Protein Family IF01668
Metagenome
Isolate
253
Members
139
Samples
194
Scaffolds
115.66
Avg Length
Representative Sequence
- ID
- 3300007095|Ga0102739_1033217|Ga0102739_10332172
- Length
- 127 aa
- Sequence
- METILALAIGALTGSGVWLLLRPRTFQVIMGLSLLSYAVNLFIFSMGRLGLEVNKEPVLTPGVPQDLLHYADPLPQALVLTAIVISFAMTALFLVVLLASRGSASTDHVDGLLAKEMQNKEMQELS*
Sample Types
Isolate
23.3%
Metagenome
76.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Formicidae
17.1%
Termitidae
14.7%
Unclassified
11.6%
Curculionidae
10.1%
Apidae
10.1%
Elmidae
9.3%
Armadillidiidae
7.8%
Culicidae
6.2%
Drosophilidae
3.1%
Kalotermitidae
1.6%
Hydrophilidae
1.6%
Rhinotermitidae
0.8%
Daphniidae
0.8%
Tenebrionidae
0.8%
Passalidae
0.8%
Crambidae
0.8%
Termopsidae
0.8%
Muscidae
0.8%
Siricidae
0.8%
Cerambycidae
0.8%
Taxonomy
Archaea
0
Bacteria
211
Eukaryota
0
Viruses
0
Unclassified
42
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2864870719 | Comamonas odontotermitis S00124 | Isolate | Elmidae |
| 2 | 2864937364 | Acidovorax soli S00198 | Isolate | Elmidae |
| 3 | 2891720358 | Azoarcus nasutitermitis CC-YHH838 | Isolate | Unclassified |
| 4 | 2963630348 | Burkholderiales bacterium 3487_49 | Isolate | Formicidae |
| 5 | 2032320009 | Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine | Metagenome | Curculionidae |
| 6 | 2820086750 | Unclassified Proteobacteria Lab288P3bin98 | Isolate | Unclassified |
| 7 | 2820132692 | Unclassified Proteobacteria Emb289P3bin76 | Isolate | Unclassified |
| 8 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 9 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 10 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 11 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 12 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 13 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 14 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 15 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 16 | 8073624232 | Bartonella sp. W8151 | Isolate | Apidae |
| 17 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 18 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 19 | 2864755708 | Massilia timonae S00006 | Isolate | Elmidae |
| 20 | 2864951976 | Brevundimonas bullata S00223 | Isolate | Elmidae |
| 21 | 2519899622 | Pseudomonas sp. Ag1 | Isolate | Culicidae |
| 22 | 2751185856 | Bartonella apis BBC0244 | Isolate | Apidae |
| 23 | 2820084079 | Unclassified Proteobacteria Lab288P4bin103 | Isolate | Unclassified |
| 24 | 2820115951 | Unclassified Proteobacteria Emb289P4bin33 | Isolate | Unclassified |
| 25 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 26 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 27 | 8011329375 | Pseudomonas sp. S31 | Isolate | Curculionidae |
| 28 | 8073617375 | Bartonella apis W8098 | Isolate | Apidae |
| 29 | 8100455565 | Delftia sp. S67 | Isolate | Curculionidae |
| 30 | 3007473699 | Pseudomonas sp. S30 | Isolate | Curculionidae |
| 31 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 32 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 33 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 34 | 2687453753 | Burkholderiales bacterium B_Cag25 | Isolate | Unclassified |
| 35 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 36 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 37 | 8073626464 | Bartonella apis W8152 | Isolate | Apidae |
