Protein Family IF01659
Metagenome
Metatranscriptome
Isolate
329
Members
188
Samples
221
Scaffolds
142.47
Avg Length
Representative Sequence
- ID
- 3300007085|Ga0104045_1079869|Ga0104045_10798692
- Length
- 144 aa
- Sequence
- MAKKVTAYIKLQVPAGKANPAPPIGPALGQHGVNIMEFCKAFNAETQQMEVGMPLPVVITVYNDRSFTFIKKTPPAAYLLKKAAGLKSGSSNPNTKKVGKVTRQQLEEIAETKGADLSGATLEAKVRTLAGSARSMGIEVEGL*
Sample Types
Isolate
32.8%
Metagenome
66.3%
MAG
0.0%
Metatranscriptome
0.9%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
25.0%
Termitidae
19.4%
Formicidae
8.9%
Kalotermitidae
7.8%
Anthocoridae
5.6%
Scarabaeidae
5.0%
Cambaridae
5.0%
Armadillidiidae
2.8%
Culicidae
2.8%
Elmidae
2.2%
Termopsidae
2.2%
Dytiscidae
1.7%
Rhinotermitidae
1.7%
Tenebrionidae
1.7%
Passalidae
1.1%
Drosophilidae
1.1%
Pentatomidae
0.6%
Pyralidae
0.6%
Sarcophagidae
0.6%
Hodotermitidae
0.6%
Stratiomyidae
0.6%
Hydrophilidae
0.6%
Reduviidae
0.6%
Cerambycidae
0.6%
Curculionidae
0.6%
Chironomidae
0.6%
Cicadellidae
0.6%
Taxonomy
Archaea
0
Bacteria
307
Eukaryota
0
Viruses
0
Unclassified
22
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 2 | 2818991478 | Micromonospora palomenae DSM 102131 | Isolate | Pentatomidae |
| 3 | 2820903739 | Unclassified Actinobacteria Emb289P4bin49 | Isolate | Unclassified |
| 4 | 2841168549 | Agromyces protaetiae FW100M-8 | Isolate | Scarabaeidae |
| 5 | 2856954254 | Pseudonocardia sp. Ae505_Ps2 | Isolate | Formicidae |
| 6 | 2864918810 | Tsukamurella ocularis S00175 | Isolate | Elmidae |
| 7 | 2873614151 | Leucobacter viscericola HDW9C | Isolate | Dytiscidae |
| 8 | 2884351759 | Cellulosimicrobium sp. BI34T | Isolate | Pyralidae |
| 9 | 2894897082 | Leucobacter sp. OLCS4 | Isolate | Anthocoridae |
| 10 | 2894974975 | Leucobacter sp. OLIS6 | Isolate | Anthocoridae |
| 11 | 2912749649 | Streptomyces sp. GS7 | Isolate | Termitidae |
| 12 | 8062747827 | Yimella sp. cx-51 | Isolate | Cambaridae |
| 13 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 14 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 15 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 16 | 2515154106 | Streptomyces sp. FxanaD5 | Isolate | Unclassified |
| 17 | 2718217924 | Pseudonocardia sp. HH130630-07 | Isolate | Formicidae |
| 18 | 2772190761 | Rhodococcus rhodnii NRRL B-16535 | Isolate | Unclassified |
| 19 | 2820803007 | Unclassified Actinobacteria Th196P3bin61 | Isolate | Unclassified |
| 20 | 2820842553 | Unclassified Actinobacteria Lab288P4bin104 | Isolate | Unclassified |
| 21 | 2847305884 | Microbacterium protaetiae DFW100M-13 | Isolate | Scarabaeidae |
| 22 | 2856960404 | Pseudonocardia sp. Ae706_Ps2 | Isolate | Formicidae |
| 23 | 2856973192 | Pseudonocardia sp. Ae331_Ps2 | Isolate | Formicidae |
| 24 | 2859970369 | Pseudonocardia sp. Ae717_Ps2 | Isolate | Formicidae |
| 25 | 2862784999 | Streptomyces sp. M41 | Isolate | Unclassified |
| 26 | 2863397684 | Micromonospora polyrhachis DSM 45886 (Annotation) (version 2) | Isolate | Unclassified |
| 27 | 2864773010 | Tsukamurella ocularis S00022 | Isolate | Elmidae |
| 28 | 2894981435 | Leucobacter sp. OLDS2 | Isolate | Anthocoridae |
| 29 | 2909412500 | Yimella sp. cx-573 | Isolate | Cambaridae |
| 30 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 31 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 32 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 33 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 34 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 35 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 36 | 3300021245 | Termite gut microbial communities from nest from French Guiana - 11-4 mRNA SA | Metatranscriptome | Termitidae |
| 37 | 3300022820 | Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA | Metatranscriptome | Termitidae |
| 38 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 39 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 40 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 41 | 2504756063 | Isoptericola variabilis J5 | Isolate | Unclassified |
| 42 | 2517487021 | Wohlfahrtiimonas chitiniclastica DSM 18708 | Isolate | Sarcophagidae |
| 43 | 2648501322 | Streptomyces sp. SA3_actF | Isolate | Unclassified |
| 44 | 2734481968 | Xylanimicrobium pachnodae JCM 13526, NBRC 107786 | Isolate | Scarabaeidae |
| 45 | 2820546020 | Unclassified Firmicutes Lab288P1bin102 | Isolate | Unclassified |
| 46 | 2856882415 | Pseudonocardia sp. Ae406_Ps2 | Isolate | Formicidae |
| 47 | 2859977607 | Pseudonocardia sp. Ae707_Ps1 | Isolate | Formicidae |
| 48 | 2864964650 | Tsukamurella ocularis S00236 | Isolate | Elmidae |
| 49 | 2884613238 | Agromyces intestinalis KACC 19306 | Isolate | Scarabaeidae |
| 50 | 2900354037 | Nocardia macrotermitis RB20 | Isolate | Termitidae |
| 51 | 2915157839 | Leucobacter sp. cx-42 | Isolate | Cambaridae |
| 52 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 53 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 54 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 55 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 56 | 8046957834 | Streptomyces coacervatus JCM 17138 | Isolate | Unclassified |
| 57 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 58 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 59 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 60 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 61 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 62 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 63 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 64 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 65 | 2505679068 | Isoptericola variabilis 225 | Isolate | Unclassified |
| 66 | 2671180625 | Pseudonocardia sp. EC080619-01 | Isolate | Formicidae |
| 67 | 2791354930 | Wohlfahrtiimonas larvae kbl006 | Isolate | Stratiomyidae |
| 68 | 2820080004 | Unclassified Proteobacteria Lab288P4bin34 | Isolate | Unclassified |
| 69 | 2820353569 | Unclassified Firmicutes Nt197P3bin28 | Isolate | Unclassified |
| 70 | 2820516196 | Unclassified Firmicutes Lab288P1bin3 | Isolate | Unclassified |
| 71 | 2820818506 | Unclassified Actinobacteria Nt197P3bin3 | Isolate | Unclassified |
| 72 | 2820849606 | Unclassified Actinobacteria Lab288P3bin39 | Isolate | Unclassified |
