Protein Family IF01614

Metagenome Isolate
282 Members
226 Samples
111 Scaffolds
378.97 Avg Length

🧬 Representative Sequence

ID
3300007067|Ga0103266_1000136|Ga0103266_10001367
Length
407 aa
Sequence
MGQACILPACFFRPFFRLLFIVKIIIAPDSFKESLSAADAAQAIAAGVAAACPQAQVHCIPMADGGEGTVAAVLAAVQEKGEWRYTDVHGALDAVSSGAGLRAGWGWLAGQSGDATAVIEMAAAAGLEQTPPASRDPLRASSVGVGELILAALDAGARRIILGLGGSSCNDGGAGMLCALGLRLLDAQGRDLPPGGAALARLARIDASGLDARLRDVAIDIASDVDNPLTGPNGATTIFGPQKGATPAQLVELDAALAHYGALSTQYLGRDFRDAPGAGAAGGLGYAAHAWLGARFRPGVEVVAELGGLADAMAGAALAFTGEGRLDAQTLRGKTPAGVARIAKDAGVPLVALAGSLGDGYEALYEHGLTAAFSLAGGPMDLAQAKRDAAQLLTARARDVTRVWLV*

πŸ“Š Sample Types

Isolate 60.6%
Metagenome 39.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 23.4%
Elmidae 8.6%
Curculionidae 5.7%
Muscidae 5.7%
Termitidae 5.7%
Apidae 5.3%
Anthocoridae 4.8%
Drosophilidae 4.3%
Formicidae 3.8%
Blattidae 3.8%
Culicidae 3.8%
Armadillidiidae 3.3%
Tenebrionidae 3.3%
Kalotermitidae 2.4%
Scarabaeidae 1.9%
Talitridae 1.4%
Cerambycidae 1.4%
Calliphoridae 1.4%
Passalidae 1.0%
Palinuridae 1.0%
Pteromalidae 1.0%
Stratiomyidae 0.5%
Thripidae 0.5%
Anthomyiidae 0.5%
Artemiidae 0.5%
Nephropidae 0.5%
Pentatomidae 0.5%
Crambidae 0.5%
Ceratophyllidae 0.5%
Trigoniulidae 0.5%
Hodotermitidae 0.5%
Daphniidae 0.5%
Siricidae 0.5%
Rhopalidae 0.5%
Penaeidae 0.5%

🌳 Taxonomy

Archaea 0
Bacteria 258
Eukaryota 0
Viruses 0
Unclassified 24

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
2 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
3 2035918003 Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine Metagenome Curculionidae
4 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
5 2518285522 Photorhabdus khanii NC19 Isolate Unclassified
6 2551306507 Vibrio parahaemolyticus PCV08-7 Isolate Unclassified
7 2636415586 Vibrio harveyi NBRC 15634 Isolate Talitridae
8 2667527887 Vibrio harveyi LMG 4044 Isolate Unclassified
9 2971438493 Paenibacillus apiarius NRRL B-23460 Isolate Apidae
10 2978161719 Serratia marcescens KZ2 Isolate Apidae
11 3004364956 Cronobacter sakazakii MOD1-Md5s Isolate Muscidae
12 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
13 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
14 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
15 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
16 3300012828 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG Metagenome
17 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
18 2843904799 Shewanella khirikhana TH2012 Isolate Unclassified
19 2864777284 Aeromonas hydrophila S00023 Isolate Elmidae
20 2864796242 Aeromonas hydrophilia S00040 Isolate Elmidae
21 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
22 2964846109 Cronobacter sakazakii MOD1-Md5g Isolate Muscidae
23 2964859436 Cronobacter sakazakii MOD1-Md40g Isolate Muscidae
24 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
25 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
26 647533136 Enterococcus faecalis Fly1 Isolate Drosophilidae
27 8028002147 Enterobacter sp. 10-1 Isolate Cerambycidae
28 8051534459 Vibrio vulnificus Vv004 Isolate
29 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
30 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
31 2032320009 Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine Metagenome Curculionidae
32 2571042430 Vibrio harveyi NBRC 15634 Isolate Talitridae
33 2731957677 Alkalihalobacillus trypoxylicola NBRC 102646 Isolate Scarabaeidae
34 2791354930 Wohlfahrtiimonas larvae kbl006 Isolate Stratiomyidae
35 2965197371 Serratia sp. OLCL1 Isolate Anthocoridae
36 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
37 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
38 2850895757 Vibrio campbellii 170502 Isolate Unclassified
39 2860776474 Vibrio parahaemolyticus R14 Isolate Unclassified
40 2864843793 Acinetobacter johnsonii S00075 Isolate Elmidae
41 2871760914 Pantoea ananatis PANS 01-2 Isolate Thripidae
42 2872471378 Vibrio owensii V180403 Isolate Unclassified
43 2891720358 Azoarcus nasutitermitis CC-YHH838 Isolate Unclassified
44 2921816052 Cronobacter sakazakii MOD1-Anth48g Isolate Anthomyiidae
45 2922113941 Serratia sp. OLEL1 Isolate Anthocoridae
46 2937427229 Cronobacter malonaticus MOD1-Md99g Isolate Muscidae
47 2937751072 Serratia sp. OLMTLW26 Isolate Anthocoridae
48 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
49 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