| 38 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 39 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 40 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 41 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 42 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 43 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 44 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 45 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 46 | 2864739902 | Pseudomonas viridiflavia S00001 | Isolate | Elmidae |
| 47 | 2864826666 | Acidovorax konjaci S00067 | Isolate | Elmidae |
| 48 | 2864853652 | Pseudomonas rhodesiae S00114 | Isolate | Elmidae |
| 49 | 2873571580 | Diaphorobacter sp. HDW4B | Isolate | Hydrophilidae |
| 50 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 51 | 2556921669 | Shinella sp. DD12 | Isolate | Daphniidae |
| 52 | 2820059968 | Unclassified Proteobacteria Nt197P4bin23 | Isolate | Unclassified |
| 53 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 54 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 55 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 56 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 57 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 58 | 8068946563 | Bartonella apihabitans M0187 | Isolate | Apidae |
| 59 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 60 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 61 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 62 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 63 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 64 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 65 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 66 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 67 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 68 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 69 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 70 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 71 | 2855798354 | Achromobacter insolitus AR476-2 | Isolate | Crambidae |
| 72 | 2864934081 | Brevundimonas vesicularis S00192 | Isolate | Elmidae |
| 73 | 2820152154 | Unclassified Proteobacteria Cu122P5bin47 | Isolate | Unclassified |
| 74 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 75 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 76 | 8035422605 | Pseudomonas monteilii CY06 | Isolate | |
| 77 | 8067483258 | Ochrobactrum soli MTP-C0764 | Isolate | Muscidae |
| 78 | 8068950955 | Bartonella apihabitans W8097 | Isolate | Apidae |
| 79 | 8073621894 | Bartonella apis W8099 | Isolate | Apidae |
| 80 | 8100449422 | Delftia sp. S66 | Isolate | Curculionidae |
| 81 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 82 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 83 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 84 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 85 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 86 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 87 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 88 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 89 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 90 | 2873565274 | Diaphorobacter sp. HDW4A | Isolate | Hydrophilidae |
| 91 | 2886876212 | Tokpelaia sp. RhiAcro1 | Isolate | Formicidae |
| 92 | 2518285616 | Brachymonas chironomi DSM 19884 | Isolate | Unclassified |
| 93 | 2603880165 | Burkholderiales A1 | Isolate | Unclassified |
| 94 | 2603880170 | Burkholderiales A2 | Isolate | Unclassified |
| 95 | 2695420964 | Hyphomicrobiales bacterium JR021 | Isolate | Unclassified |
| 96 | 2751185858 | Bartonella apis BBC0122 | Isolate | Apidae |
| 97 | 637000219 | Pseudomonas entomophila L48 | Isolate | Unclassified |
| 98 | 8035326735 | Pseudomonas prosekii A2-NA13 | Isolate | Curculionidae |