| 73 | 2820926697 | Unclassified Actinobacteria Emb289P3bin125 | Isolate | Unclassified |
| 74 | 2837204985 | Lysinimonas sp. 2DFWR-13 | Isolate | Scarabaeidae |
| 75 | 2873586004 | Sanguibacter sp. HDW7 | Isolate | Hydrophilidae |
| 76 | 2894944011 | Leucobacter sp. OLAS13 | Isolate | Anthocoridae |
| 77 | 2915166107 | Leucobacter sp. cx-87 | Isolate | Cambaridae |
| 78 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 79 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 80 | 8062637095 | Yimella sp. cx-51 | Isolate | Cambaridae |
| 81 | 8077783556 | Streptomyces sp. PLM4 | Isolate | Formicidae |
| 82 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 83 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 84 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 85 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 86 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 87 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 88 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 89 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 90 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 91 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 92 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 93 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 94 | 2545824723 | Rhodococcus rhodnii LMG 5362 | Isolate | Reduviidae |
| 95 | 2547132081 | Streptomyces sp. S4 | Isolate | Formicidae |
| 96 | 2816332114 | Microbacterium saperdae DSM 20169 | Isolate | Unclassified |
| 97 | 2820292184 | Unclassified Firmicutes Th196P3bin109 | Isolate | Unclassified |
| 98 | 2820729191 | Unclassified Chloroflexi Th196P4bin49 | Isolate | Unclassified |
| 99 | 2820825283 | Unclassified Actinobacteria Nt197P3bin111 | Isolate | Unclassified |
| 100 | 2820894511 | Unclassified Actinobacteria Lab288P1bin103 | Isolate | Unclassified |
| 101 | 2820911766 | Unclassified Actinobacteria Emb289P3bin96 | Isolate | Unclassified |
| 102 | 2873620646 | Leucobacter coleopterorum HDW9A | Isolate | Dytiscidae |
| 103 | 2883361506 | Luteimicrobium xylanilyticum HY-24 | Isolate | Cerambycidae |
| 104 | 2894935787 | Leucobacter sp. OLJS4 | Isolate | Anthocoridae |
| 105 | 2909881144 | Kocuria sp. cx-455 | Isolate | Cambaridae |
| 106 | 2915160415 | Leucobacter sp. cx-328 | Isolate | Cambaridae |
| 107 | 2918394494 | Microbacterium imperiale DSM 20530 | Isolate | Unclassified |
| 108 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 109 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 110 | 3300007733 | Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean | Metagenome | |
| 111 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 112 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 113 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 114 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 115 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 116 | 2731957681 | Xylanimicrobium pachnodae JCM 13526, NBRC 107786 | Isolate | Scarabaeidae |
| 117 | 2818991320 | Klugiella xanthotipulae DSM 18031 | Isolate | Unclassified |
| 118 | 2820101058 | Unclassified Proteobacteria Emb289P4bin76 | Isolate | Unclassified |
| 119 | 2820504582 | Unclassified Firmicutes Lab288P1bin5 | Isolate | Unclassified |
| 120 | 2852016966 | Micromonospora polyrhachis DSM 45886 | Isolate | Unclassified |
| 121 | 2873617540 | Leucobacter insecticola HDW9B | Isolate | Dytiscidae |
| 122 | 2883683260 | Protaetiibacter larvae KACC 19322 | Isolate | Scarabaeidae |
| 123 | 2894900265 | Leucobacter sp. OLTLW20 | Isolate | Anthocoridae |
| 124 | 2894929448 | Leucobacter sp. OAMSW11 | Isolate | Anthocoridae |
| 125 | 2915168811 | Leucobacter sp. cx-169 | Isolate | Cambaridae |
| 126 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 127 | 3002678670 | Agromyces sp. G127AT | Isolate | Unclassified |
| 128 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 129 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 130 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 131 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 132 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 133 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 134 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 135 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 136 | 2820005795 | Unclassified Synergistetes Nt197P3bin106 | Isolate | Unclassified |
| 137 | 2820008971 | Unclassified Synergistetes Lab288P3bin103 | Isolate | Unclassified |
| 138 | 2820159668 | Unclassified Proteobacteria Cu122P3bin5 | Isolate | Unclassified |
| 139 | 2820897376 | Unclassified Actinobacteria Lab288P1bin101 | Isolate | Unclassified |
| 140 | 2836973655 | Gryllotalpicola protaetiae 2DFW10M-5 | Isolate | Scarabaeidae |
| 141 | 2856671350 | Pseudonocardia sp. Ae356_Ps1 | Isolate | Formicidae |
| 142 | 2856947901 | Pseudonocardia sp. Ae168_Ps1 | Isolate | Formicidae |
| 143 | 2864899338 | Mycobacteroides chelonae S00154 | Isolate | Elmidae |
| 144 | 2873196663 | Streptomyces capitiformicae 1H-SSA4 | Isolate | Formicidae |
| 145 | 2894926108 | Leucobacter sp. OLES1 | Isolate | Anthocoridae |
| 146 | 2908241010 | Streptomyces sp. HF10 | Isolate | Termitidae |
| 147 | 2918390780 | Glutamicibacter protophormiae DSM 20168 | Isolate | Unclassified |
| 148 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 149 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 150 | 8069511479 | Arthrobacter ipsi IA7 | Isolate | Curculionidae |
| 151 | 3006468911 | Streptomyces sp. RB17 | Isolate | Termitidae |
| 152 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 153 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 154 | 3300005316 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 2 gut | Metagenome | Drosophilidae |
| 155 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 156 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 157 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 158 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 159 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 160 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 161 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 162 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 163 | 2515154100 | Streptomyces sp. MspMP-M5 | Isolate | Unclassified |
