Protein Family IF01432
Metagenome
Isolate
111
Members
40
Samples
107
Scaffolds
226.86
Avg Length
Representative Sequence
- ID
- 3300005485|Ga0074263_116672|Ga0074263_1166722
- Length
- 257 aa
- Sequence
- MSLLSADVEAPESNPVPASESEGVASQKHGSPPESLRKIRSFVLRGGRLTSAQKRSYDTLSQKFIIPYEAKTLDFTCVFGNGNSVIAEIGFGMGKATAVIAGENPDKNYIGLEIHKPGIGRLLWEIEQRFLSNVRIIEHDAAEVFRNTIPENSLGGVHIFFPDPWPKKRHHKRRLIQRPFTDCIASRLQPGAYIYMVSDWLDYANWALSVFTNTKGLVNEYDGFSPPQSWRPLTSFEKKGLDKKHEIKELFFRRGL*
Sample Types
Isolate
3.6%
Metagenome
96.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
36.8%
Kalotermitidae
34.2%
Rhinotermitidae
10.5%
Unclassified
10.5%
Termopsidae
7.9%
Taxonomy
Archaea
0
Bacteria
108
Eukaryota
0
Viruses
0
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 2 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 3 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 4 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 5 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 6 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 7 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 8 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 9 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 10 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 11 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 12 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 13 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 14 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 15 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 16 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 17 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 18 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 19 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 20 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 21 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 22 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 23 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 24 | 2781125695 | Treponema sp. Th196P4bin30 | Isolate | Unclassified |
| 25 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 26 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 27 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 28 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 29 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 30 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 31 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 32 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 33 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 34 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 35 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 36 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 37 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 38 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 39 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 40 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_395499 | 3300042612 | Bacteria | 5576 |