| 99 | 8073619611 | Bartonella apis B10834G6 | Isolate | Apidae |
| 100 | 2990166910 | Pseudomonas typographi CA3A | Isolate | Curculionidae |
| 101 | 3007478678 | Pseudomonas sp. S37 | Isolate | Curculionidae |
| 102 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 103 | 3300007058 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 3 gut | Metagenome | Drosophilidae |
| 104 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 105 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 106 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 107 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 108 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 109 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 110 | 2864866972 | Brevundimonas bullata S00123 | Isolate | Elmidae |
| 111 | 2864960361 | Comamonas odontotermitis S00229 | Isolate | Elmidae |
| 112 | 2868169047 | Comamonas aquatica S00077 | Isolate | Elmidae |
| 113 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 114 | 2687453742 | Burkholderiales bacterium B_Cag20 | Isolate | Unclassified |
| 115 | 8035321120 | Pseudomonas prosekii A2-NA12 | Isolate | Curculionidae |
| 116 | 8068944069 | Bartonella choladocola W8125 | Isolate | Apidae |
| 117 | 8068955631 | Bartonella apihabitans M0280 | Isolate | Apidae |
| 118 | 8073628750 | Bartonella sp. W8167 | Isolate | Apidae |
| 119 | 8100461708 | Delftia sp. S65 | Isolate | Curculionidae |
| 120 | 2997878596 | Pseudomonas bohemica IA9 | Isolate | Unclassified |
| 121 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 122 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 123 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 124 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 125 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 126 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 127 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 128 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 129 | 2864745180 | Pseudomonas rhodesiae S00002 | Isolate | Elmidae |
| 130 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 131 | 2084038013 | Anoplophora glabripennis gut microbial communities from Worchester, Massachusetts, USA - Larvae | Metagenome | Cerambycidae |
| 132 | 8052469819 | Pseudomonas putida DZ-F23 | Isolate | |
| 133 | 8068953321 | Bartonella apihabitans M0190 | Isolate | Apidae |
| 134 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 135 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 136 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 137 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 138 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 139 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466710_028412 | 3300042613 | Bacteria | 1010 |
| 2 | Ga0466711_186823 | 3300042615 | Bacteria | 11166 |
| 3 | Ga0160455_100022 | 3300012837 | Bacteria | 376035 |
| 4 | Ga0160447_127004 | 3300012849 | Bacteria | 811 |
| 5 | Ga0160434_122061 | 3300012850 | Bacteria | 959 |
| 6 | Ga0160435_1001674 | 3300012857 | Bacteria | 5569 |
| 7 | Ga0466657_012042 | 3300042582 | Bacteria | 3162 |
| 8 | Ga0466657_019412 | 3300042582 | Bacteria | 14166 |
| 9 | Ga0466693_172984 | 3300042592 | Bacteria | 7146 |
| 10 | Ga0466731_309196 | 3300042622 | Bacteria | 1301 |
| 11 | Ga0466735_102733 | 3300042624 | Bacteria | 3110 |
| 12 | Ga0466724_19173 | 3300042649 | Unclassified | 21058 |
| 13 | Ga0466724_27172 | 3300042649 | Bacteria | 94035 |
| 14 | Ga0466725_223871 | 3300042654 | Bacteria | 60893 |
| 15 | Ga0123354_10002616 | 3300010882 | Bacteria | 24034 |
| 16 | Ga0123354_10047003 | 3300010882 | Bacteria | 6585 |
