Protein Family IF01654
Metagenome
Isolate
143
Members
79
Samples
119
Scaffolds
221.11
Avg Length
Representative Sequence
- ID
- 3300007085|Ga0104045_1005529|Ga0104045_10055294
- Length
- 257 aa
- Sequence
- MEGSSKCSVKIRMCWFFYSALWATLFTYSKLCHFHYLRIMILKASNIYKSYGNLPILKGVDLSVNKGEIVSIVGASGAGKSTLLHIIGTLDRPDQGNLQINDTDINQLNERKLSSFRNQHIGFIFQFHHLLPEFTALENVCIPAFIQGVSPKEATRRGMELLDRLGVEGRAQHKPAAMSGGEQQRVSVARALMNNPSLILADEPSGNLDSENAASLHQLFFELRDTLNQTFIIVTHNEELARISDRTIHMRDGNIF*
Sample Types
Isolate
16.8%
Metagenome
83.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
16.4%
Kalotermitidae
16.4%
Blattidae
13.7%
Unclassified
9.6%
Armadillidiidae
8.2%
Drosophilidae
8.2%
Elmidae
5.5%
Rhinotermitidae
5.5%
Termopsidae
4.1%
Formicidae
4.1%
Tenebrionidae
2.7%
Bombycidae
1.4%
Passalidae
1.4%
Culicidae
1.4%
Hodotermitidae
1.4%
Taxonomy
Archaea
0
Bacteria
136
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2579779088 | Sphingobacterium paucimobilis HER1398 | Isolate | Bombycidae |
| 2 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 3 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 4 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 5 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 6 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 7 | 2864840607 | Acinetobacter johnsonii S00071 | Isolate | Elmidae |
| 8 | 2896350215 | Sphingobacterium sp. xlx-183 | Isolate | |
| 9 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 10 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 11 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 12 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 13 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 14 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 15 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 16 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 17 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 18 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 19 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 20 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 21 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 22 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 23 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 24 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 25 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 26 | 2820183396 | Unclassified Planctomycetes Lab288P3bin214 | Isolate | Unclassified |
| 27 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 28 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 29 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 30 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 31 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 32 | 3300007078 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 4 gut | Metagenome | Drosophilidae |
| 33 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 34 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 35 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 36 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 37 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 38 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 39 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 40 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 41 | 2864843793 | Acinetobacter johnsonii S00075 | Isolate | Elmidae |