| 2 | Ga0264413_102457 | 3300024493 | Bacteria | 4958 |
| 3 | Ga0264413_119598 | 3300024493 | Bacteria | 6693 |
| 4 | Ga0466692_061913 | 3300042591 | Bacteria | 2350 |
| 5 | Ga0466696_253917 | 3300042596 | Bacteria | 3460 |
| 6 | Ga0466699_187413 | 3300042597 | Bacteria | 9286 |
| 7 | Ga0466722_210590 | 3300042609 | Bacteria | 3959 |
| 8 | Ga0466729_292391 | 3300042621 | Bacteria | 3119 |
| 9 | Ga0466704_483280 | 3300042643 | Bacteria | 8520 |
| 10 | JGI24699J35502_11036198 | 3300002509 | Bacteria | 1543 |
| 11 | Ga0072941_1010315 | 3300005201 | Bacteria | 17106 |
| 12 | Ga0466705_226441 | 3300042612 | Bacteria | 1022 |
| 13 | Ga0466711_243464 | 3300042615 | Bacteria | 15442 |
| 14 | Ga0466715_186080 | 3300042616 | Bacteria | 25208 |
| 15 | Ga0466715_319193 | 3300042616 | Bacteria | 22348 |
| 16 | Ga0466718_165974 | 3300042617 | Bacteria | 1763 |
| 17 | Ga0466723_126741 | 3300042618 | Bacteria | 12699 |
| 18 | Ga0466726_078571 | 3300042619 | Bacteria | 4158 |
| 19 | Ga0466691_162466 | 3300042593 | Bacteria | 9563 |
| 20 | Ga0466699_243324 | 3300042597 | Bacteria | 3012 |
| 21 | Ga0466699_335948 | 3300042597 | Bacteria | 1354 |
| 22 | Ga0466707_009382 | 3300042601 | Bacteria | 2664 |
| 23 | Ga0466707_318605 | 3300042601 | Bacteria | 2978 |
| 24 | Ga0466720_228121 | 3300042607 | Bacteria | 17025 |
| 25 | Ga0466729_223650 | 3300042621 | Bacteria | 1520 |
| 26 | Ga0466731_357365 | 3300042622 | Bacteria | 2728 |
| 27 | Ga0466703_109750 | 3300042636 | Bacteria | 8265 |
| 28 | Ga0466709_034985 | 3300042648 | Bacteria | 42238 |
| 29 | Ga0072941_1073823 | 3300005201 | Bacteria | 3315 |
| 30 | Ga0466712_110081 | 3300042614 | Bacteria | 2858 |
| 31 | Ga0466715_478365 | 3300042616 | Bacteria | 13111 |
| 32 | Ga0466690_264324 | 3300042590 | Bacteria | 10662 |
| 33 | Ga0466692_115796 | 3300042591 | Bacteria | 13905 |
| 34 | Ga0466699_003085 | 3300042597 | Bacteria | 4185 |
| 35 | Ga0466707_211135 | 3300042601 | Bacteria | 1026 |
| 36 | Ga0466720_062417 | 3300042607 | Bacteria | 24051 |
| 37 | Ga0466722_207501 | 3300042609 | Bacteria | 2652 |
| 38 | Ga0466703_067661 | 3300042636 | Bacteria | 15749 |
| 39 | Ga0466703_316193 | 3300042636 | Bacteria | 7807 |
| 40 | Ga0466704_074664 | 3300042643 | Bacteria | 3491 |
| 41 | Ga0466704_131677 | 3300042643 | Unclassified | 5819 |
| 42 | Ga0466727_145659 | 3300042655 | Bacteria | 2096 |
| 43 | JGI24698J34947_10033652 | 3300002449 | Bacteria | 2687 |
| 44 | Ga0466732_244343 | 3300042656 | Unclassified | 2132 |
| 45 | Ga0466732_330773 | 3300042656 | Bacteria | 5364 |
| 46 | Ga0466732_422332 | 3300042656 | Bacteria | 1269 |
| 47 | Ga0466718_034398 | 3300042617 | Bacteria | 9536 |
| 48 | Ga0466726_457263 | 3300042619 | Bacteria | 1623 |
| 49 | Ga0264413_112065 | 3300024493 | Bacteria | 4683 |
| 50 | Ga0466691_103240 | 3300042593 | Bacteria | 28955 |