| 17 | Ga0123354_10465188 | 3300010882 | Bacteria | 1012 |
| 18 | Ga0160471_100637 | 3300012812 | Bacteria | 8937 |
| 19 | CVPL010W_10000511 | 3300002931 | Bacteria | 41376 |
| 20 | CVPL010W_10001186 | 3300002931 | Bacteria | 30092 |
| 21 | CVPL005L_10007960 | 3300002938 | Bacteria | 9760 |
| 22 | Ga0072941_1296909 | 3300005201 | Bacteria | 3351 |
| 23 | Ga0103263_113809 | 3300007042 | Bacteria | 798 |
| 24 | Ga0104041_1001369 | 3300007106 | Unclassified | 1940 |
| 25 | Ga0102734_1001441 | 3300007129 | Unclassified | 12218 |
| 26 | Ga0103260_1054016 | 3300007139 | Unclassified | 639 |
| 27 | Ga0102738_1000183 | 3300007141 | Unclassified | 14517 |
| 28 | Ga0102738_1006625 | 3300007141 | Bacteria | 1608 |
| 29 | Ga0160458_100786 | 3300012832 | Bacteria | 9491 |
| 30 | Ga0160445_125715 | 3300012847 | Bacteria | 747 |
| 31 | Ga0466657_071349 | 3300042582 | Bacteria | 5536 |
| 32 | Ga0466657_126576 | 3300042582 | Bacteria | 42058 |
| 33 | Ga0466734_001182 | 3300042623 | Bacteria | 11651 |
| 34 | Ga0123353_12218810 | 3300010167 | Bacteria | 663 |
| 35 | Ga0160465_100284 | 3300012803 | Unclassified | 33182 |
| 36 | Ga0466701_022302 | 3300042598 | Bacteria | 5471 |
| 37 | Ga0466721_302031 | 3300042608 | Bacteria | 1832 |
| 38 | SPBB_contig11515 | 2044078006 | Bacteria | 94151 |
| 39 | CVPL010W_10000567 | 3300002931 | Bacteria | 40167 |
| 40 | CVPL010W_10013944 | 3300002931 | Bacteria | 5998 |
| 41 | CVPL005W_1000534 | 3300002934 | Bacteria | 14442 |
| 42 | CVPL005L_10009105 | 3300002938 | Bacteria | 8669 |
| 43 | CVPL005L_10015093 | 3300002938 | Bacteria | 5060 |
| 44 | Ga0103266_1000027 | 3300007067 | Bacteria | 79635 |
| 45 | Ga0103266_1000130 | 3300007067 | Bacteria | 53434 |
| 46 | Ga0102735_1000399 | 3300007080 | Bacteria | 9560 |
| 47 | Ga0102739_1002262 | 3300007095 | Bacteria | 3004 |
| 48 | Ga0103260_1006497 | 3300007139 | Bacteria | 1682 |
| 49 | Ga0102737_1000815 | 3300007142 | Unclassified | 9629 |
| 50 | Ga0102737_1001219 | 3300007142 | Unclassified | 7450 |
| 51 | Ga0103264_1008318 | 3300007188 | Bacteria | 6876 |
| 52 | Ga0530661_009695 | 3300056564 | Bacteria | 2690 |
| 53 | Ga0466710_163569 | 3300042613 | Bacteria | 6216 |
| 54 | Ga0160453_104097 | 3300012814 | Unclassified | 2783 |
| 55 | Ga0160455_100186 | 3300012837 | Bacteria | 59790 |
| 56 | Ga0160444_100025 | 3300012841 | Bacteria | 261087 |
| 57 | Ga0160433_100129 | 3300012846 | Bacteria | 68423 |
| 58 | Ga0160433_110771 | 3300012846 | Bacteria | 1177 |
| 59 | Ga0160430_107839 | 3300012852 | Unclassified | 2090 |
| 60 | Ga0316159_10498 | 3300030930 | Bacteria | 6096 |
| 61 | Ga0466656_157105 | 3300042550 | Bacteria | 4022 |
| 62 | Ga0466657_156250 | 3300042582 | Bacteria | 1615 |
| 63 | Ga0466730_065228 | 3300042625 | Bacteria | 49177 |
| 64 | Ga0466708_326556 | 3300042652 | Bacteria | 7059 |
| 65 | Ga0466725_069605 | 3300042654 | Bacteria | 43013 |
| 66 | DPO_contig08883 | 2032320009 | Unclassified | 17958 |
| 67 | SPBB_contig10643 | 2044078006 | Unclassified | 25513 |
| 68 | IMNBGM34_c000005 | 3300000036 | Bacteria | 68435 |
| 69 | CVPL010W_10000717 | 3300002931 | Bacteria | 36884 |
| 70 | CVPL010W_10013507 | 3300002931 | Unclassified | 6209 |
| 71 | Ga0102736_1002339 | 3300007052 | Unclassified | 3015 |
| 72 | Ga0102734_1003886 | 3300007129 | Bacteria | 3375 |
| 73 | Ga0102740_1089881 | 3300007140 | Bacteria | 509 |
| 74 | Ga0102737_1002389 | 3300007142 | Bacteria | 4675 |
| 75 | Ga0103264_1039287 | 3300007188 | Unclassified | 2040 |
| 76 | Ga0105005_1004168 | 3300007505 | Bacteria | 3363 |
| 77 | Ga0160456_100157 | 3300012820 | Bacteria | 55053 |
