Protein Family IF01627
Metagenome
Isolate
118
Members
56
Samples
107
Scaffolds
215.34
Avg Length
Representative Sequence
- ID
- 3300007068|Ga0103265_1000782|Ga0103265_10007825
- Length
- 225 aa
- Sequence
- MFHKEGAKIILITLTIVVATIFLADYFVAISWLQKTIQIVALVFLLLILQFFRNPKRNIQRDDNHILSPVDGKVVLIQEVFEKEYFKDQRLMVSVFLSPFNVHVTRYALSGEIKYSKYHPGKYLVAWHPKSSEKNERTTVVVDNKVFGEVMYRQIAGAVARRIVNYAKVGTKALQGTDAGFIKFGSRVDLFLPIGTELNVKLGDKVVGAITIIAKKQLFWTQRK*
Sample Types
Isolate
9.3%
Metagenome
90.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
25.9%
Termitidae
24.1%
Formicidae
14.8%
Drosophilidae
7.4%
Unclassified
7.4%
Passalidae
3.7%
Termopsidae
3.7%
Elmidae
3.7%
Cambaridae
1.9%
Daphniidae
1.9%
Tenebrionidae
1.9%
Rhinotermitidae
1.9%
Nephropidae
1.9%
Taxonomy
Archaea
0
Bacteria
109
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2882250448 | Bizionia sp. APA-3 | Isolate | |
| 2 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 3 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 4 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 5 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 6 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 7 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 8 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 9 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 10 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 11 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 12 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 13 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 14 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 15 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 16 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 17 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 18 | 2958471994 | Flavobacterium sp. xlx-221 | Isolate | Cambaridae |
| 19 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 20 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 21 | 2811995047 | Flavobacterium succinicans DD5b | Isolate | Daphniidae |
| 22 | 2894649344 | Allomuricauda alvinocaridis SCR12 | Isolate | Unclassified |
| 23 | 2904728850 | Flavobacterium sp. xlx-214 | Isolate | |
| 24 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 25 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 26 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 27 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 28 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 29 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 30 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 31 | 2820768849 | Unclassified Bacteroidetes Lab288P3bin194 | Isolate | Unclassified |
| 32 | 2820774381 | Unclassified Bacteroidetes Lab288P1bin37 | Isolate | Unclassified |
| 33 | 2899132286 | Myroides albus BIT-d1 | Isolate | Tenebrionidae |
| 34 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 35 | 3300005317 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 2 gut | Metagenome | Drosophilidae |
| 36 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 37 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 38 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 39 | 2838772460 | Aquimarina sp. I32.4 | Isolate | Nephropidae |