| 42 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 43 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 44 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 45 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 46 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 47 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 48 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 49 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 50 | 3300005309 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 1 gut | Metagenome | Drosophilidae |
| 51 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 52 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 53 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 54 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 55 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 56 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 57 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 58 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 59 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 60 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 61 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 62 | 2864804954 | Acinetobacter johnsonii S00050 | Isolate | Elmidae |
| 63 | 2896321640 | Sphingobacterium sp. xlx-130 | Isolate | |
| 64 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 65 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 66 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 67 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 68 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 69 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 70 | 2864863795 | Acinetobacter johnsonii S00116 | Isolate | Elmidae |
| 71 | 2898741527 | Sphingobacterium sp. xlx-73 | Isolate | |
| 72 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 73 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 74 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 75 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 76 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 77 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 78 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 79 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0562378_0003 | 3300056814 | Bacteria | 2474150 |
| 2 | Ga0466707_060703 | 3300042601 | Bacteria | 27082 |
| 3 | Ga0123353_10054019 | 3300010167 | Bacteria | 6421 |
| 4 | Ga0123353_10111496 | 3300010167 | Bacteria | 4406 |
| 5 | Ga0466734_096518 | 3300042623 | Bacteria | 2527 |
| 6 | Ga0466735_009229 | 3300042624 | Bacteria | 5902 |
| 7 | Ga0466690_221039 | 3300042590 | Bacteria | 17812 |
| 8 | Ga0466692_173616 | 3300042591 | Bacteria | 4521 |
| 9 | Ga0466711_369266 | 3300042615 | Bacteria | 1017 |
| 10 | Ga0466715_044290 | 3300042616 | Bacteria | 5406 |
| 11 | Ga0466723_055263 | 3300042618 | Bacteria | 32547 |
| 12 | Ga0466729_127362 | 3300042621 | Bacteria | 8993 |
| 13 | Ga0104051_1104453 | 3300007078 | Bacteria | 1325 |
| 14 | Ga0104045_1079695 | 3300007085 | Bacteria | 1267 |
| 15 | Ga0466700_156640 | 3300042600 | Bacteria | 23709 |
| 16 | Ga0466707_012160 | 3300042601 | Bacteria | 8496 |