| 78 | Ga0160469_102836 | 3300012824 | Unclassified | 2838 |
| 79 | Ga0160469_115526 | 3300012824 | Bacteria | 612 |
| 80 | Ga0160458_100067 | 3300012832 | Bacteria | 134183 |
| 81 | Ga0160430_104097 | 3300012852 | Bacteria | 3760 |
| 82 | Ga0160457_1004110 | 3300012858 | Bacteria | 2392 |
| 83 | Ga0466701_008332 | 3300042598 | Bacteria | 48418 |
| 84 | Ga0466731_169781 | 3300042622 | Bacteria | 5163 |
| 85 | Ga0466734_135486 | 3300042623 | Bacteria | 1371 |
| 86 | Ga0466725_201645 | 3300042654 | Bacteria | 6974 |
| 87 | Ga0123357_10490354 | 3300009784 | Bacteria | 1030 |
| 88 | Ga0160465_100300 | 3300012803 | Bacteria | 30563 |
| 89 | Ga0466717_220725 | 3300042604 | Bacteria | 3800 |
| 90 | AglaG_contig17072 | 2084038013 | Bacteria | 607 |
| 91 | JGI24696J40584_12804509 | 3300002834 | Bacteria | 876 |
| 92 | CVPL010W_10032503 | 3300002931 | Bacteria | 1961 |
| 93 | Ga0102736_1030911 | 3300007052 | Unclassified | 638 |
| 94 | Ga0103260_1021573 | 3300007139 | Bacteria | 931 |
| 95 | Ga0102740_1001714 | 3300007140 | Unclassified | 5379 |
| 96 | Ga0102738_1015474 | 3300007141 | Unclassified | 1064 |
| 97 | Ga0103264_1000013 | 3300007188 | Bacteria | 122810 |
| 98 | Ga0103264_1000093 | 3300007188 | Bacteria | 53426 |
| 99 | Ga0103264_1000178 | 3300007188 | Bacteria | 55971 |
| 100 | Ga0103267_1001017 | 3300007190 | Bacteria | 7033 |
| 101 | Ga0103267_1003555 | 3300007190 | Bacteria | 4159 |
| 102 | Ga0103268_1000019 | 3300007192 | Bacteria | 53229 |
| 103 | Ga0466710_010065 | 3300042613 | Bacteria | 8773 |
| 104 | Ga0466710_350237 | 3300042613 | Bacteria | 1260 |
| 105 | Ga0160440_100002 | 3300012815 | Bacteria | 1234951 |
| 106 | Ga0160456_113325 | 3300012820 | Bacteria | 809 |
| 107 | Ga0160441_100600 | 3300012825 | Unclassified | 22924 |
| 108 | Ga0160467_110815 | 3300012829 | Unclassified | 817 |
| 109 | Ga0160455_100462 | 3300012837 | Bacteria | 21001 |
| 110 | Ga0160433_100002 | 3300012846 | Bacteria | 625007 |
| 111 | Ga0160443_112939 | 3300012848 | Bacteria | 926 |
| 112 | Ga0160436_1010818 | 3300012861 | Unclassified | 1974 |
| 113 | Ga0466657_324574 | 3300042582 | Bacteria | 1509 |
| 114 | Ga0466725_037058 | 3300042654 | Bacteria | 7792 |
| 115 | Ga0123353_10000324 | 3300010167 | Bacteria | 59051 |
| 116 | Ga0466701_084758 | 3300042598 | Bacteria | 7117 |
| 117 | SPBB_contig05890 | 2044078006 | Bacteria | 610 |
| 118 | SWWA_contig21375__length_683___numreads_9 | 2100351016 | Unclassified | 683 |
| 119 | CVPL005L_10003670 | 3300002938 | Bacteria | 16925 |
| 120 | Ga0104043_1094593 | 3300007058 | Bacteria | 1057 |
| 121 | Ga0103265_1013196 | 3300007068 | Unclassified | 1077 |
| 122 | Ga0102737_1003091 | 3300007142 | Unclassified | 3915 |
| 123 | Ga0103264_1000470 | 3300007188 | Bacteria | 20696 |
| 124 | Ga0103264_1000711 | 3300007188 | Bacteria | 35563 |
| 125 | Ga0103264_1000965 | 3300007188 | Bacteria | 23551 |
| 126 | Ga0103264_1001153 | 3300007188 | Bacteria | 11704 |
| 127 | Ga0103268_1016191 | 3300007192 | Unclassified | 1632 |
| 128 | Ga0466697_195088 | 3300042611 | Unclassified | 2733 |
| 129 | Ga0160469_107708 | 3300012824 | Unclassified | 1012 |
| 130 | Ga0160431_100371 | 3300012828 | Bacteria | 22792 |
| 131 | Ga0160472_100149 | 3300012839 | Bacteria | 102886 |
| 132 | Ga0466695_208590 | 3300042595 | Bacteria | 4554 |
| 133 | Ga0466734_021773 | 3300042623 | Bacteria | 1829 |
| 134 | Ga0466734_027408 | 3300042623 | Bacteria | 5079 |
| 135 | Ga0466725_180498 | 3300042654 | Bacteria | 1139 |
| 136 | Ga0123354_10186555 | 3300010882 | Bacteria | 2343 |
| 137 | Ga0466721_291770 | 3300042608 | Unclassified | 1134 |