| 40 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 41 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 42 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 43 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 44 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 45 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 46 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 47 | 2864878056 | Flavobacterium notoginsengisoli S00128 | Isolate | Elmidae |
| 48 | 2864886855 | Flavobacterium nitrogenifigens S00142 | Isolate | Elmidae |
| 49 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 50 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 51 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 52 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 53 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 54 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 55 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 56 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466704_081375 | 3300042643 | Bacteria | 5805 |
| 2 | Ga0466715_524738 | 3300042616 | Bacteria | 26476 |
| 3 | Ga0466723_086397 | 3300042618 | Bacteria | 25409 |
| 4 | Ga0466728_050752 | 3300042620 | Bacteria | 8047 |
| 5 | Ga0466714_056327 | 3300042603 | Bacteria | 23692 |
| 6 | Ga0466719_071074 | 3300042606 | Bacteria | 2853 |
| 7 | Ga0123353_10000053 | 3300010167 | Bacteria | 130089 |
| 8 | Ga0123353_10563266 | 3300010167 | Bacteria | 1640 |
| 9 | Ga0123353_10674042 | 3300010167 | Bacteria | 1458 |
| 10 | Ga0466705_006350 | 3300042612 | Bacteria | 1079 |
| 11 | Ga0466733_204409 | 3300042659 | Bacteria | 1012 |
| 12 | IMNBL1DRAFT_c0009421 | 3300000062 | Bacteria | 4819 |
| 13 | JGI24702J35022_10527699 | 3300002462 | Unclassified | 726 |
| 14 | Ga0103265_1000782 | 3300007068 | Bacteria | 6140 |
| 15 | Ga0104045_1078236 | 3300007085 | Bacteria | 1422 |
| 16 | Ga0102734_1000489 | 3300007129 | Bacteria | 21509 |
| 17 | Ga0466696_261586 | 3300042596 | Bacteria | 10345 |
| 18 | Ga0466708_117383 | 3300042652 | Bacteria | 20577 |
| 19 | Ga0466708_163465 | 3300042652 | Bacteria | 7277 |
| 20 | Ga0466717_191751 | 3300042604 | Bacteria | 3759 |
| 21 | Ga0466719_375583 | 3300042606 | Bacteria | 2016 |
| 22 | Ga0123353_10177267 | 3300010167 | Bacteria | 3378 |
| 23 | JGI24702J35022_10087087 | 3300002462 | Bacteria | 1696 |
| 24 | JGI24705J35276_12190570 | 3300002504 | Bacteria | 1464 |
| 25 | Ga0102735_1000088 | 3300007080 | Bacteria | 28320 |
| 26 | Ga0102740_1001193 | 3300007140 | Bacteria | 6756 |
| 27 | Ga0102737_1000378 | 3300007142 | Bacteria | 15070 |
| 28 | Ga0466735_104692 | 3300042624 | Bacteria | 8930 |
| 29 | Ga0466701_096699 | 3300042598 | Bacteria | 39572 |
| 30 | Ga0466701_102144 | 3300042598 | Bacteria | 141929 |
| 31 | Ga0123353_10140674 | 3300010167 | Bacteria | 3866 |
| 32 | Ga0466733_008285 | 3300042659 | Bacteria | 2199 |
| 33 | Ga0466733_190460 | 3300042659 | Bacteria | 2013 |
| 34 | Ga0466691_009561 | 3300042593 | Bacteria | 17343 |
| 35 | Ga0466691_031190 | 3300042593 | Unclassified | 6538 |
| 36 | Ga0466703_116375 | 3300042636 | Bacteria | 8634 |
| 37 | Ga0466703_199720 | 3300042636 | Bacteria | 2380 |