| 51 | Ga0466707_265007 | 3300042601 | Bacteria | 1513 |
| 52 | Ga0466720_140148 | 3300042607 | Bacteria | 44679 |
| 53 | Ga0466703_130056 | 3300042636 | Bacteria | 8161 |
| 54 | Ga0466704_142546 | 3300042643 | Bacteria | 8849 |
| 55 | Ga0466704_190238 | 3300042643 | Bacteria | 2797 |
| 56 | AustNasuHG_c1008876 | 3300000089 | Bacteria | 3552 |
| 57 | JGI24698J34947_10021476 | 3300002449 | Bacteria | 3472 |
| 58 | Ga0466726_283744 | 3300042619 | Bacteria | 5140 |
| 59 | Ga0466690_351778 | 3300042590 | Bacteria | 1952 |
| 60 | Ga0466692_115607 | 3300042591 | Bacteria | 16100 |
| 61 | Ga0466696_012669 | 3300042596 | Bacteria | 6516 |
| 62 | Ga0466729_249990 | 3300042621 | Bacteria | 6049 |
| 63 | Ga0466702_151904 | 3300042635 | Bacteria | 3092 |
| 64 | Ga0466702_298707 | 3300042635 | Bacteria | 3232 |
| 65 | Ga0466708_007005 | 3300042652 | Bacteria | 35340 |
| 66 | JGI24695J34938_10001038 | 3300002450 | Bacteria | 25191 |
| 67 | Ga0074263_116672 | 3300005485 | Bacteria | 1705 |
| 68 | Ga0466705_423647 | 3300042612 | Bacteria | 9956 |
| 69 | Ga0456237_0000511 | 3300041968 | Bacteria | 5920 |
| 70 | Ga0466691_085612 | 3300042593 | Bacteria | 13031 |
| 71 | Ga0466707_408320 | 3300042601 | Bacteria | 1136 |
| 72 | Ga0466719_298347 | 3300042606 | Bacteria | 2082 |
| 73 | Ga0466720_100929 | 3300042607 | Bacteria | 3961 |
| 74 | Ga0466720_117121 | 3300042607 | Bacteria | 4007 |
| 75 | Ga0466735_083144 | 3300042624 | Bacteria | 2906 |
| 76 | Ga0466735_108077 | 3300042624 | Bacteria | 19292 |
| 77 | Ga0466702_057818 | 3300042635 | Bacteria | 1760 |
| 78 | Ga0466704_012134 | 3300042643 | Bacteria | 32013 |
| 79 | Ga0466704_488601 | 3300042643 | Bacteria | 1137 |
| 80 | AustNasuHG_c1003301 | 3300000089 | Bacteria | 5824 |
| 81 | JGI24698J34947_10013873 | 3300002449 | Bacteria | 4394 |
| 82 | Ga0072940_1005678 | 3300005200 | Bacteria | 7183 |
| 83 | Ga0264413_102955 | 3300024493 | Bacteria | 5813 |
| 84 | Ga0264413_108839 | 3300024493 | Bacteria | 3140 |
| 85 | Ga0466690_131878 | 3300042590 | Bacteria | 1553 |
| 86 | Ga0466691_072839 | 3300042593 | Bacteria | 28571 |
| 87 | Ga0466707_027657 | 3300042601 | Bacteria | 2275 |
| 88 | Ga0466720_176436 | 3300042607 | Bacteria | 9544 |
| 89 | Ga0466704_101573 | 3300042643 | Bacteria | 3425 |
| 90 | JGI24698J34947_10012454 | 3300002449 | Bacteria | 4661 |
| 91 | JGI24695J34938_10000010 | 3300002450 | Bacteria | 132147 |
| 92 | Ga0072940_1019611 | 3300005200 | Bacteria | 11713 |
| 93 | Ga0466705_334709 | 3300042612 | Unclassified | 7406 |
| 94 | Ga0466712_292431 | 3300042614 | Bacteria | 3590 |
| 95 | Ga0466723_224460 | 3300042618 | Bacteria | 28628 |
| 96 | Ga0466692_056885 | 3300042591 | Bacteria | 2094 |
| 97 | Ga0123356_11431576 | 3300010049 | Bacteria | 851 |
| 98 | Ga0466716_310045 | 3300042605 | Bacteria | 7116 |
| 99 | Ga0466719_120887 | 3300042606 | Bacteria | 1439 |