| 138 | FGTW_contig28888 | 2065487013 | Unclassified | 13886 |
| 139 | JGI24705J35276_12237192 | 3300002504 | Unclassified | 10142 |
| 140 | CVPL010L_1000004 | 3300002932 | Bacteria | 122747 |
| 141 | Ga0103261_1005354 | 3300007083 | Bacteria | 1896 |
| 142 | Ga0103261_1045790 | 3300007083 | Unclassified | 639 |
| 143 | Ga0102734_1036028 | 3300007129 | Bacteria | 2343 |
| 144 | Ga0102738_1000042 | 3300007141 | Bacteria | 59015 |
| 145 | Ga0104048_1008153 | 3300007143 | Bacteria | 1903 |
| 146 | Ga0103264_1000237 | 3300007188 | Bacteria | 31419 |
| 147 | Ga0103268_1045870 | 3300007192 | Bacteria | 1071 |
| 148 | Ga0466729_063871 | 3300042621 | Bacteria | 7532 |
| 149 | Ga0160440_116109 | 3300012815 | Bacteria | 648 |
| 150 | Ga0160469_100156 | 3300012824 | Bacteria | 74880 |
| 151 | Ga0160447_105196 | 3300012849 | Bacteria | 3682 |
| 152 | Ga0160436_1002291 | 3300012861 | Bacteria | 4926 |
| 153 | Ga0466657_141545 | 3300042582 | Bacteria | 2429 |
| 154 | Ga0466657_349064 | 3300042582 | Bacteria | 3760 |
| 155 | Ga0466693_061076 | 3300042592 | Bacteria | 8322 |
| 156 | Ga0466729_264856 | 3300042621 | Bacteria | 9286 |
| 157 | Ga0466734_119803 | 3300042623 | Bacteria | 12432 |
| 158 | Ga0466724_49864 | 3300042649 | Unclassified | 18037 |
| 159 | Ga0466725_271822 | 3300042654 | Bacteria | 1255 |
| 160 | Ga0466701_097121 | 3300042598 | Bacteria | 81630 |
| 161 | DPOL_contig10276 | 2035918003 | Unclassified | 2211 |
| 162 | Ga0063521_1003716 | 3300003973 | Bacteria | 3614 |
| 163 | Ga0102739_1018147 | 3300007095 | Bacteria | 910 |
| 164 | Ga0102734_1002024 | 3300007129 | Bacteria | 5315 |
| 165 | Ga0102738_1006675 | 3300007141 | Unclassified | 1603 |
| 166 | Ga0102737_1007542 | 3300007142 | Bacteria | 1977 |
| 167 | Ga0103264_1002704 | 3300007188 | Bacteria | 9839 |
| 168 | Ga0466697_251096 | 3300042611 | Unclassified | 1163 |
| 169 | Ga0160468_124310 | 3300012819 | Bacteria | 507 |
| 170 | Ga0160469_100065 | 3300012824 | Bacteria | 179297 |
| 171 | Ga0160472_111585 | 3300012839 | Bacteria | 1048 |
| 172 | Ga0160444_104587 | 3300012841 | Unclassified | 1878 |
| 173 | Ga0160436_1042337 | 3300012861 | Unclassified | 715 |
| 174 | Ga0466657_055962 | 3300042582 | Bacteria | 2193 |
| 175 | Ga0466657_186151 | 3300042582 | Bacteria | 2514 |
| 176 | Ga0466701_003874 | 3300042598 | Bacteria | 14511 |
| 177 | Ga0466734_125679 | 3300042623 | Bacteria | 1688 |
| 178 | Ga0466730_002805 | 3300042625 | Bacteria | 56749 |
| 179 | Ga0466724_23002 | 3300042649 | Bacteria | 124941 |
| 180 | Ga0466724_45809 | 3300042649 | Bacteria | 229411 |
| 181 | Ga0466725_020929 | 3300042654 | Bacteria | 4464 |
| 182 | Ga0466725_108434 | 3300042654 | Bacteria | 2143 |
| 183 | Ga0123357_10009941 | 3300009784 | Unclassified | 12052 |
| 184 | Ga0123357_10069623 | 3300009784 | Unclassified | 4676 |
| 185 | Ga0466717_126680 | 3300042604 | Bacteria | 4492 |
| 186 | JGI24696J40584_12952486 | 3300002834 | Bacteria | 2353 |
| 187 | CVPL005W_1000045 | 3300002934 | Bacteria | 55544 |
| 188 | CVPL005L_10000761 | 3300002938 | Bacteria | 34972 |
| 189 | CVPL005L_10001581 | 3300002938 | Bacteria | 27980 |
| 190 | Ga0102739_1033217 | 3300007095 | Bacteria | 691 |
| 191 | Ga0104048_1010019 | 3300007143 | Bacteria | 753 |
| 192 | Ga0103264_1000524 | 3300007188 | Bacteria | 19311 |
| 193 | Ga0103267_1098426 | 3300007190 | Unclassified | 819 |
| 194 | Ga0103268_1011681 | 3300007192 | Unclassified | 1856 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00420 | Oxidored_q2 | NADH-ubiquinone/plastoquinone oxidoreductase chain 4L | 5 | 112 | 0.97 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.