 3300042604 Ga0466717_302216 Ga0466717_302216_3256_4440 394
183 3300042623 Ga0466734_081323 Ga0466734_081323_1193_2377 394
184 3300042654 Ga0466725_127442 Ga0466725_127442_2414_3598 394
185 iso_pr_bacteria 2820157249 2820159377 394
186 iso_pr_bacteria 2820161938 2820161956 394
187 iso_pr_bacteria 2820164216 2820166250 394
188 3300042582 Ga0466657_287738 Ga0466657_287738_23107_24297 396
189 3300042613 Ga0466710_091764 Ga0466710_091764_2040_3230 396
190 3300042616 Ga0466715_249410 Ga0466715_249410_12508_13698 396
191 3300042611 Ga0466697_255061 Ga0466697_255061_704_1897 397
192 3300042599 Ga0466706_206485 Ga0466706_206485_3875_5071 398
193 iso_pr_bacteria 2820077244 2820077270 398
194 3300009784 Ga0123357_10094547 Ga0123357_100945474 399
195 3300010882 Ga0123354_10000002 Ga0123354_1000000226 399
196 3300042606 Ga0466719_185332 Ga0466719_185332_119_1336 405
197 3300042606 Ga0466719_449246 Ga0466719_449246_527_1744 405
198 3300042616 Ga0466715_355522 Ga0466715_355522_20262_21482 406
199 3300042652 Ga0466708_039324 Ga0466708_039324_9809_11032 407
200 3300007080 Ga0102735_1000123 Ga0102735_10001234 414
201 3300007188 Ga0103264_1000228 Ga0103264_100022865 414
202 3300007190 Ga0103267_1001501 Ga0103267_10015015 414
203 3300007192 Ga0103268_1004392 Ga0103268_10043922 414
204 3300007129 Ga0102734_1003772 Ga0102734_10037723 416
205 3300042591 Ga0466692_190209 Ga0466692_190209_2855_4117 420

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00437 T2SSE Type II/IV secretion system protein 71 269 0.83

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.77 0.84 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.