| 100 | Ga0466719_339686 | 3300042606 | Bacteria | 2582 |
| 101 | Ga0466720_031923 | 3300042607 | Bacteria | 9082 |
| 102 | Ga0466720_045529 | 3300042607 | Bacteria | 15525 |
| 103 | Ga0466735_157246 | 3300042624 | Bacteria | 1124 |
| 104 | Ga0466704_157779 | 3300042643 | Bacteria | 1626 |
| 105 | Ga0466708_224717 | 3300042652 | Bacteria | 42914 |
| 106 | Ga0466708_422316 | 3300042652 | Bacteria | 1769 |
| 107 | AustNasuHG_c1026090 | 3300000089 | Bacteria | 1825 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042615 | Ga0466711_243464 | Ga0466711_243464_253_876 | 207 |
| 2 | 3300042590 | Ga0466690_264324 | Ga0466690_264324_5347_5976 | 209 |
| 3 | 3300042601 | Ga0466707_265007 | Ga0466707_265007_650_1321 | 209 |
| 4 | 3300042618 | Ga0466723_224460 | Ga0466723_224460_15235_15864 | 209 |
| 5 | 3300042624 | Ga0466735_108077 | Ga0466735_108077_16577_17206 | 209 |
| 6 | 3300042643 | Ga0466704_012134 | Ga0466704_012134_16294_16923 | 209 |
| 7 | 3300042643 | Ga0466704_157779 | Ga0466704_157779_640_1269 | 209 |
| 8 | 3300042601 | Ga0466707_408320 | Ga0466707_408320_462_1094 | 210 |
| 9 | 3300042635 | Ga0466702_151904 | Ga0466702_151904_1912_2547 | 211 |
| 10 | 3300042652 | Ga0466708_007005 | Ga0466708_007005_15226_15864 | 212 |
| 11 | iso_pr_bacteria | 2781125637 | 2781281393 | 212 |
| 12 | iso_pr_bacteria | 2781125637 | 2781281861 | 212 |
| 13 | 3300002450 | JGI24695J34938_10001038 | JGI24695J34938_100010387 | 213 |
| 14 | 3300042606 | Ga0466719_298347 | Ga0466719_298347_53_742 | 214 |
| 15 | 3300042619 | Ga0466726_457263 | Ga0466726_457263_178_822 | 214 |
| 16 | 3300042605 | Ga0466716_310045 | Ga0466716_310045_817_1464 | 215 |
| 17 | 3300042606 | Ga0466719_339686 | Ga0466719_339686_541_1239 | 216 |
| 18 | 3300042616 | Ga0466715_186080 | Ga0466715_186080_8698_9351 | 217 |
| 19 | 3300042655 | Ga0466727_145659 | Ga0466727_145659_906_1559 | 217 |
| 20 | 3300042593 | Ga0466691_085612 | Ga0466691_085612_8490_9146 | 218 |
| 21 | 3300042622 | Ga0466731_357365 | Ga0466731_357365_625_1281 | 218 |
| 22 | 3300042635 | Ga0466702_057818 | Ga0466702_057818_351_1007 | 218 |
| 23 | 3300042635 | Ga0466702_298707 | Ga0466702_298707_57_713 | 218 |
| 24 | 3300005201 | Ga0072941_1073823 | Ga0072941_10738232 | 219 |
| 25 | 3300010049 | Ga0123356_11431576 | Ga0123356_114315761 | 219 |
| 26 | 3300041968 | Ga0456237_0000511 | Ga0456237_0000511_1666_2325 | 219 |
| 27 | 3300042596 | Ga0466696_012669 | Ga0466696_012669_527_1186 | 219 |
| 28 | 3300042597 | Ga0466699_003085 | Ga0466699_003085_2534_3193 | 219 |
| 29 | 3300042606 | Ga0466719_120887 | Ga0466719_120887_608_1324 | 219 |
| 30 | iso_pr_bacteria | 2781125695 | 2781439389 | 219 |
| 31 | 3300042590 | Ga0466690_131878 | Ga0466690_131878_654_1316 | 220 |
| 32 | 3300042590 | Ga0466690_351778 | Ga0466690_351778_543_1205 | 220 |
| 33 | 3300042593 | Ga0466691_072839 | Ga0466691_072839_21902_22564 | 220 |
| 34 | 3300042612 | Ga0466705_423647 | Ga0466705_423647_3097_3759 | 220 |