| 17 | Ga0466707_047231 | 3300042601 | Bacteria | 47080 |
| 18 | Ga0466713_016871 | 3300042602 | Bacteria | 29897 |
| 19 | Ga0466713_022012 | 3300042602 | Bacteria | 58844 |
| 20 | Ga0123353_10352185 | 3300010167 | Bacteria | 2218 |
| 21 | Ga0466704_204908 | 3300042643 | Bacteria | 43948 |
| 22 | Ga0466704_441697 | 3300042643 | Bacteria | 17399 |
| 23 | Ga0466727_206335 | 3300042655 | Bacteria | 4293 |
| 24 | Ga0160433_100049 | 3300012846 | Bacteria | 134813 |
| 25 | Ga0466691_090778 | 3300042593 | Bacteria | 7868 |
| 26 | Ga0466696_065759 | 3300042596 | Bacteria | 1629 |
| 27 | Ga0466705_460495 | 3300042612 | Bacteria | 10576 |
| 28 | Ga0068305_10017587 | 3300005083 | Bacteria | 30588 |
| 29 | Ga0104045_1004504 | 3300007085 | Bacteria | 17527 |
| 30 | Ga0466732_343093 | 3300042656 | Bacteria | 4993 |
| 31 | Ga0466733_217517 | 3300042659 | Bacteria | 12455 |
| 32 | Ga0466701_031337 | 3300042598 | Bacteria | 4824 |
| 33 | Ga0466706_167656 | 3300042599 | Bacteria | 64805 |
| 34 | Ga0466707_017877 | 3300042601 | Bacteria | 16904 |
| 35 | Ga0466707_365246 | 3300042601 | Bacteria | 17576 |
| 36 | Ga0466713_039862 | 3300042602 | Bacteria | 2693 |
| 37 | Ga0466713_116260 | 3300042602 | Bacteria | 47144 |
| 38 | Ga0466719_337839 | 3300042606 | Bacteria | 2790 |
| 39 | Ga0466719_435321 | 3300042606 | Bacteria | 3404 |
| 40 | Ga0123353_10002361 | 3300010167 | Bacteria | 23445 |
| 41 | Ga0466724_24432 | 3300042649 | Bacteria | 5813 |
| 42 | Ga0466724_53539 | 3300042649 | Bacteria | 21378 |
| 43 | Ga0466723_082783 | 3300042618 | Bacteria | 9612 |
| 44 | Ga0466726_458842 | 3300042619 | Bacteria | 3575 |
| 45 | Ga0104019_1190021 | 3300007150 | Bacteria | 2962 |
| 46 | Ga0466707_273157 | 3300042601 | Bacteria | 4862 |
| 47 | Ga0466713_061292 | 3300042602 | Bacteria | 15151 |
| 48 | Ga0123353_10000958 | 3300010167 | Bacteria | 35325 |
| 49 | Ga0123353_10009656 | 3300010167 | Bacteria | 13355 |
| 50 | Ga0160442_100032 | 3300012806 | Bacteria | 257303 |
| 51 | Ga0466729_286658 | 3300042621 | Unclassified | 6548 |
| 52 | Ga0466730_053884 | 3300042625 | Bacteria | 416658 |
| 53 | Ga0466696_367902 | 3300042596 | Bacteria | 1248 |
| 54 | Ga0104050_1005461 | 3300007153 | Unclassified | 3940 |
| 55 | Ga0466705_361197 | 3300042612 | Bacteria | 1266 |
| 56 | Ga0466707_058803 | 3300042601 | Bacteria | 27189 |
| 57 | Ga0466713_108668 | 3300042602 | Bacteria | 52205 |
| 58 | Ga0123356_10336210 | 3300010049 | Bacteria | 1629 |
| 59 | Ga0123353_10004722 | 3300010167 | Bacteria | 17643 |
| 60 | Ga0466729_230630 | 3300042621 | Bacteria | 7962 |
| 61 | Ga0466703_116178 | 3300042636 | Bacteria | 2270 |
| 62 | Ga0466704_432076 | 3300042643 | Bacteria | 5453 |
| 63 | Ga0466724_04791 | 3300042649 | Unclassified | 5399 |
| 64 | Ga0466724_34059 | 3300042649 | Bacteria | 3395 |
| 65 | Ga0466708_048815 | 3300042652 | Bacteria | 8820 |
| 66 | Ga0466727_124960 | 3300042655 | Bacteria | 13419 |
| 67 | Ga0466727_125799 | 3300042655 | Bacteria | 12931 |
| 68 | Ga0160468_100066 | 3300012819 | Bacteria | 140854 |
| 69 | Ga0466690_152437 | 3300042590 | Bacteria | 6947 |
| 70 | Ga0466690_408627 | 3300042590 | Bacteria | 146519 |
| 71 | Ga0466692_156027 | 3300042591 | Bacteria | 99798 |
| 72 | Ga0466726_454201 | 3300042619 | Bacteria | 5143 |