| 164 | 2524023214 | Leucobacter chironomi DSM 19883 | Isolate | Chironomidae |
| 165 | 2675903497 | Pseudonocardia sp. EC080610-09 | Isolate | Formicidae |
| 166 | 2681812870 | Oerskovia enterophila DFA-19 | Isolate | Unclassified |
| 167 | 2820488713 | Unclassified Firmicutes Lab288P1bin69 | Isolate | Unclassified |
| 168 | 2820512088 | Unclassified Firmicutes Lab288P1bin4 | Isolate | Unclassified |
| 169 | 2820533259 | Unclassified Firmicutes Lab288P1bin140 | Isolate | Unclassified |
| 170 | 2848356102 | Xylanimonas allomyrinae 2JSPR-7 | Isolate | Scarabaeidae |
| 171 | 2856966858 | Pseudonocardia sp. Ae263_Ps1 | Isolate | Formicidae |
| 172 | 2894932631 | Leucobacter sp. OAMLP11 | Isolate | Anthocoridae |
| 173 | 2894966443 | Leucobacter sp. OLCALW19 | Isolate | Anthocoridae |
| 174 | 2896955351 | Streptomyces sp. GF20 | Isolate | Termitidae |
| 175 | 2910090113 | Kocuria sp. cx-116 | Isolate | Cambaridae |
| 176 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 177 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 178 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 179 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 180 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 181 | 649989992 | Pseudonocardia sp. P1 | Isolate | Formicidae |
| 182 | 8053361298 | Streptomyces formicae 1H-GS9 | Isolate | Unclassified |
| 183 | 8067987626 | Agromyces larvae CFWR-12 | Isolate | Unclassified |
| 184 | 638341057 | Candidatus Sulcia muelleri Hc | Isolate | Cicadellidae |
| 185 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 186 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 187 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 188 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_416627 | 3300042612 | Bacteria | 1420 |
| 2 | Ga0466715_207139 | 3300042616 | Bacteria | 1723 |
| 3 | Ga0466728_315541 | 3300042620 | Bacteria | 4049 |
| 4 | Ga0160432_105796 | 3300012818 | Unclassified | 1150 |
| 5 | Ga0160456_100953 | 3300012820 | Bacteria | 7616 |
| 6 | Ga0160443_100074 | 3300012848 | Bacteria | 181634 |
| 7 | Ga0160430_115357 | 3300012852 | Unclassified | 1161 |
| 8 | Ga0466656_163020 | 3300042550 | Bacteria | 1940 |
| 9 | Ga0123357_10373063 | 3300009784 | Unclassified | 1335 |
| 10 | Ga0123355_10236924 | 3300009826 | Bacteria | 2594 |
| 11 | Ga0123353_12414035 | 3300010167 | Bacteria | 628 |
| 12 | Ga0466707_267774 | 3300042601 | Bacteria | 2761 |
| 13 | Ga0466731_260197 | 3300042622 | Bacteria | 2004 |
| 14 | Ga0466704_466576 | 3300042643 | Unclassified | 1998 |
| 15 | Ga0466708_352734 | 3300042652 | Bacteria | 3692 |
| 16 | Ga0466725_363171 | 3300042654 | Unclassified | 1224 |
| 17 | Ga0466727_345476 | 3300042655 | Bacteria | 2053 |
| 18 | AustNasuHG_c1000390 | 3300000089 | Bacteria | 15232 |
| 19 | JGI24703J35330_11286913 | 3300002501 | Bacteria | 836 |
| 20 | Ga0104045_1079869 | 3300007085 | Bacteria | 1251 |
| 21 | Ga0466697_261186 | 3300042611 | Bacteria | 1104 |
| 22 | Ga0466705_099663 | 3300042612 | Bacteria | 6936 |
| 23 | Ga0466705_530790 | 3300042612 | Bacteria | 85737 |
| 24 | Ga0466710_020092 | 3300042613 | Bacteria | 54215 |
| 25 | Ga0466711_218509 | 3300042615 | Bacteria | 19081 |
| 26 | Ga0466715_482592 | 3300042616 | Bacteria | 2040 |
| 27 | Ga0466723_069063 | 3300042618 | Bacteria | 65221 |
| 28 | Ga0466723_076687 | 3300042618 | Bacteria | 24518 |
| 29 | Ga0466723_166276 | 3300042618 | Unclassified | 1010 |
| 30 | Ga0466728_064550 | 3300042620 | Bacteria | 23023 |
| 31 | Ga0160456_105226 | 3300012820 | Bacteria | 1605 |
| 32 | Ga0160452_101936 | 3300012834 | Bacteria | 5064 |
| 33 | Ga0160447_100250 | 3300012849 | Unclassified | 29607 |
| 34 | Ga0466693_402423 | 3300042592 | Bacteria | 1776 |
| 35 | Ga0466696_457018 | 3300042596 | Unclassified | 1343 |
| 36 | Ga0123357_10005217 | 3300009784 | Bacteria | 15509 |
| 37 | Ga0123355_10058236 | 3300009826 | Bacteria | 6250 |
| 38 | Ga0123355_10283834 | 3300009826 | Bacteria | 2282 |
| 39 | Ga0123356_10001142 | 3300010049 | Bacteria | 29321 |
| 40 | Ga0123356_10018156 | 3300010049 | Bacteria | 6680 |
| 41 | Ga0123353_10017322 | 3300010167 | Bacteria | 10583 |
| 42 | Ga0466713_109379 | 3300042602 | Bacteria | 40861 |
| 43 | Ga0466716_362984 | 3300042605 | Bacteria | 1781 |
| 44 | Ga0466735_088670 | 3300042624 | Bacteria | 3931 |
| 45 | Ga0466730_078941 | 3300042625 | Bacteria | 1359 |
| 46 | Ga0466702_197445 | 3300042635 | Bacteria | 2430 |
| 47 | Ga0466703_374126 | 3300042636 | Bacteria | 5737 |
| 48 | Ga0466704_294078 | 3300042643 | Bacteria | 1422 |
| 49 | Ga0466704_546614 | 3300042643 | Bacteria | 12463 |
| 50 | Ga0466708_270537 | 3300042652 | Bacteria | 10856 |
| 51 | Ga0466708_323940 | 3300042652 | Bacteria | 18001 |
| 52 | Ga0466727_224521 | 3300042655 | Bacteria | 4128 |
| 53 | JGI24705J35276_12224577 | 3300002504 | Bacteria | 2625 |
| 54 | Ga0072940_1072086 | 3300005200 | Bacteria | 1431 |
| 55 | Ga0466715_516599 | 3300042616 | Unclassified | 1201 |
| 56 | Ga0466715_573674 | 3300042616 | Bacteria | 4663 |
| 57 | Ga0466718_160337 | 3300042617 | Bacteria | 7528 |
| 58 | Ga0466723_057389 | 3300042618 | Bacteria | 22907 |
| 59 | Ga0466726_014097 | 3300042619 | Unclassified | 1051 |
| 60 | Ga0160444_116597 | 3300012841 | Bacteria | 838 |
| 61 | Ga0160435_1001259 | 3300012857 | Bacteria | 6561 |
| 62 | Ga0223683_1012300 | 3300021245 | Bacteria | 3699 |
| 63 | Ga0466690_246469 | 3300042590 | Bacteria | 1558 |
| 64 | Ga0466696_040070 | 3300042596 | Bacteria | 5365 |
| 65 | Ga0466696_323850 | 3300042596 | Bacteria | 1147 |
| 66 | Ga0123357_10161788 | 3300009784 | Bacteria | 2681 |
| 67 | Ga0123355_10000344 | 3300009826 | Bacteria | 60129 |
| 68 | Ga0123355_10248943 | 3300009826 | Bacteria | 2505 |
| 69 | Ga0123355_12000427 | 3300009826 | Bacteria | 537 |
| 70 | Ga0123353_10505236 | 3300010167 | Bacteria | 1760 |
| 71 | Ga0123354_10054298 | 3300010882 | Unclassified | 6012 |
| 72 | Ga0160466_100074 | 3300012809 | Bacteria | 108538 |
| 73 | Ga0466707_387188 | 3300042601 | Bacteria | 8546 |
| 74 | Ga0466716_248657 | 3300042605 | Bacteria | 1273 |
| 75 | Ga0466719_290035 | 3300042606 | Bacteria | 2463 |