| 35 | 3300042616 | Ga0466715_319193 | Ga0466715_319193_15694_16356 | 220 |
| 36 | 3300042636 | Ga0466703_316193 | Ga0466703_316193_1974_2636 | 220 |
| 37 | 3300042607 | Ga0466720_176436 | Ga0466720_176436_2802_3467 | 221 |
| 38 | 3300042612 | Ga0466705_334709 | Ga0466705_334709_6149_6814 | 221 |
| 39 | 3300042636 | Ga0466703_109750 | Ga0466703_109750_2881_3546 | 221 |
| 40 | 3300042591 | Ga0466692_056885 | Ga0466692_056885_410_1078 | 222 |
| 41 | 3300042601 | Ga0466707_211135 | Ga0466707_211135_102_770 | 222 |
| 42 | iso_pr_bacteria | 2781125644 | 2781294925 | 222 |
| 43 | 3300002450 | JGI24695J34938_10000010 | JGI24695J34938_1000001021 | 223 |
| 44 | 3300042591 | Ga0466692_115607 | Ga0466692_115607_10421_11092 | 223 |
| 45 | 3300042597 | Ga0466699_335948 | Ga0466699_335948_615_1286 | 223 |
| 46 | 3300042612 | Ga0466705_226441 | Ga0466705_226441_18_689 | 223 |
| 47 | 3300042612 | Ga0466705_395499 | Ga0466705_395499_2023_2694 | 223 |
| 48 | 3300042614 | Ga0466712_110081 | Ga0466712_110081_278_949 | 223 |
| 49 | 3300042624 | Ga0466735_083144 | Ga0466735_083144_490_1161 | 223 |
| 50 | 3300042624 | Ga0466735_157246 | Ga0466735_157246_250_921 | 223 |
| 51 | 3300042643 | Ga0466704_074664 | Ga0466704_074664_2537_3208 | 223 |
| 52 | 3300042643 | Ga0466704_131677 | Ga0466704_131677_2288_2959 | 223 |
| 53 | 3300042643 | Ga0466704_142546 | Ga0466704_142546_6275_6946 | 223 |
| 54 | 3300042643 | Ga0466704_483280 | Ga0466704_483280_3043_3714 | 223 |
| 55 | 3300042643 | Ga0466704_488601 | Ga0466704_488601_99_770 | 223 |
| 56 | 3300042601 | Ga0466707_318605 | Ga0466707_318605_484_1158 | 224 |
| 57 | 3300042597 | Ga0466699_187413 | Ga0466699_187413_3406_4083 | 225 |
| 58 | 3300042597 | Ga0466699_243324 | Ga0466699_243324_1517_2194 | 225 |
| 59 | 3300042601 | Ga0466707_027657 | Ga0466707_027657_1344_2021 | 225 |
| 60 | 3300042616 | Ga0466715_478365 | Ga0466715_478365_6363_7040 | 225 |
| 61 | 3300042621 | Ga0466729_249990 | Ga0466729_249990_1332_2009 | 225 |
| 62 | 3300042636 | Ga0466703_067661 | Ga0466703_067661_7840_8517 | 225 |
| 63 | 3300042652 | Ga0466708_224717 | Ga0466708_224717_29810_30487 | 225 |
| 64 | 3300042621 | Ga0466729_223650 | Ga0466729_223650_796_1476 | 226 |
| 65 | 3300042591 | Ga0466692_115796 | Ga0466692_115796_11940_12623 | 227 |
| 66 | 3300042607 | Ga0466720_031923 | Ga0466720_031923_6775_7458 | 227 |
| 67 | 3300042621 | Ga0466729_292391 | Ga0466729_292391_1232_1915 | 227 |
| 68 | 3300002449 | JGI24698J34947_10013873 | JGI24698J34947_100138732 | 228 |
| 69 | 3300002449 | JGI24698J34947_10021476 | JGI24698J34947_100214763 | 228 |
| 70 | 3300002509 | JGI24699J35502_11036198 | JGI24699J35502_110361982 | 228 |
| 71 | 3300042614 | Ga0466712_292431 | Ga0466712_292431_560_1246 | 228 |
| 72 | 3300042619 | Ga0466726_283744 | Ga0466726_283744_2490_3176 | 228 |
| 73 | 3300002449 | JGI24698J34947_10012454 | JGI24698J34947_100124544 | 229 |