| 73 | Ga0102734_1003692 | 3300007129 | Bacteria | 8811 |
| 74 | Ga0466706_028321 | 3300042599 | Bacteria | 102705 |
| 75 | Ga0466713_150340 | 3300042602 | Bacteria | 42021 |
| 76 | Ga0466735_023576 | 3300042624 | Bacteria | 4389 |
| 77 | Ga0466703_059585 | 3300042636 | Bacteria | 6373 |
| 78 | Ga0466704_340727 | 3300042643 | Bacteria | 10047 |
| 79 | Ga0466724_14071 | 3300042649 | Bacteria | 4365 |
| 80 | Ga0160432_100016 | 3300012818 | Bacteria | 326439 |
| 81 | Ga0466691_130562 | 3300042593 | Bacteria | 8605 |
| 82 | Ga0466696_197935 | 3300042596 | Bacteria | 12852 |
| 83 | Ga0466701_011852 | 3300042598 | Bacteria | 10727 |
| 84 | Ga0466711_159908 | 3300042615 | Bacteria | 2279 |
| 85 | Ga0466715_040636 | 3300042616 | Bacteria | 8506 |
| 86 | IMNBL1DRAFT_c0034988 | 3300000062 | Bacteria | 1778 |
| 87 | JGI24699J35502_11134084 | 3300002509 | Bacteria | 29116 |
| 88 | Ga0074306_1120801 | 3300005309 | Bacteria | 1113 |
| 89 | Ga0102739_1005330 | 3300007095 | Bacteria | 1763 |
| 90 | Ga0466716_180239 | 3300042605 | Bacteria | 6569 |
| 91 | Ga0466722_081474 | 3300042609 | Bacteria | 14100 |
| 92 | Ga0123353_10001319 | 3300010167 | Bacteria | 30425 |
| 93 | Ga0160470_100017 | 3300012813 | Bacteria | 310162 |
| 94 | Ga0160445_100300 | 3300012847 | Bacteria | 30922 |
| 95 | Ga0160457_1002163 | 3300012858 | Bacteria | 4367 |
| 96 | Ga0160457_1002720 | 3300012858 | Bacteria | 3456 |
| 97 | Ga0466710_428615 | 3300042613 | Bacteria | 4604 |
| 98 | Ga0466726_040298 | 3300042619 | Bacteria | 11019 |
| 99 | Ga0466729_080235 | 3300042621 | Bacteria | 12008 |
| 100 | Ga0104045_1005529 | 3300007085 | Bacteria | 6589 |
| 101 | Ga0104045_1022132 | 3300007085 | Bacteria | 2915 |
| 102 | Ga0105005_1028608 | 3300007505 | Bacteria | 6340 |
| 103 | Ga0466705_112180 | 3300042612 | Bacteria | 5601 |
| 104 | Ga0562375_0509 | 3300056856 | Bacteria | 79717 |
| 105 | Ga0466722_068045 | 3300042609 | Bacteria | 5787 |
| 106 | Ga0466731_245518 | 3300042622 | Bacteria | 31974 |
| 107 | Ga0466735_067185 | 3300042624 | Bacteria | 2611 |
| 108 | Ga0466735_212438 | 3300042624 | Bacteria | 11985 |
| 109 | Ga0466730_041141 | 3300042625 | Bacteria | 266815 |
| 110 | Ga0466730_058121 | 3300042625 | Bacteria | 2800 |
| 111 | Ga0466724_08393 | 3300042649 | Unclassified | 2178 |
| 112 | Ga0466724_61903 | 3300042649 | Unclassified | 2036 |
| 113 | Ga0160444_109412 | 3300012841 | Unclassified | 1208 |
| 114 | Ga0160445_101901 | 3300012847 | Bacteria | 5314 |
| 115 | Ga0160443_104190 | 3300012848 | Unclassified | 2231 |
| 116 | Ga0466696_141945 | 3300042596 | Bacteria | 13688 |
| 117 | Ga0466726_273911 | 3300042619 | Bacteria | 2285 |
| 118 | CVPL010W_10002552 | 3300002931 | Bacteria | 21338 |
| 119 | Ga0104050_1202592 | 3300007153 | Bacteria | 1595 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042625 | Ga0466730_053884 | Ga0466730_053884_158762_159412 | 209 |
| 2 | 3300042649 | Ga0466724_08393 | Ga0466724_08393_236_886 | 209 |
| 3 | 3300056814 | Ga0562378_0003 | Ga0562378_0003_233816_234460 | 214 |
| 4 | 3300056856 | Ga0562375_0509 | Ga0562375_0509_66475_67119 | 214 |
| 5 | 3300007505 | Ga0105005_1028608 | Ga0105005_10286086 | 216 |
| 6 | 3300042591 | Ga0466692_173616 | Ga0466692_173616_1399_2049 | 216 |