50 641736255 Paenibacillus larvae larvae BRL-230010 Isolate Unclassified
51 8022087107 Vibrio sp. OULL4 Isolate Unclassified
52 8022439116 Vibrio sp. ArtGut-C1 Isolate Artemiidae
53 8043041867 Bacillus pumilus Ha06YP001 Isolate Nephropidae
54 8102982778 Erwinia sp. S63 Isolate Curculionidae
55 2571042554 Vibrio owensii CAIM 1854 Isolate Palinuridae
56 2603880165 Burkholderiales A1 Isolate Unclassified
57 2622736579 Desemzia incerta DSM 20581 Isolate Unclassified
58 2971189173 Yersinia pestis A-1249 Isolate Unclassified
59 2990166910 Pseudomonas typographi CA3A Isolate Curculionidae
60 3007478678 Pseudomonas sp. S37 Isolate Curculionidae
61 3300007150 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut Metagenome Drosophilidae
62 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
63 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
64 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
65 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
66 2836755666 Arsenophonus nasoniae FIN Isolate Pteromalidae
67 2846386538 Rahnella sp. AN3-3W3 Isolate Pentatomidae
68 2864751016 Pseudomonas oryzihabitans S00005 Isolate Elmidae
69 2864840607 Acinetobacter johnsonii S00071 Isolate Elmidae
70 2876358570 Cronobacter sakazakii MOD1-Ls15g Isolate Calliphoridae
71 637000219 Pseudomonas entomophila L48 Isolate Unclassified
72 8035326735 Pseudomonas prosekii A2-NA13 Isolate Curculionidae
73 8101680043 Providencia sp. JGM178 Isolate Drosophilidae
74 2510065002 Arsenophonus sp. ArN Isolate Pteromalidae
75 2519899623 Enterobacter sp. Ag1 Isolate Culicidae
76 2531839005 Vibrio harveyi CAIM 1792 Isolate Unclassified
77 2537561600 Salmonella enterica enterica sv. Newport CVM 19443 Isolate Unclassified
78 2588253791 Yokenella regensburgei F. Haas DC-1, ATCC 49455 Isolate Unclassified
79 2593339125 Clostridium sp. 5 Isolate Termitidae
80 2648501158 Vibrio hepatarius DSM 19134 Isolate Unclassified
81 2663763317 Vibrio parahaemolyticus ISF-94-1 Isolate Unclassified
82 2703719239 Serratia marcescens ano1 Isolate Unclassified
83 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
84 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Formicidae
85 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
86 2835335304 Rahnella sp. Larv3_ips Isolate Curculionidae
87 2855798354 Achromobacter insolitus AR476-2 Isolate Crambidae
88 2859315706 Serratia sp. 3ACOL1 Isolate Cerambycidae
89 2864801025 Bacillus aerius S00042 Isolate Elmidae
90 2864926767 Pseudomonas nitritireducens S00179 Isolate Elmidae
91 2876334352 Cronobacter sakazakii MOD1-Md6g Isolate Muscidae
92 2912570088 Vibrio parahaemolyticus CHN25 Isolate
93 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
94 2961206375 Serratia sp. OMLW3 Isolate Anthocoridae
95 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
96 8004285568 Serratia sp. OLHL2 Isolate Anthocoridae
97 8004541719 Serratia marcescens KZ19 Isolate Apidae
98 8004582426 Serratia sp. OSPLW9 Isolate Anthocoridae
99 8035422605 Pseudomonas monteilii CY06 Isolate
100 8051551332 Vibrio vulnificus Vv003 Isolate
101 8077780672 Enterococcus sp. PLM3 Isolate Formicidae
102 2511231129 Vibrio sp. EJY3 Isolate Unclassified
103 2519899622 Pseudomonas sp. Ag1 Isolate Culicidae
104 2524614872 Arsenophonus nasoniae DSM 15247 Isolate Unclassified
105 2529292851 Providencia burhodogranariea DSM 19968 Isolate Drosophilidae
106 2590828840 Clostridium sp. 2 Isolate Termitidae
107 2600255074 Vibrio proteolyticus NBRC 13287 Isolate Unclassified
108 2693429575 Vibrio parahaemolyticus ISF-54-12 Isolate Unclassified
109 2703719240 Serratia marcescens ano2 Isolate Unclassified
110 2967915117 Cronobacter sakazakii MOD1-Lc10g Isolate Calliphoridae
111 2997380424 Vibrio parahaemolyticus MVP1 Isolate Unclassified
112 3007473699 Pseudomonas sp. S30 Isolate Curculionidae
113 2864755708 Massilia timonae S00006 Isolate Elmidae
114 2864863795 Acinetobacter johnsonii S00116 Isolate Elmidae
115 2902451016 Photobacterium leiognathi mandapamensis ajapo.4.1 Isolate Unclassified
116 2905310146 Ligilactobacillus salivarius A3iob Isolate Apidae
117 2908136803 Vibrio owensii 1700302 Isolate Unclassified
118 2957730672 Cronobacter sakazakii MOD1-Md70g Isolate Muscidae
119 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
120 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
121 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
122 640963010 Vibrio harveyi HY01 Isolate Unclassified