| 76 | Ga0466719_557914 | 3300042606 | Bacteria | 2151 |
| 77 | Ga0466722_084356 | 3300042609 | Bacteria | 15517 |
| 78 | Ga0466729_279717 | 3300042621 | Bacteria | 16005 |
| 79 | Ga0466729_317575 | 3300042621 | Bacteria | 5499 |
| 80 | Ga0466730_018891 | 3300042625 | Bacteria | 23265 |
| 81 | Ga0466709_021096 | 3300042648 | Bacteria | 2101 |
| 82 | Ga0068302_10196194 | 3300005071 | Bacteria | 2161 |
| 83 | Ga0105524_104074 | 3300007733 | Bacteria | 4841 |
| 84 | Ga0466705_045517 | 3300042612 | Bacteria | 16885 |
| 85 | Ga0466705_389532 | 3300042612 | Bacteria | 8116 |
| 86 | Ga0466711_138410 | 3300042615 | Unclassified | 1518 |
| 87 | Ga0466711_426653 | 3300042615 | Bacteria | 6141 |
| 88 | Ga0466715_337537 | 3300042616 | Bacteria | 1044 |
| 89 | Ga0466723_217651 | 3300042618 | Bacteria | 11471 |
| 90 | Ga0466723_284730 | 3300042618 | Bacteria | 2551 |
| 91 | Ga0466726_080548 | 3300042619 | Bacteria | 1855 |
| 92 | Ga0160440_100031 | 3300012815 | Bacteria | 222224 |
| 93 | Ga0160441_117752 | 3300012825 | Bacteria | 721 |
| 94 | Ga0160434_100001 | 3300012850 | Bacteria | 617314 |
| 95 | Ga0160457_1000015 | 3300012858 | Bacteria | 420875 |
| 96 | Ga0160457_1014732 | 3300012858 | Bacteria | 1102 |
| 97 | Ga0415639_084484 | 3300038395 | Bacteria | 1281 |
| 98 | Ga0123355_10576015 | 3300009826 | Bacteria | 1348 |
| 99 | Ga0123356_10181073 | 3300010049 | Bacteria | 2129 |
| 100 | Ga0123353_10971957 | 3300010167 | Bacteria | 1145 |
| 101 | Ga0466707_273957 | 3300042601 | Bacteria | 1040 |
| 102 | Ga0466713_075160 | 3300042602 | Bacteria | 2920 |
| 103 | Ga0466716_451505 | 3300042605 | Unclassified | 1212 |
| 104 | Ga0466719_153307 | 3300042606 | Bacteria | 1166 |
| 105 | Ga0466734_101257 | 3300042623 | Bacteria | 12403 |
| 106 | Ga0466703_405818 | 3300042636 | Bacteria | 3315 |
| 107 | Ga0466724_66581 | 3300042649 | Bacteria | 665985 |
| 108 | JGI24703J35330_11429914 | 3300002501 | Bacteria | 1000 |
| 109 | JGI24699J35502_11131476 | 3300002509 | Bacteria | 5736 |
| 110 | Ga0072940_1128073 | 3300005200 | Bacteria | 948 |
| 111 | Ga0466705_098859 | 3300042612 | Bacteria | 1211 |
| 112 | Ga0562379_1772 | 3300056790 | Bacteria | 21961 |
| 113 | Ga0562375_0569 | 3300056856 | Bacteria | 72979 |
| 114 | Ga0466715_350154 | 3300042616 | Bacteria | 13779 |
| 115 | Ga0466715_356273 | 3300042616 | Bacteria | 5566 |
| 116 | Ga0160472_115045 | 3300012839 | Bacteria | 841 |
| 117 | Ga0466692_029625 | 3300042591 | Bacteria | 2919 |
| 118 | Ga0466694_142981 | 3300042594 | Bacteria | 3106 |
| 119 | Ga0466695_398548 | 3300042595 | Bacteria | 4750 |
| 120 | Ga0123355_10185420 | 3300009826 | Bacteria | 3078 |
| 121 | Ga0123355_10382656 | 3300009826 | Bacteria | 1832 |
| 122 | Ga0123353_10005645 | 3300010167 | Bacteria | 16480 |
| 123 | Ga0123353_10140079 | 3300010167 | Bacteria | 3875 |
| 124 | Ga0123353_10141372 | 3300010167 | Bacteria | 3855 |
| 125 | Ga0123353_10169880 | 3300010167 | Bacteria | 3462 |
| 126 | Ga0123354_10188767 | 3300010882 | Bacteria | 2318 |
| 127 | Ga0466706_061946 | 3300042599 | Bacteria | 1285 |
| 128 | Ga0466700_407847 | 3300042600 | Bacteria | 5031 |
| 129 | Ga0466722_070296 | 3300042609 | Bacteria | 18781 |
| 130 | Ga0466734_005690 | 3300042623 | Bacteria | 1484 |
| 131 | Ga0466709_078906 | 3300042648 | Bacteria | 10892 |
| 132 | IMNBL1DRAFT_c0000348 | 3300000062 | Bacteria | 39017 |
| 133 | JGI24703J35330_10827800 | 3300002501 | Bacteria | 548 |
| 134 | Ga0466715_099310 | 3300042616 | Bacteria | 20026 |
| 135 | Ga0160453_106543 | 3300012814 | Bacteria | 1706 |
| 136 | Ga0160430_102216 | 3300012852 | Bacteria | 6318 |
| 137 | Ga0160436_1000020 | 3300012861 | Bacteria | 107309 |
| 138 | Ga0123357_10482656 | 3300009784 | Bacteria | 1046 |
| 139 | Ga0123355_11836860 | 3300009826 | Bacteria | 570 |
| 140 | Ga0123353_10024050 | 3300010167 | Bacteria | 9238 |
| 141 | Ga0123353_12808586 | 3300010167 | Bacteria | 570 |
| 142 | Ga0123354_10008410 | 3300010882 | Bacteria | 15681 |
| 143 | Ga0123354_10025166 | 3300010882 | Bacteria | 9386 |
| 144 | Ga0466701_041583 | 3300042598 | Bacteria | 9889 |
| 145 | Ga0466706_133081 | 3300042599 | Bacteria | 17278 |
| 146 | Ga0466722_046512 | 3300042609 | Bacteria | 16580 |
| 147 | Ga0466729_277023 | 3300042621 | Bacteria | 1249 |
| 148 | Ga0466730_059059 | 3300042625 | Bacteria | 1377 |
| 149 | Ga0466704_027569 | 3300042643 | Bacteria | 2101 |
| 150 | Ga0466704_455727 | 3300042643 | Bacteria | 9569 |
| 151 | Ga0466708_079182 | 3300042652 | Bacteria | 17120 |
| 152 | 2227532960 | 2225789004 | Bacteria | 16186 |
| 153 | Ga0562376_4978 | 3300056857 | Bacteria | 9708 |
| 154 | Ga0466715_114261 | 3300042616 | Bacteria | 1886 |
| 155 | Ga0466723_081664 | 3300042618 | Bacteria | 7210 |
| 156 | Ga0466723_166148 | 3300042618 | Bacteria | 1966 |
| 157 | Ga0466728_010589 | 3300042620 | Bacteria | 1963 |
| 158 | Ga0255809_1015086 | 3300022820 | Bacteria | 1701 |
| 159 | Ga0466690_066232 | 3300042590 | Bacteria | 1735 |
| 160 | Ga0466690_199955 | 3300042590 | Bacteria | 3807 |
| 161 | Ga0466691_053870 | 3300042593 | Unclassified | 8312 |
| 162 | Ga0466696_180643 | 3300042596 | Bacteria | 1875 |
| 163 | Ga0466696_204543 | 3300042596 | Bacteria | 2298 |
| 164 | Ga0123357_10148867 | 3300009784 | Bacteria | 2848 |
| 165 | Ga0123355_10099582 | 3300009826 | Bacteria | 4580 |
| 166 | Ga0123355_10139643 | 3300009826 | Bacteria | 3711 |
| 167 | Ga0123355_10339485 | 3300009826 | Bacteria | 2003 |
| 168 | Ga0123355_10696009 | 3300009826 | Unclassified | 1169 |
| 169 | Ga0123355_10920061 | 3300009826 | Bacteria | 946 |
| 170 | Ga0123356_10094368 | 3300010049 | Bacteria | 2857 |
| 171 | Ga0123356_10181774 | 3300010049 | Bacteria | 2125 |
| 172 | Ga0123356_10717174 | 3300010049 | Bacteria | 1169 |
| 173 | Ga0123356_10736768 | 3300010049 | Bacteria | 1155 |
| 174 | Ga0123353_10390092 | 3300010167 | Bacteria | 2078 |
| 175 | Ga0123353_11892908 | 3300010167 | Unclassified | 736 |
| 176 | Ga0466706_002696 | 3300042599 | Bacteria | 4951 |
| 177 | Ga0466707_210122 | 3300042601 | Bacteria | 8877 |
| 178 | Ga0466698_315578 | 3300042610 | Bacteria | 1063 |
| 179 | Ga0466731_054820 | 3300042622 | Bacteria | 3845 |
| 180 | Ga0466734_015766 | 3300042623 | Bacteria | 1135 |