| 38 | Ga0466708_120062 | 3300042652 | Bacteria | 20195 |
| 39 | Ga0466711_036320 | 3300042615 | Bacteria | 5772 |
| 40 | Ga0466711_093274 | 3300042615 | Bacteria | 7928 |
| 41 | Ga0466723_139180 | 3300042618 | Bacteria | 9503 |
| 42 | Ga0466723_157059 | 3300042618 | Bacteria | 28946 |
| 43 | Ga0466723_196088 | 3300042618 | Bacteria | 18737 |
| 44 | Ga0466728_050778 | 3300042620 | Bacteria | 2761 |
| 45 | Ga0466728_147191 | 3300042620 | Bacteria | 3547 |
| 46 | Ga0466714_153850 | 3300042603 | Bacteria | 4278 |
| 47 | Ga0466716_302559 | 3300042605 | Bacteria | 1568 |
| 48 | Ga0123356_10165344 | 3300010049 | Bacteria | 2216 |
| 49 | Ga0123356_10399715 | 3300010049 | Bacteria | 1511 |
| 50 | Ga0123353_10078644 | 3300010167 | Bacteria | 5301 |
| 51 | Ga0123354_10110863 | 3300010882 | Unclassified | 3625 |
| 52 | Ga0466733_063151 | 3300042659 | Bacteria | 3864 |
| 53 | Ga0466694_306966 | 3300042594 | Unclassified | 1294 |
| 54 | Ga0466724_08729 | 3300042649 | Bacteria | 294157 |
| 55 | Ga0466726_052290 | 3300042619 | Unclassified | 2036 |
| 56 | Ga0466726_370661 | 3300042619 | Bacteria | 2043 |
| 57 | Ga0466719_003591 | 3300042606 | Unclassified | 1919 |
| 58 | Ga0466719_365578 | 3300042606 | Bacteria | 1825 |
| 59 | Ga0466719_448797 | 3300042606 | Bacteria | 1081 |
| 60 | Ga0466722_063783 | 3300042609 | Bacteria | 23373 |
| 61 | Ga0123356_10470263 | 3300010049 | Bacteria | 1408 |
| 62 | Ga0123353_10566264 | 3300010167 | Bacteria | 1634 |
| 63 | Ga0466697_227524 | 3300042611 | Bacteria | 1135 |
| 64 | Ga0104045_1004815 | 3300007085 | Bacteria | 5498 |
| 65 | Ga0104019_1030782 | 3300007150 | Bacteria | 3925 |
| 66 | Ga0104050_1002809 | 3300007153 | Unclassified | 4927 |
| 67 | Ga0466690_092090 | 3300042590 | Bacteria | 2192 |
| 68 | Ga0466690_095965 | 3300042590 | Bacteria | 3163 |
| 69 | Ga0466690_196358 | 3300042590 | Bacteria | 23413 |
| 70 | Ga0466696_030516 | 3300042596 | Bacteria | 35467 |
| 71 | Ga0466735_144745 | 3300042624 | Bacteria | 5120 |
| 72 | Ga0466735_198625 | 3300042624 | Bacteria | 1490 |
| 73 | Ga0466703_127524 | 3300042636 | Bacteria | 2223 |
| 74 | Ga0466704_029288 | 3300042643 | Bacteria | 4054 |
| 75 | Ga0466711_293585 | 3300042615 | Bacteria | 10612 |
| 76 | Ga0466701_028715 | 3300042598 | Bacteria | 29523 |
| 77 | Ga0466700_040774 | 3300042600 | Bacteria | 25447 |
| 78 | Ga0466716_013565 | 3300042605 | Bacteria | 8664 |
| 79 | Ga0466719_007964 | 3300042606 | Bacteria | 2269 |
| 80 | Ga0466719_207411 | 3300042606 | Bacteria | 1773 |
| 81 | Ga0123353_10068909 | 3300010167 | Bacteria | 5681 |
| 82 | Ga0123353_10381903 | 3300010167 | Bacteria | 2106 |
| 83 | Ga0123354_10436195 | 3300010882 | Bacteria | 1074 |
| 84 | Ga0466705_120372 | 3300042612 | Bacteria | 4805 |
| 85 | Ga0466733_117200 | 3300042659 | Bacteria | 4391 |
| 86 | IMNBGM34_c000167 | 3300000036 | Bacteria | 19497 |
| 87 | IMNBL1DRAFT_c0031599 | 3300000062 | Bacteria | 1923 |
| 88 | JGI24705J35276_12076254 | 3300002504 | Bacteria | 964 |
| 89 | JGI24705J35276_12231022 | 3300002504 | Bacteria | 3804 |
| 90 | CVPL010W_10000117 | 3300002931 | Bacteria | 60114 |
| 91 | Ga0074311_1145622 | 3300005317 | Bacteria | 1290 |
| 92 | Ga0466690_356372 | 3300042590 | Bacteria | 2133 |