123 8001394582 Limnobaculum allomyrinae BWR-B9 Isolate Scarabaeidae
124 8006199443 Yersinia pestis M-1763 Isolate Ceratophyllidae
125 8007215774 Enterococcus sp. BWR-S5 Isolate Scarabaeidae
126 8011357093 Pseudomonas schmalbachii Milli4 Isolate Trigoniulidae
127 8101676404 Providencia sp. JGM172 Isolate Drosophilidae
128 8017458139 Lactobacillus johnsonii CRL1647 Isolate Apidae
129 8114544644 Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 Isolate
130 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
131 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
132 2065487013 Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm Metagenome
133 2574179716 Serratia sp. DD3 Isolate Daphniidae
134 2590828839 Clostridium sp. 1 Isolate Termitidae
135 2597489903 Providencia sneebia DSM 19967 Isolate Drosophilidae
136 2654587515 Vibrio owensii CAIM 1854 Isolate Palinuridae
137 2718217944 Serratia marcescens AS1 Isolate Culicidae
138 2977691992 Cronobacter malonaticus MOD1-Md27g Isolate Muscidae
139 2977745872 Cronobacter sakazakii MOD1-Md1g Isolate Muscidae
140 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
141 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
142 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
143 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
144 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
145 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
146 2827179085 Paenibacillus alvei DSM 29 Isolate Apidae
147 2844251356 Photobacterium leiognathi mandapamensis ajapo.3.1 Isolate Unclassified
148 2849104611 Paenibacillus larvae larvae Eric_IV Isolate Apidae
149 2864764899 Aeromonas fluvialis S00019 Isolate Elmidae
150 2864853652 Pseudomonas rhodesiae S00114 Isolate Elmidae
151 2864985977 Staphylococcus hominis S00278 Isolate Elmidae
152 2880115952 Vibrio parahaemolyticus PB1937 Isolate Unclassified
153 2900349738 Photobacterium lucens CAIM 1938 Isolate Unclassified
154 2940419646 Paenibacillus sp. PastF-4 Isolate Blattidae
155 2961232173 Serratia sp. OLLOLW30 Isolate Anthocoridae
156 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
157 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
158 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
159 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
160 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
161 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
162 8021899934 Acinetobacter sp. AR2-3 Isolate Culicidae
163 8048928574 Photobacterium swingsii CECT 7576 Isolate Unclassified
164 2100351016 Sirex noctilio microbial communities from Pennsylvania, USA - adult community Metagenome Siricidae
165 2667527830 Vibrio parahaemolyticus ISF-29-3 Isolate Unclassified
166 2700989396 Vibrio parahaemolyticus ISF-77-01 Isolate Unclassified
167 2785510762 Vibrio parahaemolyticus VP14 Isolate Unclassified
168 2970335472 Cronobacter muytjensii MOD1-Md1s Isolate Muscidae
169 2978102237 Serratia fonticola AeS1 Isolate Culicidae
170 3300002464 Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 Metagenome Culicidae
171 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
172 3300012806 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG Metagenome
173 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
174 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
175 2836667214 Paenibacillus larvae larvae B-3650 Isolate Apidae
176 2837516909 Rahnella bruchi DSM 27398 Isolate Unclassified
177 2841260384 Providencia alcalifaciens Dmel2 Isolate Drosophilidae
178 2849099867 Paenibacillus larvae larvae ERIC_I Isolate Unclassified
179 2857891623 Gilliamella apicola wkB171 Isolate Apidae
180 2864859030 Chromobacterium alkanivorans S00115 Isolate Elmidae
181 2864874997 Acinetobacter lwoffii S00127 Isolate Elmidae
182 2878947168 Serratia marcescens ADJS-2D_White Isolate Unclassified
183 2896187957 Providencia stuartii Crippen Isolate Calliphoridae
184 2937735258 Serratia marcescens KZ11 Isolate Apidae
185 2940413413 Paenibacillus sp. PastH-3 Isolate Blattidae
186 2961247850 Serratia sp. OLAL2 Isolate Anthocoridae
187 8004307473 Serratia sp. OLIL2 Isolate Anthocoridae
188 8008122225 Vibrio harveyi CAIM 1792 Isolate Unclassified
189 8035321120 Pseudomonas prosekii A2-NA12 Isolate Curculionidae
190 8042061949 Vibrio harveyi Hep-2a-10 Isolate Unclassified
191 2044078006 Dendroctonus frontalis bacterial communities from Mississippi, USA Metagenome Curculionidae