| 7 | 3300042598 | Ga0466701_011852 | Ga0466701_011852_3551_4201 | 216 |
| 8 | 3300042598 | Ga0466701_031337 | Ga0466701_031337_620_1270 | 216 |
| 9 | 3300042601 | Ga0466707_060703 | Ga0466707_060703_13224_13874 | 216 |
| 10 | 3300042612 | Ga0466705_112180 | Ga0466705_112180_2205_2855 | 216 |
| 11 | 3300042612 | Ga0466705_361197 | Ga0466705_361197_219_869 | 216 |
| 12 | 3300042613 | Ga0466710_428615 | Ga0466710_428615_2114_2764 | 216 |
| 13 | 3300042616 | Ga0466715_040636 | Ga0466715_040636_2891_3541 | 216 |
| 14 | 3300042618 | Ga0466723_082783 | Ga0466723_082783_1855_2505 | 216 |
| 15 | 3300042619 | Ga0466726_273911 | Ga0466726_273911_1059_1709 | 216 |
| 16 | 3300042619 | Ga0466726_454201 | Ga0466726_454201_127_777 | 216 |
| 17 | 3300042621 | Ga0466729_230630 | Ga0466729_230630_442_1092 | 216 |
| 18 | 3300042621 | Ga0466729_286658 | Ga0466729_286658_262_912 | 216 |
| 19 | 3300042622 | Ga0466731_245518 | Ga0466731_245518_18343_18993 | 216 |
| 20 | 3300042643 | Ga0466704_441697 | Ga0466704_441697_7220_7870 | 216 |
| 21 | 3300042649 | Ga0466724_24432 | Ga0466724_24432_1399_2049 | 216 |
| 22 | 3300042649 | Ga0466724_61903 | Ga0466724_61903_1362_2012 | 216 |
| 23 | 3300042655 | Ga0466727_124960 | Ga0466727_124960_12671_13321 | 216 |
| 24 | iso_pr_bacteria | 2695420317 | 2695486824 | 216 |
| 25 | iso_pr_bacteria | 2820762746 | 2820763998 | 216 |
| 26 | iso_pr_bacteria | 2910930387 | 2910933013 | 216 |
| 27 | iso_pr_bacteria | 8100157865 | 8100158929 | 216 |
| 28 | 3300002509 | JGI24699J35502_11134084 | JGI24699J35502_1113408416 | 217 |
| 29 | 3300010049 | Ga0123356_10336210 | Ga0123356_103362102 | 217 |
| 30 | 3300042590 | Ga0466690_221039 | Ga0466690_221039_11137_11790 | 217 |
| 31 | 3300042596 | Ga0466696_197935 | Ga0466696_197935_6262_6915 | 217 |
| 32 | 3300042596 | Ga0466696_367902 | Ga0466696_367902_75_728 | 217 |
| 33 | 3300042599 | Ga0466706_028321 | Ga0466706_028321_58762_59415 | 217 |
| 34 | 3300042600 | Ga0466700_156640 | Ga0466700_156640_10784_11437 | 217 |
| 35 | 3300042601 | Ga0466707_012160 | Ga0466707_012160_5558_6211 | 217 |
| 36 | 3300042601 | Ga0466707_047231 | Ga0466707_047231_20262_20915 | 217 |
| 37 | 3300042601 | Ga0466707_058803 | Ga0466707_058803_7696_8349 | 217 |
| 38 | 3300042602 | Ga0466713_150340 | Ga0466713_150340_39871_40524 | 217 |
| 39 | 3300042606 | Ga0466719_337839 | Ga0466719_337839_271_924 | 217 |
| 40 | 3300042616 | Ga0466715_044290 | Ga0466715_044290_1024_1677 | 217 |
| 41 | 3300042618 | Ga0466723_055263 | Ga0466723_055263_2890_3543 | 217 |
| 42 | 3300042619 | Ga0466726_040298 | Ga0466726_040298_1536_2189 | 217 |
| 43 | 3300042621 | Ga0466729_127362 | Ga0466729_127362_4682_5335 | 217 |
| 44 | 3300042655 | Ga0466727_206335 | Ga0466727_206335_407_1060 | 217 |
| 45 | 3300042656 | Ga0466732_343093 | Ga0466732_343093_2442_3095 | 217 |
| 46 | iso_pr_bacteria | 2940193328 | 2940194637 | 217 |
| 47 | iso_pr_bacteria | 2940336608 | 2940337964 | 217 |
| 48 | 3300002931 | CVPL010W_10002552 | CVPL010W_100025525 | 218 |
| 49 | 3300007085 | Ga0104045_1004504 | Ga0104045_100450411 | 218 |
| 50 | 3300007095 | Ga0102739_1005330 | Ga0102739_10053302 | 218 |
| 51 | 3300007129 | Ga0102734_1003692 | Ga0102734_10036926 | 218 |
| 52 | 3300007153 | Ga0104050_1005461 | Ga0104050_10054612 | 218 |