| 93 | Ga0466691_014035 | 3300042593 | Bacteria | 10531 |
| 94 | Ga0466696_065668 | 3300042596 | Bacteria | 2317 |
| 95 | Ga0466703_049927 | 3300042636 | Bacteria | 2336 |
| 96 | Ga0466709_051923 | 3300042648 | Bacteria | 6193 |
| 97 | Ga0466715_191352 | 3300042616 | Bacteria | 43892 |
| 98 | Ga0466728_221236 | 3300042620 | Bacteria | 7196 |
| 99 | Ga0466701_034179 | 3300042598 | Bacteria | 18777 |
| 100 | Ga0466707_062433 | 3300042601 | Bacteria | 7276 |
| 101 | Ga0466722_070429 | 3300042609 | Bacteria | 5856 |
| 102 | Ga0466722_231389 | 3300042609 | Bacteria | 11475 |
| 103 | Ga0123356_10308918 | 3300010049 | Bacteria | 1690 |
| 104 | Ga0102739_1000407 | 3300007095 | Bacteria | 9156 |
| 105 | Ga0103268_1000480 | 3300007192 | Unclassified | 12138 |
| 106 | Ga0466703_380963 | 3300042636 | Unclassified | 1799 |
| 107 | Ga0466711_066483 | 3300042615 | Bacteria | 17172 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042619 | Ga0466726_052290 | Ga0466726_052290_705_1361 | 181 |
| 2 | 3300042590 | Ga0466690_196358 | Ga0466690_196358_18679_19332 | 183 |
| 3 | 3300042615 | Ga0466711_093274 | Ga0466711_093274_3331_3984 | 184 |
| 4 | 3300007085 | Ga0104045_1078236 | Ga0104045_10782362 | 191 |
| 5 | 3300002462 | JGI24702J35022_10527699 | JGI24702J35022_105276991 | 193 |
| 6 | 3300042606 | Ga0466719_007964 | Ga0466719_007964_1072_1662 | 196 |
| 7 | 3300042636 | Ga0466703_380963 | Ga0466703_380963_690_1340 | 197 |
| 8 | 3300042636 | Ga0466703_127524 | Ga0466703_127524_1035_1685 | 198 |
| 9 | 3300042618 | Ga0466723_196088 | Ga0466723_196088_1832_2488 | 201 |
| 10 | 3300042590 | Ga0466690_092090 | Ga0466690_092090_1335_1991 | 202 |
| 11 | 3300042593 | Ga0466691_031190 | Ga0466691_031190_1302_1955 | 202 |
| 12 | 3300042612 | Ga0466705_006350 | Ga0466705_006350_40_693 | 202 |
| 13 | 3300042618 | Ga0466723_157059 | Ga0466723_157059_11393_12001 | 202 |
| 14 | 3300042624 | Ga0466735_104692 | Ga0466735_104692_6925_7581 | 202 |
| 15 | 3300042590 | Ga0466690_356372 | Ga0466690_356372_96_707 | 203 |
| 16 | 3300042605 | Ga0466716_302559 | Ga0466716_302559_210_863 | 205 |
| 17 | 3300042652 | Ga0466708_117383 | Ga0466708_117383_11366_12019 | 205 |
| 18 | 3300042636 | Ga0466703_049927 | Ga0466703_049927_815_1468 | 206 |
| 19 | 3300042598 | Ga0466701_034179 | Ga0466701_034179_10422_11075 | 210 |
| 20 | 3300042643 | Ga0466704_081375 | Ga0466704_081375_3826_4479 | 210 |
| 21 | 3300007150 | Ga0104019_1030782 | Ga0104019_10307824 | 211 |
| 22 | 3300042596 | Ga0466696_030516 | Ga0466696_030516_17646_18302 | 213 |
| 23 | 3300000062 | IMNBL1DRAFT_c0009421 | IMNBL1DRAFT_00094213 | 215 |
| 24 | 3300042598 | Ga0466701_096699 | Ga0466701_096699_18618_19265 | 215 |
| 25 | 3300042609 | Ga0466722_063783 | Ga0466722_063783_7893_8540 | 215 |
| 26 | 3300042609 | Ga0466722_070429 | Ga0466722_070429_1740_2387 | 215 |
| 27 | 3300042649 | Ga0466724_08729 | Ga0466724_08729_51481_52128 | 215 |
| 28 | iso_pr_bacteria | 2838772460 | 2838774930 | 215 |
| 29 | 3300042596 | Ga0466696_065668 | Ga0466696_065668_540_1190 | 216 |
| 30 | 3300042603 | Ga0466714_153850 | Ga0466714_153850_674_1324 | 216 |
| 31 | 3300042618 | Ga0466723_086397 | Ga0466723_086397_23042_23692 | 216 |