192 2684622551 Vibrio campbellii E1 Isolate Unclassified
193 2731957638 Vibrio harveyi NBRC 15634 Isolate Talitridae
194 2967924226 Cronobacter malonaticus MOD1-Md25g Isolate Muscidae
195 2970322301 Cronobacter sakazakii MOD1-Md33g Isolate Muscidae
196 2996406003 Serratia sp. OLJL1 Isolate Anthocoridae
197 3006190525 Acinetobacter sp. S54 Isolate Curculionidae
198 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
199 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
200 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
201 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
202 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
203 2824588292 Yokenella regensburgei WCD67 Isolate Rhopalidae
204 2847708326 Serratia liquefaciens P2ACOL2 Isolate Cerambycidae
205 2848339753 Ephemeroptericola cinctiostellae F02 Isolate Unclassified
206 2854132136 Gilliamella apicola wkB292 Isolate Apidae
207 2856068565 Cronobacter sakazakii MOD1-Md35s Isolate Muscidae
208 2861449170 Desulfovibrio intestinalis DSM 11275 Isolate Unclassified
209 2864745180 Pseudomonas rhodesiae S00002 Isolate Elmidae
210 2864804954 Acinetobacter johnsonii S00050 Isolate Elmidae
211 2864914039 Chromobacterium alkanivorans S00172 Isolate Elmidae
212 2864988360 Chromobacterium alkanivorans S00296 Isolate Elmidae
213 2875320051 Vibrio parahaemolyticus 160807 Isolate Unclassified
214 2877638525 Vibrio campbellii 1114GL Isolate Penaeidae
215 2877647439 Vibrio parahaemolyticus R13 Isolate Unclassified
216 2902469402 Photobacterium lucens CAIM 1937 Isolate Unclassified
217 2940221333 Paenibacillus sp. PastF-3 Isolate Blattidae
218 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
219 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
220 2940425923 Paenibacillus sp. PastH-4 Isolate Blattidae
221 8007211731 Enterococcus larvae BWM-S5 Isolate Scarabaeidae
222 8022096067 Vibrio sp. SALL6 Isolate Unclassified
223 8051461712 Vibrio vulnificus Vv002 Isolate
224 8052469819 Pseudomonas putida DZ-F23 Isolate
225 8060845732 Vibrio vulnificus Vv006 Isolate
226 8101683685 Providencia sp. JGM181 Isolate Drosophilidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0562379_0100 3300056790 Bacteria 294662
2 Ga0562377_0001 3300056842 Bacteria 5082480
3 Ga0562377_0014 3300056842 Bacteria 1212095
4 Ga0562376_5143 3300056857 Bacteria 9229
5 Ga0562374_0274 3300057007 Bacteria 100745
6 DPOL_contig00322 2035918003 Bacteria 72223
7 Ga0160469_100104 3300012824 Bacteria 130054
8 Ga0160469_100284 3300012824 Bacteria 35180
9 Ga0160441_100068 3300012825 Bacteria 134559
10 Ga0160472_100085 3300012839 Bacteria 150451
11 Ga0466723_300495 3300042618 Bacteria 14323
12 Ga0466730_032447 3300042625 Bacteria 115525
13 Ga0466713_001678 3300042602 Bacteria 81551
14 Ga0466733_141870 3300042659 Bacteria 11427
15 Ga0530661_001183 3300056564 Bacteria 14316
16 Ga0562379_0926 3300056790 Unclassified 42655
17 Ga0562379_1241 3300056790 Unclassified 31318
18 Ga0562375_1128 3300056856 Unclassified 40147
19 Ga0160454_100112 3300012798 Bacteria 100261
20 Meta3P_1001423 3300002464 Unclassified 1956
21 Ga0103266_1000136 3300007067 Bacteria 23718
22 Ga0160453_100105 3300012814 Bacteria 85609
23 Ga0160467_100062 3300012829 Bacteria 159890
24 Ga0160472_100305 3300012839 Bacteria 50196
25 Ga0466723_348583 3300042618 Unclassified 6409
26 Ga0466724_05229 3300042649 Bacteria 33843
27 Ga0466701_055280 3300042598 Bacteria 22188
28 Ga0562379_0001 3300056790 Bacteria 4904077
29 Ga0562379_0069 3300056790 Bacteria 430601
30 Ga0562377_0805 3300056842 Unclassified 42338
31 FGTW_contig30424 2065487013 Bacteria 46135
32 JGI24699J35502_11130535 3300002509 Bacteria 5163
33 Ga0160453_100123 3300012814 Bacteria 78292
34 Ga0160468_100173 3300012819 Bacteria 47688
35 Ga0160433_100031 3300012846 Bacteria 172603
36 Ga0264413_101850 3300024493 Bacteria 4337
37 Ga0466701_096728 3300042598 Bacteria 2787
38 Ga0466713_088144 3300042602 Bacteria 17171
39 Ga0466733_142985 3300042659 Bacteria 32755
40 Ga0562378_1863 3300056814 Unclassified 20499
41 Ga0562377_0119 3300056842 Unclassified 245367
42 Ga0562377_0219 3300056842 Bacteria 141429
43 Ga0160442_100001 3300012806 Bacteria 1594759
44 SPBB_contig10681 2044078006 Bacteria 147815
45 SWWA_contig04381__length_21682___numreads_1035 2100351016 Bacteria 21682
46 IMNBL1DRAFT_c0000607 3300000062 Bacteria 28740
47 CVPL010W_10000175 3300002931 Bacteria 55645