| 181 | Ga0466704_140451 | 3300042643 | Bacteria | 8289 |
| 182 | Ga0466708_014187 | 3300042652 | Bacteria | 53990 |
| 183 | Ga0466708_168140 | 3300042652 | Bacteria | 4122 |
| 184 | Ga0466725_023268 | 3300042654 | Bacteria | 7029 |
| 185 | Ga0466725_136486 | 3300042654 | Bacteria | 1949 |
| 186 | JGI24702J35022_10180640 | 3300002462 | Bacteria | 1198 |
| 187 | JGI24705J35276_12235009 | 3300002504 | Unclassified | 6073 |
| 188 | Ga0068302_10121767 | 3300005071 | Bacteria | 957 |
| 189 | Ga0074302_1142572 | 3300005316 | Bacteria | 1022 |
| 190 | Ga0466697_248437 | 3300042611 | Bacteria | 1060 |
| 191 | Ga0466705_298057 | 3300042612 | Bacteria | 3924 |
| 192 | Ga0562375_1477 | 3300056856 | Bacteria | 31484 |
| 193 | Ga0466705_424260 | 3300042612 | Bacteria | 2845 |
| 194 | Ga0466710_448286 | 3300042613 | Unclassified | 1395 |
| 195 | Ga0466711_355004 | 3300042615 | Bacteria | 4660 |
| 196 | Ga0466718_049115 | 3300042617 | Bacteria | 1451 |
| 197 | Ga0466723_203571 | 3300042618 | Bacteria | 7357 |
| 198 | Ga0160432_100253 | 3300012818 | Bacteria | 45732 |
| 199 | Ga0160445_100026 | 3300012847 | Bacteria | 192712 |
| 200 | Ga0160436_1004278 | 3300012861 | Bacteria | 3415 |
| 201 | Ga0255809_1027864 | 3300022820 | Bacteria | 940 |
| 202 | Ga0466691_010952 | 3300042593 | Bacteria | 3372 |
| 203 | Ga0123357_10643816 | 3300009784 | Bacteria | 789 |
| 204 | Ga0123355_10013763 | 3300009826 | Bacteria | 12605 |
| 205 | Ga0123355_10485690 | 3300009826 | Bacteria | 1534 |
| 206 | Ga0123355_11971004 | 3300009826 | Bacteria | 543 |
| 207 | Ga0123356_11787312 | 3300010049 | Unclassified | 764 |
| 208 | Ga0123353_10278919 | 3300010167 | Bacteria | 2568 |
| 209 | Ga0123353_11699514 | 3300010167 | Bacteria | 791 |
| 210 | Ga0123353_11956240 | 3300010167 | Bacteria | 720 |
| 211 | Ga0123354_10063808 | 3300010882 | Unclassified | 5409 |
| 212 | Ga0466707_371628 | 3300042601 | Bacteria | 1921 |
| 213 | Ga0466713_129586 | 3300042602 | Bacteria | 40082 |
| 214 | Ga0466716_410104 | 3300042605 | Bacteria | 2120 |
| 215 | Ga0466697_029015 | 3300042611 | Unclassified | 2061 |
| 216 | Ga0466730_068856 | 3300042625 | Bacteria | 20075 |
| 217 | Ga0466709_419554 | 3300042648 | Bacteria | 1442 |
| 218 | JGI24699J35502_11132030 | 3300002509 | Bacteria | 6294 |
| 219 | Ga0068305_10125350 | 3300005083 | Bacteria | 15394 |
| 220 | Ga0072940_1088610 | 3300005200 | Bacteria | 4665 |
| 221 | Ga0104045_1029938 | 3300007085 | Unclassified | 984 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | iso_pr_bacteria | 638341057 | 638952706 | 130 |
| 2 | 3300005200 | Ga0072940_1128073 | Ga0072940_11280732 | 131 |
| 3 | 3300009826 | Ga0123355_10920061 | Ga0123355_109200612 | 132 |
| 4 | 3300042601 | Ga0466707_210122 | Ga0466707_210122_6283_6687 | 134 |
| 5 | 3300042601 | Ga0466707_267774 | Ga0466707_267774_826_1230 | 134 |
| 6 | 3300042618 | Ga0466723_069063 | Ga0466723_069063_35155_35607 | 134 |
| 7 | iso_pr_bacteria | 2820897376 | 2820897648 | 134 |
| 8 | 3300042596 | Ga0466696_180643 | Ga0466696_180643_452_859 | 135 |
| 9 | 3300042635 | Ga0466702_197445 | Ga0466702_197445_1200_1607 | 135 |
| 10 | 3300042590 | Ga0466690_199955 | Ga0466690_199955_2699_3121 | 140 |
| 11 | 3300042601 | Ga0466707_387188 | Ga0466707_387188_4970_5392 | 140 |
| 12 | 3300042602 | Ga0466713_109379 | Ga0466713_109379_37449_37871 | 140 |
| 13 | 3300042602 | Ga0466713_129586 | Ga0466713_129586_38057_38479 | 140 |
| 14 | 3300042605 | Ga0466716_410104 | Ga0466716_410104_1012_1434 | 140 |
| 15 | 3300042615 | Ga0466711_426653 | Ga0466711_426653_2557_2979 | 140 |
| 16 | 3300042616 | Ga0466715_114261 | Ga0466715_114261_717_1139 | 140 |
| 17 | 3300042616 | Ga0466715_573674 | Ga0466715_573674_1400_1822 | 140 |
| 18 | 3300042620 | Ga0466728_010589 | Ga0466728_010589_1009_1431 | 140 |
| 19 | 3300042620 | Ga0466728_064550 | Ga0466728_064550_3036_3458 | 140 |
| 20 | 3300042622 | Ga0466731_054820 | Ga0466731_054820_2707_3129 | 140 |
| 21 | 3300042624 | Ga0466735_088670 | Ga0466735_088670_2111_2533 | 140 |
| 22 | 3300042636 | Ga0466703_405818 | Ga0466703_405818_2801_3223 | 140 |
| 23 | 3300042648 | Ga0466709_078906 | Ga0466709_078906_4392_4814 | 140 |
| 24 | 3300042652 | Ga0466708_079182 | Ga0466708_079182_14952_15374 | 140 |
| 25 | 3300042655 | Ga0466727_224521 | Ga0466727_224521_496_918 | 140 |
| 26 | iso_pr_bacteria | 2820729191 | 2820730475 | 140 |
| 27 | 2225789004 | 2227532960 | 2228046780 | 141 |
| 28 | 3300000062 | IMNBL1DRAFT_c0000348 | IMNBL1DRAFT_000034819 | 141 |
| 29 | 3300009826 | Ga0123355_11971004 | Ga0123355_119710042 | 141 |
| 30 | 3300010049 | Ga0123356_10736768 | Ga0123356_107367682 | 141 |
| 31 | 3300021245 | Ga0223683_1012300 | Ga0223683_10123005 | 141 |
| 32 | 3300022820 | Ga0255809_1015086 | Ga0255809_10150863 | 141 |
| 33 | 3300022820 | Ga0255809_1027864 | Ga0255809_10278642 | 141 |
| 34 | 3300038395 | Ga0415639_084484 | Ga0415639_084484_268_693 | 141 |
| 35 | 3300042590 | Ga0466690_066232 | Ga0466690_066232_737_1162 | 141 |
| 36 | 3300042591 | Ga0466692_029625 | Ga0466692_029625_1350_1775 | 141 |
| 37 | 3300042593 | Ga0466691_053870 | Ga0466691_053870_6415_6840 | 141 |
| 38 | 3300042594 | Ga0466694_142981 | Ga0466694_142981_2275_2700 | 141 |
| 39 | 3300042595 | Ga0466695_398548 | Ga0466695_398548_3022_3447 | 141 |
| 40 | 3300042596 | Ga0466696_204543 | Ga0466696_204543_922_1347 | 141 |
| 41 | 3300042596 | Ga0466696_323850 | Ga0466696_323850_352_777 | 141 |
| 42 | 3300042596 | Ga0466696_457018 | Ga0466696_457018_677_1102 | 141 |
| 43 | 3300042599 | Ga0466706_133081 | Ga0466706_133081_12149_12574 | 141 |
| 44 | 3300042600 | Ga0466700_407847 | Ga0466700_407847_2432_2857 | 141 |
| 45 | 3300042601 | Ga0466707_273957 | Ga0466707_273957_424_849 | 141 |
| 46 | 3300042605 | Ga0466716_362984 | Ga0466716_362984_747_1172 | 141 |
| 47 | 3300042605 | Ga0466716_451505 | Ga0466716_451505_325_750 | 141 |
| 48 | 3300042606 | Ga0466719_153307 | Ga0466719_153307_291_716 | 141 |
| 49 | 3300042606 | Ga0466719_290035 | Ga0466719_290035_454_879 | 141 |
| 50 | 3300042606 | Ga0466719_557914 | Ga0466719_557914_854_1279 | 141 |
| 51 | 3300042609 | Ga0466722_046512 | Ga0466722_046512_1381_1806 | 141 |
| 52 | 3300042609 | Ga0466722_070296 | Ga0466722_070296_16980_17405 | 141 |