| 32 | 3300042620 | Ga0466728_050752 | Ga0466728_050752_2138_2788 | 216 |
| 33 | 3300042620 | Ga0466728_147191 | Ga0466728_147191_413_1063 | 216 |
| 34 | 3300042636 | Ga0466703_199720 | Ga0466703_199720_690_1340 | 216 |
| 35 | 3300042652 | Ga0466708_120062 | Ga0466708_120062_15234_15884 | 216 |
| 36 | 3300042659 | Ga0466733_063151 | Ga0466733_063151_699_1349 | 216 |
| 37 | iso_pr_bacteria | 2882250448 | 2882253021 | 216 |
| 38 | iso_pr_bacteria | 2899132286 | 2899132850 | 216 |
| 39 | 3300002931 | CVPL010W_10000117 | CVPL010W_1000011744 | 217 |
| 40 | 3300007080 | Ga0102735_1000088 | Ga0102735_10000888 | 217 |
| 41 | 3300007095 | Ga0102739_1000407 | Ga0102739_10004074 | 217 |
| 42 | 3300007129 | Ga0102734_1000489 | Ga0102734_100048916 | 217 |
| 43 | 3300007140 | Ga0102740_1001193 | Ga0102740_10011934 | 217 |
| 44 | 3300007142 | Ga0102737_1000378 | Ga0102737_10003788 | 217 |
| 45 | 3300007192 | Ga0103268_1000480 | Ga0103268_10004804 | 217 |
| 46 | 3300042590 | Ga0466690_095965 | Ga0466690_095965_778_1431 | 217 |
| 47 | 3300042593 | Ga0466691_009561 | Ga0466691_009561_3972_4625 | 217 |
| 48 | 3300042593 | Ga0466691_014035 | Ga0466691_014035_3969_4622 | 217 |
| 49 | 3300042598 | Ga0466701_028715 | Ga0466701_028715_17346_17999 | 217 |
| 50 | 3300042598 | Ga0466701_102144 | Ga0466701_102144_120283_120936 | 217 |
| 51 | 3300042603 | Ga0466714_056327 | Ga0466714_056327_10808_11461 | 217 |
| 52 | 3300042605 | Ga0466716_013565 | Ga0466716_013565_4203_4856 | 217 |
| 53 | 3300042606 | Ga0466719_003591 | Ga0466719_003591_1008_1661 | 217 |
| 54 | 3300042606 | Ga0466719_071074 | Ga0466719_071074_1468_2121 | 217 |
| 55 | 3300042606 | Ga0466719_207411 | Ga0466719_207411_1054_1707 | 217 |
| 56 | 3300042606 | Ga0466719_365578 | Ga0466719_365578_1121_1774 | 217 |
| 57 | 3300042606 | Ga0466719_375583 | Ga0466719_375583_334_987 | 217 |
| 58 | 3300042609 | Ga0466722_231389 | Ga0466722_231389_4310_4963 | 217 |
| 59 | 3300042616 | Ga0466715_191352 | Ga0466715_191352_20378_21031 | 217 |
| 60 | 3300042616 | Ga0466715_524738 | Ga0466715_524738_3895_4548 | 217 |
| 61 | 3300042618 | Ga0466723_139180 | Ga0466723_139180_3542_4195 | 217 |
| 62 | 3300042619 | Ga0466726_370661 | Ga0466726_370661_405_1058 | 217 |
| 63 | 3300042620 | Ga0466728_050778 | Ga0466728_050778_882_1535 | 217 |
| 64 | 3300042620 | Ga0466728_221236 | Ga0466728_221236_2969_3622 | 217 |
| 65 | 3300042636 | Ga0466703_116375 | Ga0466703_116375_1988_2641 | 217 |
| 66 | 3300042648 | Ga0466709_051923 | Ga0466709_051923_4158_4811 | 217 |
| 67 | 3300042652 | Ga0466708_163465 | Ga0466708_163465_1516_2169 | 217 |
| 68 | iso_pr_bacteria | 2811995047 | 2812945747 | 217 |
| 69 | iso_pr_bacteria | 2820768849 | 2820769985 | 217 |
| 70 | iso_pr_bacteria | 2820774381 | 2820775191 | 217 |
| 71 | iso_pr_bacteria | 2864878056 | 2864881527 | 217 |
| 72 | iso_pr_bacteria | 2864886855 | 2864890327 | 217 |
| 73 | 3300000036 | IMNBGM34_c000167 | IMNBGM34_00016713 | 218 |
| 74 | 3300000062 | IMNBL1DRAFT_c0031599 | IMNBL1DRAFT_00315992 | 218 |
| 75 | 3300007153 | Ga0104050_1002809 | Ga0104050_10028094 | 218 |
| 76 | 3300010167 | Ga0123353_10000053 | Ga0123353_1000005364 | 218 |
| 77 | 3300042594 | Ga0466694_306966 | Ga0466694_306966_263_919 | 218 |