48 CVPL010L_1000495 3300002932 Bacteria 12053
49 Ga0103264_1000010 3300007188 Bacteria 126108
50 Ga0160467_102946 3300012829 Bacteria 3223
51 Ga0160444_104986 3300012841 Unclassified 1783
52 Ga0160433_101743 3300012846 Unclassified 5498
53 Ga0466724_18477 3300042649 Bacteria 32570
54 Ga0466724_50079 3300042649 Bacteria 18697
55 Ga0466701_072699 3300042598 Bacteria 11513
56 Ga0466706_067447 3300042599 Bacteria 5564
57 Ga0562378_2030 3300056814 Bacteria 18727
58 Ga0562376_1102 3300056857 Unclassified 40277
59 Ga0562374_0064 3300057007 Bacteria 350233
60 DPO_contig00990 2032320009 Bacteria 46760
61 SPBB_contig11516 2044078006 Bacteria 90532
62 IMNBL1DRAFT_c0000006 3300000062 Bacteria 247403
63 CVPL010W_10020354 3300002931 Bacteria 7573
64 CVPL005W_1000721 3300002934 Bacteria 11612
65 Ga0063521_1000845 3300003973 Unclassified 10523
66 Ga0102739_1002921 3300007095 Bacteria 2565
67 Ga0103264_1000069 3300007188 Bacteria 85289
68 Ga0160441_100083 3300012825 Bacteria 114325
69 Ga0160431_103321 3300012828 Bacteria 3364
70 Ga0466701_008162 3300042598 Bacteria 138467
71 Ga0466724_04616 3300042649 Unclassified 2865
72 Ga0466724_24119 3300042649 Bacteria 301338
73 Ga0466713_131912 3300042602 Bacteria 29597
74 Ga0466733_120067 3300042659 Bacteria 152095
75 Ga0562376_0180 3300056857 Unclassified 132306
76 Ga0123356_10172378 3300010049 Bacteria 2176
77 DPO_contig00670 2032320009 Bacteria 28519
78 Ga0102735_1000145 3300007080 Bacteria 21702
79 Ga0104045_1011981 3300007085 Bacteria 2856
80 Ga0104019_1031678 3300007150 Unclassified 1875
81 Ga0160452_104428 3300012834 Bacteria 2204
82 Ga0160455_100078 3300012837 Bacteria 160114
83 Ga0466730_007633 3300042625 Bacteria 2096
84 Ga0466704_509831 3300042643 Bacteria 133092
85 Ga0466724_40074 3300042649 Bacteria 90242
86 Ga0466725_248881 3300042654 Bacteria 5542
87 Ga0466713_075796 3300042602 Bacteria 58807
88 Ga0530661_002106 3300056564 Unclassified 8124
89 Ga0562377_0194 3300056842 Unclassified 159163
90 Ga0562375_0025 3300056856 Bacteria 749171
91 Ga0562376_0043 3300056857 Unclassified 318471
92 Ga0160464_100270 3300012805 Unclassified 47707
93 SWWA_contig03468__length_3826___numreads_76 2100351016 Unclassified 3826
94 2227065799 2225789003 Bacteria 3349
95 Ga0123357_10000346 3300009784 Bacteria 43712
96 Ga0160457_1000585 3300012858 Bacteria 14797
97 Ga0466724_05350 3300042649 Bacteria 16299
98 Ga0466705_188833 3300042612 Unclassified 6467
99 Ga0530661_000008 3300056564 Bacteria 327436
100 Ga0562378_2573 3300056814 Unclassified 14453
101 Ga0562377_0165 3300056842 Unclassified 182346
102 Ga0562377_0533 3300056842 Bacteria 59704
103 Ga0562377_0936 3300056842 Bacteria 37241
104 DPOL_contig12797 2035918003 Unclassified 6911
105 Meta3P_1000236 3300002464 Bacteria 24894
106 Ga0160447_101201 3300012849 Bacteria 10340
107 Ga0466693_387689 3300042592 Bacteria 7228
108 Ga0466730_001886 3300042625 Bacteria 7861
109 Ga0466703_425653 3300042636 Bacteria 82792
110 Ga0466709_411005 3300042648 Bacteria 41852
111 Ga0466724_64498 3300042649 Bacteria 13151

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300056814 Ga0562378_1863 Ga0562378_1863_17700_18809 329
2 3300042602 Ga0466713_075796 Ga0466713_075796_57014_58006 330
3 3300007188 Ga0103264_1000069 Ga0103264_100006925 333
4 3300010049 Ga0123356_10172378 Ga0123356_101723782 343
5 3300056842 Ga0562377_0194 Ga0562377_0194_141431_142591 344
6 3300056564 Ga0530661_002106 Ga0530661_002106_1608_2768 346
7 3300056790 Ga0562379_0926 Ga0562379_0926_7753_8913 346
8 3300056790 Ga0562379_1241 Ga0562379_1241_7753_8913 346
9 3300056814 Ga0562378_2573 Ga0562378_2573_182_1342 346
10 3300056842 Ga0562377_0014 Ga0562377_0014_168806_169966 346
11 3300056842 Ga0562377_0119 Ga0562377_0119_103616_104776 346
12 3300056842 Ga0562377_0165 Ga0562377_0165_37928_39088 346
13 3300056842 Ga0562377_0805 Ga0562377_0805_29473_30633 346
14 3300056842 Ga0562377_0936 Ga0562377_0936_19368_20528 346
15 3300056857 Ga0562376_0043 Ga0562376_0043_171993_173153 346
16 3300056857 Ga0562376_1102 Ga0562376_1102_15861_17021 346
17 3300057007 Ga0562374_0064 Ga0562374_0064_170941_172101 346
18 3300056790 Ga0562379_0100 Ga0562379_0100_162280_163440 351
19 3300042599 Ga0466706_067447 Ga0466706_067447_1432_2568 360
20 3300056564 Ga0530661_000008 Ga0530661_000008_231298_232413 363
21 3300042602 Ga0466713_131912 Ga0466713_131912_7938_9083 364
22 3300042659 Ga0466733_141870 Ga0466733_141870_8867_10009 365