| 53 | 3300042609 | Ga0466722_084356 | Ga0466722_084356_1374_1799 | 141 |
| 54 | 3300042610 | Ga0466698_315578 | Ga0466698_315578_81_506 | 141 |
| 55 | 3300042611 | Ga0466697_029015 | Ga0466697_029015_988_1413 | 141 |
| 56 | 3300042611 | Ga0466697_248437 | Ga0466697_248437_41_466 | 141 |
| 57 | 3300042611 | Ga0466697_261186 | Ga0466697_261186_579_1004 | 141 |
| 58 | 3300042612 | Ga0466705_045517 | Ga0466705_045517_15417_15842 | 141 |
| 59 | 3300042612 | Ga0466705_098859 | Ga0466705_098859_465_890 | 141 |
| 60 | 3300042612 | Ga0466705_424260 | Ga0466705_424260_1448_1873 | 141 |
| 61 | 3300042615 | Ga0466711_138410 | Ga0466711_138410_19_444 | 141 |
| 62 | 3300042615 | Ga0466711_218509 | Ga0466711_218509_17222_17647 | 141 |
| 63 | 3300042615 | Ga0466711_355004 | Ga0466711_355004_2359_2784 | 141 |
| 64 | 3300042616 | Ga0466715_099310 | Ga0466715_099310_894_1319 | 141 |
| 65 | 3300042616 | Ga0466715_350154 | Ga0466715_350154_1817_2242 | 141 |
| 66 | 3300042616 | Ga0466715_356273 | Ga0466715_356273_3907_4332 | 141 |
| 67 | 3300042616 | Ga0466715_482592 | Ga0466715_482592_348_773 | 141 |
| 68 | 3300042616 | Ga0466715_516599 | Ga0466715_516599_154_579 | 141 |
| 69 | 3300042618 | Ga0466723_166148 | Ga0466723_166148_1422_1847 | 141 |
| 70 | 3300042618 | Ga0466723_166276 | Ga0466723_166276_14_439 | 141 |
| 71 | 3300042618 | Ga0466723_203571 | Ga0466723_203571_5574_5999 | 141 |
| 72 | 3300042618 | Ga0466723_284730 | Ga0466723_284730_466_891 | 141 |
| 73 | 3300042619 | Ga0466726_014097 | Ga0466726_014097_335_760 | 141 |
| 74 | 3300042621 | Ga0466729_277023 | Ga0466729_277023_374_799 | 141 |
| 75 | 3300042622 | Ga0466731_260197 | Ga0466731_260197_838_1263 | 141 |
| 76 | 3300042623 | Ga0466734_101257 | Ga0466734_101257_2490_2915 | 141 |
| 77 | 3300042636 | Ga0466703_374126 | Ga0466703_374126_4911_5336 | 141 |
| 78 | 3300042643 | Ga0466704_027569 | Ga0466704_027569_795_1220 | 141 |
| 79 | 3300042643 | Ga0466704_140451 | Ga0466704_140451_4349_4774 | 141 |
| 80 | 3300042643 | Ga0466704_294078 | Ga0466704_294078_110_535 | 141 |
| 81 | 3300042643 | Ga0466704_466576 | Ga0466704_466576_157_582 | 141 |
| 82 | 3300042648 | Ga0466709_021096 | Ga0466709_021096_286_711 | 141 |
| 83 | 3300042652 | Ga0466708_168140 | Ga0466708_168140_3218_3643 | 141 |
| 84 | 3300042652 | Ga0466708_270537 | Ga0466708_270537_1377_1802 | 141 |
| 85 | 3300042652 | Ga0466708_323940 | Ga0466708_323940_1687_2112 | 141 |
| 86 | 3300042652 | Ga0466708_352734 | Ga0466708_352734_1991_2416 | 141 |
| 87 | 3300042654 | Ga0466725_363171 | Ga0466725_363171_592_1017 | 141 |
| 88 | 3300042655 | Ga0466727_345476 | Ga0466727_345476_619_1044 | 141 |
| 89 | iso_pr_bacteria | 2820005795 | 2820006777 | 141 |
| 90 | iso_pr_bacteria | 2820008971 | 2820009337 | 141 |
| 91 | iso_pr_bacteria | 2820080004 | 2820082053 | 141 |
| 92 | iso_pr_bacteria | 2820101058 | 2820103528 | 141 |
| 93 | iso_pr_bacteria | 2820159668 | 2820160167 | 141 |
| 94 | iso_pr_bacteria | 2820292184 | 2820293728 | 141 |
| 95 | iso_pr_bacteria | 2820353569 | 2820355160 | 141 |
| 96 | iso_pr_bacteria | 2820488713 | 2820490327 | 141 |
| 97 | iso_pr_bacteria | 2820504582 | 2820505225 | 141 |
| 98 | iso_pr_bacteria | 2820512088 | 2820513934 | 141 |
| 99 | iso_pr_bacteria | 2820516196 | 2820517374 | 141 |
| 100 | iso_pr_bacteria | 2820533259 | 2820533557 | 141 |
| 101 | iso_pr_bacteria | 2820546020 | 2820547000 | 141 |
| 102 | 3300002501 | JGI24703J35330_11286913 | JGI24703J35330_112869131 | 142 |
| 103 | 3300002501 | JGI24703J35330_11429914 | JGI24703J35330_114299142 | 142 |
| 104 | 3300002504 | JGI24705J35276_12224577 | JGI24705J35276_122245772 | 142 |
| 105 | 3300002504 | JGI24705J35276_12235009 | JGI24705J35276_122350095 | 142 |
| 106 | 3300005071 | Ga0068302_10121767 | Ga0068302_101217672 | 142 |
| 107 | 3300005083 | Ga0068305_10125350 | Ga0068305_1012535011 | 142 |
| 108 | 3300007733 | Ga0105524_104074 | Ga0105524_1040744 | 142 |
| 109 | 3300009784 | Ga0123357_10005217 | Ga0123357_1000521710 | 142 |
| 110 | 3300009784 | Ga0123357_10373063 | Ga0123357_103730632 | 142 |
| 111 | 3300009784 | Ga0123357_10643816 | Ga0123357_106438161 | 142 |
| 112 | 3300009826 | Ga0123355_10000344 | Ga0123355_1000034441 | 142 |
| 113 | 3300009826 | Ga0123355_10013763 | Ga0123355_100137634 | 142 |
| 114 | 3300009826 | Ga0123355_10058236 | Ga0123355_100582364 | 142 |
| 115 | 3300009826 | Ga0123355_10139643 | Ga0123355_101396436 | 142 |
| 116 | 3300009826 | Ga0123355_10185420 | Ga0123355_101854202 | 142 |
| 117 | 3300009826 | Ga0123355_10236924 | Ga0123355_102369244 | 142 |
| 118 | 3300009826 | Ga0123355_10248943 | Ga0123355_102489433 | 142 |
| 119 | 3300009826 | Ga0123355_10283834 | Ga0123355_102838342 | 142 |
| 120 | 3300009826 | Ga0123355_10339485 | Ga0123355_103394853 | 142 |
| 121 | 3300009826 | Ga0123355_10382656 | Ga0123355_103826563 | 142 |
| 122 | 3300009826 | Ga0123355_10485690 | Ga0123355_104856904 | 142 |
| 123 | 3300009826 | Ga0123355_10696009 | Ga0123355_106960092 | 142 |
| 124 | 3300009826 | Ga0123355_11836860 | Ga0123355_118368601 | 142 |
| 125 | 3300009826 | Ga0123355_12000427 | Ga0123355_120004271 | 142 |
| 126 | 3300010049 | Ga0123356_10181774 | Ga0123356_101817742 | 142 |
| 127 | 3300010049 | Ga0123356_11787312 | Ga0123356_117873122 | 142 |
| 128 | 3300010167 | Ga0123353_10005645 | Ga0123353_1000564516 | 142 |
| 129 | 3300010167 | Ga0123353_10024050 | Ga0123353_100240509 | 142 |
| 130 | 3300010167 | Ga0123353_10140079 | Ga0123353_101400799 | 142 |
| 131 | 3300010167 | Ga0123353_10141372 | Ga0123353_1014137210 | 142 |
| 132 | 3300010167 | Ga0123353_10278919 | Ga0123353_102789195 | 142 |
| 133 | 3300010167 | Ga0123353_10390092 | Ga0123353_103900922 | 142 |
| 134 | 3300010167 | Ga0123353_10971957 | Ga0123353_109719572 | 142 |
| 135 | 3300010167 | Ga0123353_11699514 | Ga0123353_116995142 | 142 |
| 136 | 3300010167 | Ga0123353_11892908 | Ga0123353_118929082 | 142 |
| 137 | 3300010167 | Ga0123353_11956240 | Ga0123353_119562401 | 142 |
| 138 | 3300010167 | Ga0123353_12414035 | Ga0123353_124140351 | 142 |
| 139 | 3300010882 | Ga0123354_10054298 | Ga0123354_100542985 | 142 |
| 140 | 3300010882 | Ga0123354_10063808 | Ga0123354_100638082 | 142 |