| 53 | 3300010167 | Ga0123353_10000958 | Ga0123353_1000095811 | 218 |
| 54 | 3300010167 | Ga0123353_10009656 | Ga0123353_100096569 | 218 |
| 55 | 3300010167 | Ga0123353_10054019 | Ga0123353_100540194 | 218 |
| 56 | 3300010167 | Ga0123353_10111496 | Ga0123353_101114964 | 218 |
| 57 | 3300012818 | Ga0160432_100016 | Ga0160432_100016119 | 218 |
| 58 | 3300042593 | Ga0466691_090778 | Ga0466691_090778_5227_5883 | 218 |
| 59 | 3300042602 | Ga0466713_022012 | Ga0466713_022012_35009_35665 | 218 |
| 60 | 3300042609 | Ga0466722_081474 | Ga0466722_081474_6086_6742 | 218 |
| 61 | 3300042621 | Ga0466729_080235 | Ga0466729_080235_10611_11267 | 218 |
| 62 | 3300042623 | Ga0466734_096518 | Ga0466734_096518_1441_2097 | 218 |
| 63 | 3300042624 | Ga0466735_009229 | Ga0466735_009229_278_934 | 218 |
| 64 | 3300042624 | Ga0466735_067185 | Ga0466735_067185_1250_1906 | 218 |
| 65 | 3300042636 | Ga0466703_116178 | Ga0466703_116178_937_1593 | 218 |
| 66 | 3300042643 | Ga0466704_432076 | Ga0466704_432076_4289_4945 | 218 |
| 67 | 3300042649 | Ga0466724_53539 | Ga0466724_53539_18218_18874 | 218 |
| 68 | iso_pr_bacteria | 2579779088 | 2582239540 | 218 |
| 69 | iso_pr_bacteria | 2896321640 | 2896325431 | 218 |
| 70 | iso_pr_bacteria | 2896330536 | 2896330981 | 218 |
| 71 | iso_pr_bacteria | 2896350215 | 2896350688 | 218 |
| 72 | iso_pr_bacteria | 2898741527 | 2898741545 | 218 |
| 73 | iso_pr_bacteria | 2940216256 | 2940216999 | 218 |
| 74 | 3300007085 | Ga0104045_1022132 | Ga0104045_10221323 | 219 |
| 75 | 3300012806 | Ga0160442_100032 | Ga0160442_100032126 | 219 |
| 76 | 3300012813 | Ga0160470_100017 | Ga0160470_100017165 | 219 |
| 77 | 3300012819 | Ga0160468_100066 | Ga0160468_10006621 | 219 |
| 78 | 3300012847 | Ga0160445_100300 | Ga0160445_10030020 | 219 |
| 79 | 3300012847 | Ga0160445_101901 | Ga0160445_1019013 | 219 |
| 80 | 3300012848 | Ga0160443_104190 | Ga0160443_1041904 | 219 |
| 81 | 3300042590 | Ga0466690_152437 | Ga0466690_152437_5005_5664 | 219 |
| 82 | 3300042602 | Ga0466713_039862 | Ga0466713_039862_1754_2413 | 219 |
| 83 | 3300042602 | Ga0466713_061292 | Ga0466713_061292_6825_7484 | 219 |
| 84 | 3300042605 | Ga0466716_180239 | Ga0466716_180239_5719_6378 | 219 |
| 85 | 3300042609 | Ga0466722_068045 | Ga0466722_068045_3201_3860 | 219 |
| 86 | 3300042624 | Ga0466735_212438 | Ga0466735_212438_10647_11306 | 219 |
| 87 | 3300042649 | Ga0466724_34059 | Ga0466724_34059_1477_2136 | 219 |
| 88 | 3300005083 | Ga0068305_10017587 | Ga0068305_1001758726 | 220 |
| 89 | 3300012858 | Ga0160457_1002720 | Ga0160457_10027205 | 220 |
| 90 | 3300042596 | Ga0466696_065759 | Ga0466696_065759_171_833 | 220 |
| 91 | 3300042601 | Ga0466707_017877 | Ga0466707_017877_13473_14135 | 220 |
| 92 | 3300042619 | Ga0466726_458842 | Ga0466726_458842_2479_3141 | 220 |
| 93 | 3300042624 | Ga0466735_023576 | Ga0466735_023576_3291_3953 | 220 |
| 94 | iso_pr_bacteria | 2820183396 | 2820185019 | 220 |
| 95 | 3300000062 | IMNBL1DRAFT_c0034988 | IMNBL1DRAFT_00349882 | 221 |
| 96 | 3300010167 | Ga0123353_10001319 | Ga0123353_1000131918 | 221 |
| 97 | 3300042591 | Ga0466692_156027 | Ga0466692_156027_13987_14652 | 221 |
| 98 | 3300042601 | Ga0466707_273157 | Ga0466707_273157_2827_3492 | 221 |
| 99 | 3300042601 | Ga0466707_365246 | Ga0466707_365246_14760_15425 | 221 |