23 3300056842 Ga0562377_0533 Ga0562377_0533_23930_25030 366
24 3300056856 Ga0562375_1128 Ga0562375_1128_14315_15415 366
25 3300057007 Ga0562374_0274 Ga0562374_0274_81710_82810 366
26 3300012814 Ga0160453_100123 Ga0160453_10012323 367
27 2044078006 SPBB_contig10681 SPBB_1189150 369
28 2225789003 2227065799 2227422967 369
29 3300000062 IMNBL1DRAFT_c0000006 IMNBL1DRAFT_000000638 370
30 3300007150 Ga0104019_1031678 Ga0104019_10316782 371
31 3300042602 Ga0466713_001678 Ga0466713_001678_23747_24862 371
32 iso_pr_bacteria 8114544644 8114547141 371
33 3300002509 JGI24699J35502_11130535 JGI24699J35502_111305353 372
34 3300042612 Ga0466705_188833 Ga0466705_188833_1950_3104 373
35 iso_pr_bacteria 8007215774 8007218074 374
36 3300042598 Ga0466701_096728 Ga0466701_096728_1124_2269 375
37 iso_pr_bacteria 8007211731 8007212648 375
38 iso_pr_bacteria 2511231129 2511732727 376
39 iso_pr_bacteria 2648501158 2648749406 376
40 iso_pr_bacteria 8017458139 8017459315 376
41 3300007095 Ga0102739_1002921 Ga0102739_10029213 377
42 iso_pr_bacteria 2531839005 2531866766 377
43 iso_pr_bacteria 2571042430 2572512865 377
44 iso_pr_bacteria 2571042554 2572925039 377
45 iso_pr_bacteria 2636415586 2637164189 377
46 iso_pr_bacteria 2654587515 2654659611 377
47 iso_pr_bacteria 2667527887 2669890647 377
48 iso_pr_bacteria 2684622551 2684821753 377
49 iso_pr_bacteria 2731957638 2732530538 377
50 iso_pr_bacteria 2844251356 2844255260 377
51 iso_pr_bacteria 2850895757 2850900811 377
52 iso_pr_bacteria 2864764899 2864767086 377
53 iso_pr_bacteria 2864777284 2864778953 377
54 iso_pr_bacteria 2864796242 2864798439 377
55 iso_pr_bacteria 2872471378 2872475299 377
56 iso_pr_bacteria 2877638525 2877641813 377
57 iso_pr_bacteria 2900349738 2900350853 377
58 iso_pr_bacteria 2902451016 2902451682 377
59 iso_pr_bacteria 2902469402 2902472687 377
60 iso_pr_bacteria 2908136803 2908140306 377
61 iso_pr_bacteria 640963010 641027676 377
62 iso_pr_bacteria 8008122225 8008122399 377
63 iso_pr_bacteria 8042061949 8042062417 377
64 3300007188 Ga0103264_1000010 Ga0103264_100001067 378
65 3300042649 Ga0466724_04616 Ga0466724_04616_334_1470 378
66 iso_pr_bacteria 2519899623 2520393692 378
67 iso_pr_bacteria 2551306507 2553346700 378
68 iso_pr_bacteria 2663763317 2666540066 378
69 iso_pr_bacteria 2667527830 2669649083 378
70 iso_pr_bacteria 2693429575 2693742003 378
71 iso_pr_bacteria 2700989396 2702440744 378
72 iso_pr_bacteria 2785510762 2785800590 378
73 iso_pr_bacteria 2860776474 2860780713 378
74 iso_pr_bacteria 2864751016 2864752551 378
75 iso_pr_bacteria 2875320051 2875324195 378
76 iso_pr_bacteria 2877647439 2877651364 378
77 iso_pr_bacteria 2880115952 2880119619 378
78 iso_pr_bacteria 2891720358 2891722270 378
79 iso_pr_bacteria 2912570088 2912573443 378
80 iso_pr_bacteria 2940221333 2940224412 378
81 iso_pr_bacteria 2971189173 2971189963 378
82 iso_pr_bacteria 2997380424 2997384396 378
83 iso_pr_bacteria 8006199443 8006200550 378
84 iso_pr_bacteria 8022087107 8022088721 378
85 iso_pr_bacteria 8022096067 8022099849 378
86 iso_pr_bacteria 8022439116 8022442204 378
87 iso_pr_bacteria 8051461712 8051464285 378
88 iso_pr_bacteria 8051534459 8051539191 378
89 iso_pr_bacteria 8051551332 8051554603 378
90 iso_pr_bacteria 8060845732 8060849084 378
91 2032320009 DPO_contig00670 DPOB_181530 379
92 2032320009 DPO_contig00990 DPOB_573130 379
93 2065487013 FGTW_contig30424 FGTW_00437390 379
94 3300000062 IMNBL1DRAFT_c0000607 IMNBL1DRAFT_000060718 379
95 3300002934 CVPL005W_1000721 CVPL005W_10007213 379
96 3300012846 Ga0160433_101743 Ga0160433_1017434 379
97 3300012849 Ga0160447_101201 Ga0160447_1012018 379
98 3300042598 Ga0466701_055280 Ga0466701_055280_8862_10001 379
99 3300042625 Ga0466730_001886 Ga0466730_001886_496_1635 379
100 3300042625 Ga0466730_007633 Ga0466730_007633_183_1322 379
101 3300042636 Ga0466703_425653 Ga0466703_425653_17955_19121 379
102 3300042643 Ga0466704_509831 Ga0466704_509831_2329_3495 379
103 3300042649 Ga0466724_05229 Ga0466724_05229_2857_3996 379
104 3300042649 Ga0466724_40074 Ga0466724_40074_65664_66803 379
105 3300042659 Ga0466733_142985 Ga0466733_142985_2390_3529 379
106 3300056564 Ga0530661_001183 Ga0530661_001183_5346_6485 379
107 3300056857 Ga0562376_5143 Ga0562376_5143_5392_6531 379
108 iso_pr_bacteria 2511231129 2511731305 379
109 iso_pr_bacteria 2518285522 2518343636 379
110 iso_pr_bacteria 2537561600 2537927209 379
111 iso_pr_bacteria 2600255074 2600847414 379