| 141 | 3300042592 | Ga0466693_402423 | Ga0466693_402423_607_1035 | 142 |
| 142 | 3300042605 | Ga0466716_248657 | Ga0466716_248657_344_772 | 142 |
| 143 | 3300042612 | Ga0466705_389532 | Ga0466705_389532_3155_3583 | 142 |
| 144 | 3300042612 | Ga0466705_530790 | Ga0466705_530790_36603_37031 | 142 |
| 145 | 3300042613 | Ga0466710_020092 | Ga0466710_020092_1129_1557 | 142 |
| 146 | 3300042616 | Ga0466715_337537 | Ga0466715_337537_465_893 | 142 |
| 147 | 3300042618 | Ga0466723_057389 | Ga0466723_057389_1970_2398 | 142 |
| 148 | 3300042618 | Ga0466723_076687 | Ga0466723_076687_2085_2513 | 142 |
| 149 | 3300042618 | Ga0466723_081664 | Ga0466723_081664_6729_7157 | 142 |
| 150 | 3300042618 | Ga0466723_217651 | Ga0466723_217651_7300_7728 | 142 |
| 151 | 3300042620 | Ga0466728_315541 | Ga0466728_315541_1387_1815 | 142 |
| 152 | 3300042643 | Ga0466704_455727 | Ga0466704_455727_1245_1673 | 142 |
| 153 | 3300042652 | Ga0466708_014187 | Ga0466708_014187_50175_50603 | 142 |
| 154 | 3300056790 | Ga0562379_1772 | Ga0562379_1772_2112_2540 | 142 |
| 155 | 3300056857 | Ga0562376_4978 | Ga0562376_4978_710_1138 | 142 |
| 156 | iso_pr_bacteria | 2818991320 | 2819439090 | 142 |
| 157 | iso_pr_bacteria | 2841168549 | 2841168830 | 142 |
| 158 | iso_pr_bacteria | 2864899338 | 2864899680 | 142 |
| 159 | iso_pr_bacteria | 2873614151 | 2873615691 | 142 |
| 160 | iso_pr_bacteria | 2873617540 | 2873617745 | 142 |
| 161 | iso_pr_bacteria | 2873620646 | 2873623914 | 142 |
| 162 | iso_pr_bacteria | 2884613238 | 2884614448 | 142 |
| 163 | iso_pr_bacteria | 2909412500 | 2909412818 | 142 |
| 164 | iso_pr_bacteria | 2909881144 | 2909881879 | 142 |
| 165 | iso_pr_bacteria | 2910090113 | 2910091617 | 142 |
| 166 | iso_pr_bacteria | 2915157839 | 2915158688 | 142 |
| 167 | iso_pr_bacteria | 2915160415 | 2915162353 | 142 |
| 168 | iso_pr_bacteria | 2915166107 | 2915167625 | 142 |
| 169 | iso_pr_bacteria | 2915168811 | 2915171246 | 142 |
| 170 | iso_pr_bacteria | 3002678670 | 3002680747 | 142 |
| 171 | iso_pr_bacteria | 8062637095 | 8062639550 | 142 |
| 172 | iso_pr_bacteria | 8062747827 | 8062748361 | 142 |
| 173 | iso_pr_bacteria | 8067987626 | 8067991169 | 142 |
| 174 | 3300005200 | Ga0072940_1072086 | Ga0072940_10720862 | 143 |
| 175 | 3300005200 | Ga0072940_1088610 | Ga0072940_10886103 | 143 |
| 176 | 3300005316 | Ga0074302_1142572 | Ga0074302_11425721 | 143 |
| 177 | 3300009784 | Ga0123357_10161788 | Ga0123357_101617884 | 143 |
| 178 | 3300010049 | Ga0123356_10181073 | Ga0123356_101810734 | 143 |
| 179 | 3300010049 | Ga0123356_10717174 | Ga0123356_107171742 | 143 |
| 180 | 3300010882 | Ga0123354_10025166 | Ga0123354_100251664 | 143 |
| 181 | 3300012852 | Ga0160430_102216 | Ga0160430_1022165 | 143 |
| 182 | 3300042596 | Ga0466696_040070 | Ga0466696_040070_3928_4359 | 143 |
| 183 | 3300042598 | Ga0466701_041583 | Ga0466701_041583_6679_7110 | 143 |
| 184 | 3300042601 | Ga0466707_371628 | Ga0466707_371628_1175_1606 | 143 |
| 185 | 3300042612 | Ga0466705_099663 | Ga0466705_099663_628_1059 | 143 |
| 186 | 3300042616 | Ga0466715_207139 | Ga0466715_207139_600_1031 | 143 |
| 187 | 3300042617 | Ga0466718_049115 | Ga0466718_049115_238_669 | 143 |
| 188 | 3300042617 | Ga0466718_160337 | Ga0466718_160337_3405_3836 | 143 |
| 189 | 3300042625 | Ga0466730_059059 | Ga0466730_059059_730_1161 | 143 |
| 190 | 3300042625 | Ga0466730_078941 | Ga0466730_078941_39_470 | 143 |
| 191 | 3300042643 | Ga0466704_546614 | Ga0466704_546614_2986_3417 | 143 |
| 192 | 3300042649 | Ga0466724_66581 | Ga0466724_66581_137693_138124 | 143 |
| 193 | 3300042654 | Ga0466725_136486 | Ga0466725_136486_583_1014 | 143 |
| 194 | 3300056856 | Ga0562375_1477 | Ga0562375_1477_18408_18839 | 143 |
| 195 | iso_pr_bacteria | 2504756063 | 2504977476 | 143 |
| 196 | iso_pr_bacteria | 2505679068 | 2505951748 | 143 |
| 197 | iso_pr_bacteria | 2517487021 | 2517564472 | 143 |
| 198 | iso_pr_bacteria | 2524023214 | 2524489593 | 143 |
| 199 | iso_pr_bacteria | 2545824723 | 2546569986 | 143 |
| 200 | iso_pr_bacteria | 2681812870 | 2682010920 | 143 |
| 201 | iso_pr_bacteria | 2731957681 | 2732700074 | 143 |
| 202 | iso_pr_bacteria | 2734481968 | 2734845079 | 143 |
| 203 | iso_pr_bacteria | 2772190761 | 2772885666 | 143 |
| 204 | iso_pr_bacteria | 2791354930 | 2792024460 | 143 |
| 205 | iso_pr_bacteria | 2816332114 | 2816396906 | 143 |
| 206 | iso_pr_bacteria | 2818991478 | 2819787647 | 143 |
| 207 | iso_pr_bacteria | 2820825283 | 2820826953 | 143 |
| 208 | iso_pr_bacteria | 2820894511 | 2820896912 | 143 |
| 209 | iso_pr_bacteria | 2836973655 | 2836975906 | 143 |
| 210 | iso_pr_bacteria | 2837204985 | 2837206558 | 143 |
| 211 | iso_pr_bacteria | 2847305884 | 2847308200 | 143 |
| 212 | iso_pr_bacteria | 2848356102 | 2848359433 | 143 |
| 213 | iso_pr_bacteria | 2864773010 | 2864774136 | 143 |
| 214 | iso_pr_bacteria | 2864918810 | 2864921634 | 143 |
| 215 | iso_pr_bacteria | 2864964650 | 2864966258 | 143 |
| 216 | iso_pr_bacteria | 2873586004 | 2873586611 | 143 |
| 217 | iso_pr_bacteria | 2883361506 | 2883362316 | 143 |
| 218 | iso_pr_bacteria | 2883683260 | 2883683503 | 143 |
| 219 | iso_pr_bacteria | 2884351759 | 2884355161 | 143 |
| 220 | iso_pr_bacteria | 2894897082 | 2894897383 | 143 |
| 221 | iso_pr_bacteria | 2894900265 | 2894903106 | 143 |
| 222 | iso_pr_bacteria | 2894926108 | 2894928200 | 143 |
| 223 | iso_pr_bacteria | 2894929448 | 2894932461 | 143 |
| 224 | iso_pr_bacteria | 2894932631 | 2894935121 | 143 |
| 225 | iso_pr_bacteria | 2894935787 | 2894938143 | 143 |
| 226 | iso_pr_bacteria | 2894944011 | 2894946697 | 143 |
| 227 | iso_pr_bacteria | 2894966443 | 2894967670 | 143 |
| 228 | iso_pr_bacteria | 2894974975 | 2894976547 | 143 |
| 229 | iso_pr_bacteria | 2894981435 | 2894984187 | 143 |
| 230 | iso_pr_bacteria | 2918390780 | 2918394347 | 143 |
| 231 | iso_pr_bacteria | 2918394494 | 2918397162 | 143 |
| 232 | iso_pr_bacteria | 8069511479 | 8069515155 | 143 |
| 233 | 3300002501 | JGI24703J35330_10827800 | JGI24703J35330_108278001 | 144 |
| 234 | 3300002509 | JGI24699J35502_11131476 | JGI24699J35502_111314764 | 144 |
| 235 | 3300002509 | JGI24699J35502_11132030 | JGI24699J35502_111320304 | 144 |
| 236 | 3300007085 | Ga0104045_1029938 | Ga0104045_10299382 | 144 |