| 78 | 3300042596 | Ga0466696_261586 | Ga0466696_261586_425_1081 | 218 |
| 79 | 3300042611 | Ga0466697_227524 | Ga0466697_227524_402_1058 | 218 |
| 80 | 3300042612 | Ga0466705_120372 | Ga0466705_120372_2378_3034 | 218 |
| 81 | 3300042643 | Ga0466704_029288 | Ga0466704_029288_2806_3462 | 218 |
| 82 | 3300042659 | Ga0466733_117200 | Ga0466733_117200_3093_3749 | 218 |
| 83 | 3300042659 | Ga0466733_204409 | Ga0466733_204409_120_776 | 218 |
| 84 | iso_pr_bacteria | 2904728850 | 2904731542 | 218 |
| 85 | iso_pr_bacteria | 2958471994 | 2958474692 | 218 |
| 86 | 3300002462 | JGI24702J35022_10087087 | JGI24702J35022_100870871 | 219 |
| 87 | 3300002504 | JGI24705J35276_12076254 | JGI24705J35276_120762541 | 219 |
| 88 | 3300002504 | JGI24705J35276_12190570 | JGI24705J35276_121905702 | 219 |
| 89 | 3300010049 | Ga0123356_10165344 | Ga0123356_101653442 | 219 |
| 90 | 3300010049 | Ga0123356_10308918 | Ga0123356_103089182 | 219 |
| 91 | 3300010049 | Ga0123356_10470263 | Ga0123356_104702632 | 219 |
| 92 | 3300010167 | Ga0123353_10068909 | Ga0123353_100689092 | 219 |
| 93 | 3300010167 | Ga0123353_10078644 | Ga0123353_100786443 | 219 |
| 94 | 3300010167 | Ga0123353_10140674 | Ga0123353_101406743 | 219 |
| 95 | 3300010167 | Ga0123353_10177267 | Ga0123353_101772673 | 219 |
| 96 | 3300010167 | Ga0123353_10563266 | Ga0123353_105632662 | 219 |
| 97 | 3300010167 | Ga0123353_10566264 | Ga0123353_105662642 | 219 |
| 98 | 3300010167 | Ga0123353_10674042 | Ga0123353_106740422 | 219 |
| 99 | 3300010882 | Ga0123354_10110863 | Ga0123354_101108633 | 219 |
| 100 | 3300010882 | Ga0123354_10436195 | Ga0123354_104361952 | 219 |
| 101 | 3300042601 | Ga0466707_062433 | Ga0466707_062433_4454_5113 | 219 |
| 102 | 3300042624 | Ga0466735_144745 | Ga0466735_144745_1786_2445 | 219 |
| 103 | 3300042624 | Ga0466735_198625 | Ga0466735_198625_454_1113 | 219 |
| 104 | 3300042659 | Ga0466733_008285 | Ga0466733_008285_424_1083 | 219 |
| 105 | 3300005317 | Ga0074311_1145622 | Ga0074311_11456221 | 220 |
| 106 | 3300007085 | Ga0104045_1004815 | Ga0104045_10048153 | 220 |
| 107 | 3300042600 | Ga0466700_040774 | Ga0466700_040774_14898_15560 | 220 |
| 108 | 3300042615 | Ga0466711_066483 | Ga0466711_066483_12245_12907 | 220 |
| 109 | 3300042606 | Ga0466719_448797 | Ga0466719_448797_64_729 | 221 |
| 110 | 3300042659 | Ga0466733_190460 | Ga0466733_190460_1311_1976 | 221 |
| 111 | iso_pr_bacteria | 2894649344 | 2894651969 | 221 |
| 112 | 3300002504 | JGI24705J35276_12231022 | JGI24705J35276_122310224 | 222 |
| 113 | 3300042604 | Ga0466717_191751 | Ga0466717_191751_1759_2427 | 222 |
| 114 | 3300042615 | Ga0466711_036320 | Ga0466711_036320_2942_3610 | 222 |
| 115 | 3300007068 | Ga0103265_1000782 | Ga0103265_10007825 | 225 |
| 116 | 3300042615 | Ga0466711_293585 | Ga0466711_293585_8978_9706 | 242 |
| 117 | 3300010049 | Ga0123356_10399715 | Ga0123356_103997154 | 249 |
| 118 | 3300010167 | Ga0123353_10381903 | Ga0123353_103819032 | 265 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02666 | PS_Dcarbxylase | Phosphatidylserine decarboxylase | 46 | 213 | 0.96 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.85 | 0.87 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.