112 iso_pr_bacteria 2835335304 2835340207 379
113 iso_pr_bacteria 2836667214 2836667657 379
114 iso_pr_bacteria 2837516909 2837520883 379
115 iso_pr_bacteria 2841260384 2841260761 379
116 iso_pr_bacteria 2846386538 2846388069 379
117 iso_pr_bacteria 2849099867 2849104191 379
118 iso_pr_bacteria 2849104611 2849105023 379
119 iso_pr_bacteria 2864745180 2864749238 379
120 iso_pr_bacteria 2864801025 2864801915 379
121 iso_pr_bacteria 2864853652 2864856429 379
122 iso_pr_bacteria 2864874997 2864875946 379
123 iso_pr_bacteria 2864926767 2864928379 379
124 iso_pr_bacteria 2871760914 2871763495 379
125 iso_pr_bacteria 2896187957 2896188873 379
126 iso_pr_bacteria 2940244548 2940247455 379
127 iso_pr_bacteria 2940248789 2940251690 379
128 iso_pr_bacteria 2940253009 2940255929 379
129 iso_pr_bacteria 2940257232 2940260086 379
130 iso_pr_bacteria 3007478678 3007479650 379
131 iso_pr_bacteria 641736255 641741813 379
132 iso_pr_bacteria 8021899934 8021902882 379
133 iso_pr_bacteria 8035321120 8035321256 379
134 iso_pr_bacteria 8035326735 8035332144 379
135 iso_pr_bacteria 8035422605 8035427839 379
136 iso_pr_bacteria 8043041867 8043044664 379
137 iso_pr_bacteria 8052469819 8052474345 379
138 iso_pr_bacteria 8101676404 8101678766 379
139 iso_pr_bacteria 8101680043 8101683587 379
140 iso_pr_bacteria 8101683685 8101687248 379
141 iso_pr_bacteria 8102982778 8102985468 379
142 2100351016 SWWA_contig04381__length_21682___numreads_1035 SWWA_00993250 380
143 3300003973 Ga0063521_1000845 Ga0063521_10008456 380
144 3300012798 Ga0160454_100112 Ga0160454_10011221 380
145 3300012814 Ga0160453_100105 Ga0160453_10010567 380
146 3300012825 Ga0160441_100083 Ga0160441_100083102 380
147 3300012839 Ga0160472_100085 Ga0160472_10008583 380
148 3300042648 Ga0466709_411005 Ga0466709_411005_27038_28180 380
149 3300042649 Ga0466724_24119 Ga0466724_24119_117697_118839 380
150 3300042649 Ga0466724_50079 Ga0466724_50079_13867_15009 380
151 3300056790 Ga0562379_0001 Ga0562379_0001_1423345_1424487 380
152 3300056814 Ga0562378_2030 Ga0562378_2030_16433_17575 380
153 3300056842 Ga0562377_0001 Ga0562377_0001_4892941_4894083 380
154 3300056857 Ga0562376_0180 Ga0562376_0180_35694_36836 380
155 iso_pr_bacteria 2590828839 2593252622 380
156 iso_pr_bacteria 2590828840 2593259247 380
157 iso_pr_bacteria 2593339125 2595066658 380
158 iso_pr_bacteria 2603880165 2606015620 380
159 iso_pr_bacteria 2905310146 2905310885 380
160 iso_pr_bacteria 2971438493 2971443369 380
161 iso_pr_bacteria 3007473699 3007473871 380
162 iso_pr_bacteria 637000219 638001856 380
163 iso_pr_bacteria 8011357093 8011360533 380
164 iso_pr_bacteria 8048928574 8048929021 380
165 iso_pr_bacteria 8052469819 8052474754 380
166 2035918003 DPOL_contig00322 DPOLB_1503340 381
167 2044078006 SPBB_contig11516 SPBB_308220 381
168 3300002931 CVPL010W_10020354 CVPL010W_100203544 381
169 3300007080 Ga0102735_1000145 Ga0102735_100014512 381
170 3300012841 Ga0160444_104986 Ga0160444_1049862 381
171 3300012846 Ga0160433_100031 Ga0160433_100031108 381
172 3300042598 Ga0466701_072699 Ga0466701_072699_9762_10907 381
173 3300042649 Ga0466724_05350 Ga0466724_05350_11656_12801 381
174 iso_pr_bacteria 2519899622 2520387737 381
175 iso_pr_bacteria 2791354930 2792024438 381
176 iso_pr_bacteria 2827179085 2827185352 381
177 iso_pr_bacteria 2864755708 2864759027 381
178 iso_pr_bacteria 2864804954 2864805915 381
179 iso_pr_bacteria 2864985977 2864988209 381
180 iso_pr_bacteria 3006190525 3006193096 381
181 2035918003 DPOL_contig12797 DPOLB_809530 382
182 3300002464 Meta3P_1001423 Meta3P_10014232 382
183 3300002931 CVPL010W_10000175 CVPL010W_100001759 382
184 3300042625 Ga0466730_032447 Ga0466730_032447_46583_47731 382
185 3300042649 Ga0466724_18477 Ga0466724_18477_17813_18961 382
186 3300056790 Ga0562379_0069 Ga0562379_0069_354094_355242 382
187 3300056842 Ga0562377_0219 Ga0562377_0219_101895_103043 382
188 3300056856 Ga0562375_0025 Ga0562375_0025_180099_181247 382
189 iso_pr_bacteria 2588253791 2588729258 382
190 iso_pr_bacteria 2824588292 2824591154 382
191 iso_pr_bacteria 2847708326 2847709247 382
192 iso_pr_bacteria 2990166910 2990170933 382
193 iso_pr_bacteria 647533136 647747200 382
194 iso_pr_bacteria 8001394582 8001396683 382
195 iso_pr_bacteria 8077780672 8077782811 382
196 3300002932 CVPL010L_1000495 CVPL010L_10004956 383
197 3300012824 Ga0160469_100104 Ga0160469_10010480 383
198 3300042618 Ga0466723_300495 Ga0466723_300495_7104_8255 383