| 237 | 3300007085 | Ga0104045_1079869 | Ga0104045_10798692 | 144 |
| 238 | 3300009826 | Ga0123355_10576015 | Ga0123355_105760152 | 144 |
| 239 | 3300010167 | Ga0123353_10017322 | Ga0123353_1001732212 | 144 |
| 240 | 3300010167 | Ga0123353_10505236 | Ga0123353_105052363 | 144 |
| 241 | 3300010167 | Ga0123353_12808586 | Ga0123353_128085861 | 144 |
| 242 | 3300012809 | Ga0160466_100074 | Ga0160466_10007483 | 144 |
| 243 | 3300012814 | Ga0160453_106543 | Ga0160453_1065432 | 144 |
| 244 | 3300012815 | Ga0160440_100031 | Ga0160440_10003190 | 144 |
| 245 | 3300012818 | Ga0160432_100253 | Ga0160432_10025345 | 144 |
| 246 | 3300012818 | Ga0160432_105796 | Ga0160432_1057962 | 144 |
| 247 | 3300012820 | Ga0160456_100953 | Ga0160456_1009535 | 144 |
| 248 | 3300012820 | Ga0160456_105226 | Ga0160456_1052263 | 144 |
| 249 | 3300012825 | Ga0160441_117752 | Ga0160441_1177521 | 144 |
| 250 | 3300012839 | Ga0160472_115045 | Ga0160472_1150451 | 144 |
| 251 | 3300012847 | Ga0160445_100026 | Ga0160445_100026126 | 144 |
| 252 | 3300012848 | Ga0160443_100074 | Ga0160443_10007468 | 144 |
| 253 | 3300012849 | Ga0160447_100250 | Ga0160447_10025013 | 144 |
| 254 | 3300012850 | Ga0160434_100001 | Ga0160434_100001382 | 144 |
| 255 | 3300012857 | Ga0160435_1001259 | Ga0160435_10012594 | 144 |
| 256 | 3300012858 | Ga0160457_1000015 | Ga0160457_1000015373 | 144 |
| 257 | 3300012858 | Ga0160457_1014732 | Ga0160457_10147322 | 144 |
| 258 | 3300012861 | Ga0160436_1000020 | Ga0160436_100002061 | 144 |
| 259 | 3300012861 | Ga0160436_1004278 | Ga0160436_10042784 | 144 |
| 260 | 3300042599 | Ga0466706_002696 | Ga0466706_002696_2826_3260 | 144 |
| 261 | 3300042599 | Ga0466706_061946 | Ga0466706_061946_526_960 | 144 |
| 262 | 3300042602 | Ga0466713_075160 | Ga0466713_075160_1113_1547 | 144 |
| 263 | 3300042612 | Ga0466705_298057 | Ga0466705_298057_2691_3125 | 144 |
| 264 | 3300042619 | Ga0466726_080548 | Ga0466726_080548_549_983 | 144 |
| 265 | 3300042621 | Ga0466729_317575 | Ga0466729_317575_2992_3426 | 144 |
| 266 | 3300042623 | Ga0466734_005690 | Ga0466734_005690_550_984 | 144 |
| 267 | 3300042623 | Ga0466734_015766 | Ga0466734_015766_81_515 | 144 |
| 268 | 3300042625 | Ga0466730_018891 | Ga0466730_018891_16689_17123 | 144 |
| 269 | 3300042625 | Ga0466730_068856 | Ga0466730_068856_14254_14688 | 144 |
| 270 | 3300042648 | Ga0466709_419554 | Ga0466709_419554_924_1358 | 144 |
| 271 | 3300042654 | Ga0466725_023268 | Ga0466725_023268_406_840 | 144 |
| 272 | iso_pr_bacteria | 2515154100 | 2515556424 | 144 |
| 273 | iso_pr_bacteria | 2515154106 | 2515605404 | 144 |
| 274 | iso_pr_bacteria | 2547132081 | 2547292732 | 144 |
| 275 | iso_pr_bacteria | 2648501322 | 2649448812 | 144 |
| 276 | iso_pr_bacteria | 2671180625 | 2673536494 | 144 |
| 277 | iso_pr_bacteria | 2675903497 | 2678199055 | 144 |
| 278 | iso_pr_bacteria | 2718217924 | 2719373021 | 144 |
| 279 | iso_pr_bacteria | 2820803007 | 2820804432 | 144 |
| 280 | iso_pr_bacteria | 2820818506 | 2820818648 | 144 |
| 281 | iso_pr_bacteria | 2820842553 | 2820845301 | 144 |
| 282 | iso_pr_bacteria | 2820849606 | 2820850114 | 144 |
| 283 | iso_pr_bacteria | 2820903739 | 2820904705 | 144 |
| 284 | iso_pr_bacteria | 2820911766 | 2820913567 | 144 |
| 285 | iso_pr_bacteria | 2820926697 | 2820928871 | 144 |
| 286 | iso_pr_bacteria | 2852016966 | 2852018989 | 144 |
| 287 | iso_pr_bacteria | 2856671350 | 2856675484 | 144 |
| 288 | iso_pr_bacteria | 2856882415 | 2856886881 | 144 |
| 289 | iso_pr_bacteria | 2856947901 | 2856950458 | 144 |
| 290 | iso_pr_bacteria | 2856954254 | 2856954933 | 144 |
| 291 | iso_pr_bacteria | 2856960404 | 2856964868 | 144 |
| 292 | iso_pr_bacteria | 2856966858 | 2856969600 | 144 |
| 293 | iso_pr_bacteria | 2856973192 | 2856974510 | 144 |
| 294 | iso_pr_bacteria | 2859970369 | 2859975125 | 144 |
| 295 | iso_pr_bacteria | 2859977607 | 2859982757 | 144 |
| 296 | iso_pr_bacteria | 2862784999 | 2862787504 | 144 |
| 297 | iso_pr_bacteria | 2863397684 | 2863399707 | 144 |
| 298 | iso_pr_bacteria | 2873196663 | 2873203608 | 144 |
| 299 | iso_pr_bacteria | 2896955351 | 2896957770 | 144 |
| 300 | iso_pr_bacteria | 2900354037 | 2900357529 | 144 |
| 301 | iso_pr_bacteria | 2908241010 | 2908245348 | 144 |
| 302 | iso_pr_bacteria | 2912749649 | 2912750110 | 144 |
| 303 | iso_pr_bacteria | 3006468911 | 3006474048 | 144 |
| 304 | iso_pr_bacteria | 649989992 | 650095473 | 144 |
| 305 | iso_pr_bacteria | 8046957834 | 8046958486 | 144 |
| 306 | iso_pr_bacteria | 8053361298 | 8053362065 | 144 |
| 307 | iso_pr_bacteria | 8077783556 | 8077785868 | 144 |
| 308 | 3300002462 | JGI24702J35022_10180640 | JGI24702J35022_101806402 | 145 |
| 309 | 3300005071 | Ga0068302_10196194 | Ga0068302_101961943 | 145 |
| 310 | 3300009784 | Ga0123357_10148867 | Ga0123357_101488672 | 145 |
| 311 | 3300009784 | Ga0123357_10482656 | Ga0123357_104826562 | 145 |
| 312 | 3300010049 | Ga0123356_10001142 | Ga0123356_1000114216 | 145 |
| 313 | 3300010049 | Ga0123356_10018156 | Ga0123356_100181562 | 145 |
| 314 | 3300010049 | Ga0123356_10094368 | Ga0123356_100943684 | 145 |
| 315 | 3300010167 | Ga0123353_10169880 | Ga0123353_101698804 | 145 |
| 316 | 3300010882 | Ga0123354_10008410 | Ga0123354_1000841014 | 145 |
| 317 | 3300010882 | Ga0123354_10188767 | Ga0123354_101887674 | 145 |
| 318 | 3300012852 | Ga0160430_115357 | Ga0160430_1153571 | 145 |
| 319 | 3300042613 | Ga0466710_448286 | Ga0466710_448286_760_1197 | 145 |
| 320 | 3300056856 | Ga0562375_0569 | Ga0562375_0569_24799_25236 | 145 |
| 321 | 3300009826 | Ga0123355_10099582 | Ga0123355_100995824 | 147 |
| 322 | 3300042550 | Ga0466656_163020 | Ga0466656_163020_282_725 | 147 |
| 323 | 3300000089 | AustNasuHG_c1000390 | AustNasuHG_10003904 | 148 |
| 324 | 3300042593 | Ga0466691_010952 | Ga0466691_010952_2304_2756 | 150 |
| 325 | 3300042621 | Ga0466729_279717 | Ga0466729_279717_1308_1766 | 152 |
| 326 | 3300042590 | Ga0466690_246469 | Ga0466690_246469_837_1298 | 153 |
| 327 | 3300042612 | Ga0466705_416627 | Ga0466705_416627_820_1287 | 155 |
| 328 | 3300012841 | Ga0160444_116597 | Ga0160444_1165972 | 156 |
| 329 | 3300012834 | Ga0160452_101936 | Ga0160452_1019363 | 163 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.82 | 0.82 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.