| 100 | 3300010167 | Ga0123353_10004722 | Ga0123353_1000472213 | 222 |
| 101 | 3300010167 | Ga0123353_10352185 | Ga0123353_103521852 | 222 |
| 102 | 3300042602 | Ga0466713_016871 | Ga0466713_016871_11732_12403 | 223 |
| 103 | 3300042602 | Ga0466713_116260 | Ga0466713_116260_44628_45299 | 223 |
| 104 | 3300042612 | Ga0466705_460495 | Ga0466705_460495_729_1400 | 223 |
| 105 | 3300042615 | Ga0466711_159908 | Ga0466711_159908_157_828 | 223 |
| 106 | 3300042625 | Ga0466730_058121 | Ga0466730_058121_1686_2357 | 223 |
| 107 | 3300042659 | Ga0466733_217517 | Ga0466733_217517_6804_7475 | 223 |
| 108 | iso_pr_bacteria | 2910942425 | 2910945514 | 223 |
| 109 | 3300042590 | Ga0466690_408627 | Ga0466690_408627_145453_146127 | 224 |
| 110 | 3300042599 | Ga0466706_167656 | Ga0466706_167656_21869_22543 | 224 |
| 111 | 3300042636 | Ga0466703_059585 | Ga0466703_059585_2601_3275 | 224 |
| 112 | iso_pr_bacteria | 2695420931 | 2698111842 | 225 |
| 113 | iso_pr_bacteria | 2940244548 | 2940245953 | 225 |
| 114 | iso_pr_bacteria | 2940248789 | 2940249777 | 225 |
| 115 | iso_pr_bacteria | 2940253009 | 2940253852 | 225 |
| 116 | iso_pr_bacteria | 2940257232 | 2940258019 | 225 |
| 117 | 3300007085 | Ga0104045_1079695 | Ga0104045_10796952 | 227 |
| 118 | 3300010167 | Ga0123353_10002361 | Ga0123353_1000236115 | 227 |
| 119 | iso_pr_bacteria | 2864804954 | 2864806480 | 227 |
| 120 | iso_pr_bacteria | 2864840607 | 2864843454 | 227 |
| 121 | iso_pr_bacteria | 2864843793 | 2864845745 | 227 |
| 122 | iso_pr_bacteria | 2864863795 | 2864866641 | 227 |
| 123 | 3300005309 | Ga0074306_1120801 | Ga0074306_11208011 | 228 |
| 124 | iso_pr_bacteria | 2910926975 | 2910927973 | 228 |
| 125 | 3300042606 | Ga0466719_435321 | Ga0466719_435321_2591_3280 | 229 |
| 126 | 3300007150 | Ga0104019_1190021 | Ga0104019_11900211 | 230 |
| 127 | 3300042652 | Ga0466708_048815 | Ga0466708_048815_1286_1978 | 230 |
| 128 | 3300042625 | Ga0466730_041141 | Ga0466730_041141_20808_21503 | 231 |
| 129 | 3300042649 | Ga0466724_04791 | Ga0466724_04791_2884_3579 | 231 |
| 130 | 3300042655 | Ga0466727_125799 | Ga0466727_125799_11759_12454 | 231 |
| 131 | 3300012841 | Ga0160444_109412 | Ga0160444_1094122 | 232 |
| 132 | 3300012846 | Ga0160433_100049 | Ga0160433_10004931 | 232 |
| 133 | 3300012858 | Ga0160457_1002163 | Ga0160457_10021633 | 232 |
| 134 | 3300042649 | Ga0466724_14071 | Ga0466724_14071_2922_3620 | 232 |
| 135 | 3300007078 | Ga0104051_1104453 | Ga0104051_11044532 | 233 |
| 136 | 3300007153 | Ga0104050_1202592 | Ga0104050_12025922 | 233 |
| 137 | 3300042596 | Ga0466696_141945 | Ga0466696_141945_1124_1825 | 233 |
| 138 | 3300042602 | Ga0466713_108668 | Ga0466713_108668_2043_2750 | 235 |
| 139 | 3300042615 | Ga0466711_369266 | Ga0466711_369266_81_791 | 236 |
| 140 | 3300042593 | Ga0466691_130562 | Ga0466691_130562_346_1065 | 239 |
| 141 | 3300042643 | Ga0466704_340727 | Ga0466704_340727_3704_4438 | 244 |
| 142 | 3300042643 | Ga0466704_204908 | Ga0466704_204908_41620_42360 | 246 |
| 143 | 3300007085 | Ga0104045_1005529 | Ga0104045_10055294 | 257 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00005 | ABC_tran | ABC transporter | 57 | 205 | 0.95 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.85 | 0.91 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.