199 3300042618 Ga0466723_348583 Ga0466723_348583_3304_4455 383
200 iso_pr_bacteria 2731957677 2732687642 383
201 iso_pr_bacteria 2836755666 2836758570 383
202 iso_pr_bacteria 2841260384 2841262863 383
203 iso_pr_bacteria 2940413413 2940416749 383
204 iso_pr_bacteria 2940419646 2940423315 383
205 iso_pr_bacteria 2940425923 2940429409 383
206 iso_pr_bacteria 8028002147 8028005839 383
207 3300009784 Ga0123357_10000346 Ga0123357_1000034627 384
208 3300012806 Ga0160442_100001 Ga0160442_100001105 384
209 3300012837 Ga0160455_100078 Ga0160455_10007836 384
210 3300012858 Ga0160457_1000585 Ga0160457_100058511 384
211 3300042592 Ga0466693_387689 Ga0466693_387689_1942_3096 384
212 iso_pr_bacteria 2597489903 2597924083 384
213 iso_pr_bacteria 2856068565 2856069040 384
214 iso_pr_bacteria 2864840607 2864840784 384
215 iso_pr_bacteria 2864843793 2864845166 384
216 iso_pr_bacteria 2864863795 2864863953 384
217 iso_pr_bacteria 2876334352 2876334841 384
218 iso_pr_bacteria 2876358570 2876360953 384
219 iso_pr_bacteria 2921816052 2921816303 384
220 iso_pr_bacteria 2937427229 2937429925 384
221 iso_pr_bacteria 2957730672 2957731544 384
222 iso_pr_bacteria 2964846109 2964849729 384
223 iso_pr_bacteria 2964859436 2964863182 384
224 iso_pr_bacteria 2967915117 2967916999 384
225 iso_pr_bacteria 2967924226 2967924762 384
226 iso_pr_bacteria 2970322301 2970322889 384
227 iso_pr_bacteria 2970335472 2970336479 384
228 iso_pr_bacteria 2977691992 2977695430 384
229 iso_pr_bacteria 2977745872 2977747348 384
230 iso_pr_bacteria 3004364956 3004367456 384
231 3300007085 Ga0104045_1011981 Ga0104045_10119812 385
232 3300024493 Ga0264413_101850 Ga0264413_1018504 385
233 3300042602 Ga0466713_088144 Ga0466713_088144_9632_10789 385
234 iso_pr_bacteria 2529292851 2530235047 385
235 iso_pr_bacteria 2854132136 2854134521 385
236 iso_pr_bacteria 2857891623 2857893769 385
237 iso_pr_bacteria 2574179716 2574246570 386
238 iso_pr_bacteria 2622736579 2623392842 386
239 2100351016 SWWA_contig03468__length_3826___numreads_76 SWWA_01294710 387
240 3300042649 Ga0466724_64498 Ga0466724_64498_277_1440 387
241 iso_pr_bacteria 2703719239 2706049574 387
242 iso_pr_bacteria 2703719240 2706054852 387
243 iso_pr_bacteria 2718217944 2719461441 387
244 iso_pr_bacteria 2861449170 2861450224 387
245 iso_pr_bacteria 2878947168 2878950865 387
246 iso_pr_bacteria 2922113941 2922118174 387
247 iso_pr_bacteria 2937735258 2937736974 387
248 iso_pr_bacteria 2937751072 2937755322 387
249 iso_pr_bacteria 2961206375 2961207383 387
250 iso_pr_bacteria 2961232173 2961235963 387
251 iso_pr_bacteria 2961247850 2961251644 387
252 iso_pr_bacteria 2965197371 2965199505 387
253 iso_pr_bacteria 2978161719 2978164219 387
254 iso_pr_bacteria 2996406003 2996407203 387
255 iso_pr_bacteria 8004285568 8004289913 387
256 iso_pr_bacteria 8004307473 8004311556 387
257 iso_pr_bacteria 8004541719 8004544400 387
258 iso_pr_bacteria 8004582426 8004587327 387
259 3300002464 Meta3P_1000236 Meta3P_10002363 388
260 3300012825 Ga0160441_100068 Ga0160441_100068106 388
261 3300012829 Ga0160467_100062 Ga0160467_100062105 388
262 iso_pr_bacteria 2864859030 2864859472 388
263 iso_pr_bacteria 2864914039 2864914482 388
264 iso_pr_bacteria 2864988360 2864988803 388
265 iso_pr_bacteria 2848339753 2848341415 391
266 3300042654 Ga0466725_248881 Ga0466725_248881_2727_4025 393
267 3300042659 Ga0466733_120067 Ga0466733_120067_45083_46333 394
268 iso_pr_bacteria 2855798354 2855803116 394
269 iso_pr_bacteria 2859315706 2859315800 394
270 iso_pr_bacteria 2978102237 2978105840 394
271 iso_pr_bacteria 2843904799 2843907985 395
272 iso_pr_bacteria 2510065002 2510071991 396
273 iso_pr_bacteria 2524614872 2526113655 396
274 3300042598 Ga0466701_008162 Ga0466701_008162_107826_109031 401
275 3300012819 Ga0160468_100173 Ga0160468_10017319 403
276 3300012829 Ga0160467_102946 Ga0160467_1029462 403
277 3300012834 Ga0160452_104428 Ga0160452_1044282 403
278 3300012805 Ga0160464_100270 Ga0160464_10027040 404
279 3300012824 Ga0160469_100284 Ga0160469_1002848 404
280 3300012828 Ga0160431_103321 Ga0160431_1033213 404
281 3300007067 Ga0103266_1000136 Ga0103266_10001367 407
282 3300012839 Ga0160472_100305 Ga0160472_10030529 426

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02595 Gly_kinase Glycerate kinase family 24 404 0.96

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.89 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.