| 74 | 3300042656 | Ga0466732_422332 | Ga0466732_422332_298_1047 | 229 |
| 75 | 3300024493 | Ga0264413_112065 | Ga0264413_1120652 | 230 |
| 76 | 3300005201 | Ga0072941_1010315 | Ga0072941_10103153 | 231 |
| 77 | 3300042601 | Ga0466707_009382 | Ga0466707_009382_45_740 | 231 |
| 78 | 3300042617 | Ga0466718_165974 | Ga0466718_165974_717_1412 | 231 |
| 79 | 3300000089 | AustNasuHG_c1026090 | AustNasuHG_10260902 | 232 |
| 80 | 3300002449 | JGI24698J34947_10033652 | JGI24698J34947_100336523 | 232 |
| 81 | 3300042643 | Ga0466704_101573 | Ga0466704_101573_2515_3213 | 232 |
| 82 | 3300042652 | Ga0466708_422316 | Ga0466708_422316_245_949 | 234 |
| 83 | 3300042591 | Ga0466692_061913 | Ga0466692_061913_477_1184 | 235 |
| 84 | 3300042593 | Ga0466691_162466 | Ga0466691_162466_3237_3947 | 236 |
| 85 | 3300042609 | Ga0466722_210590 | Ga0466722_210590_89_799 | 236 |
| 86 | 3300042593 | Ga0466691_103240 | Ga0466691_103240_19963_20676 | 237 |
| 87 | 3300042619 | Ga0466726_078571 | Ga0466726_078571_1669_2382 | 237 |
| 88 | 3300042617 | Ga0466718_034398 | Ga0466718_034398_2917_3633 | 238 |
| 89 | 3300042648 | Ga0466709_034985 | Ga0466709_034985_30592_31308 | 238 |
| 90 | 3300042656 | Ga0466732_244343 | Ga0466732_244343_965_1681 | 238 |
| 91 | 3300024493 | Ga0264413_108839 | Ga0264413_1088392 | 239 |
| 92 | 3300042636 | Ga0466703_130056 | Ga0466703_130056_2223_2942 | 239 |
| 93 | 3300042656 | Ga0466732_330773 | Ga0466732_330773_4423_5142 | 239 |
| 94 | 3300042607 | Ga0466720_062417 | Ga0466720_062417_6687_7412 | 241 |
| 95 | 3300042607 | Ga0466720_140148 | Ga0466720_140148_21539_22264 | 241 |
| 96 | 3300042643 | Ga0466704_190238 | Ga0466704_190238_735_1460 | 241 |
| 97 | 3300005200 | Ga0072940_1019611 | Ga0072940_101961115 | 242 |
| 98 | 3300042596 | Ga0466696_253917 | Ga0466696_253917_439_1167 | 242 |
| 99 | 3300024493 | Ga0264413_102955 | Ga0264413_1029558 | 243 |
| 100 | 3300024493 | Ga0264413_119598 | Ga0264413_1195989 | 243 |
| 101 | 3300042607 | Ga0466720_117121 | Ga0466720_117121_768_1499 | 243 |
| 102 | 3300042607 | Ga0466720_100929 | Ga0466720_100929_2495_3229 | 244 |
| 103 | 3300005200 | Ga0072940_1005678 | Ga0072940_10056787 | 247 |
| 104 | 3300042618 | Ga0466723_126741 | Ga0466723_126741_11216_11959 | 247 |
| 105 | 3300024493 | Ga0264413_102457 | Ga0264413_1024572 | 248 |
| 106 | 3300042607 | Ga0466720_228121 | Ga0466720_228121_2563_3309 | 248 |
| 107 | 3300000089 | AustNasuHG_c1003301 | AustNasuHG_10033018 | 250 |
| 108 | 3300042607 | Ga0466720_045529 | Ga0466720_045529_7442_8197 | 251 |
| 109 | 3300042609 | Ga0466722_207501 | Ga0466722_207501_1765_2520 | 251 |
| 110 | 3300000089 | AustNasuHG_c1008876 | AustNasuHG_10088761 | 257 |
| 111 | 3300005485 | Ga0074263_116672 | Ga0074263_1166722 | 257 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02390 | Methyltransf_4 | Putative methyltransferase | 84 | 250 | 0.94 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.77 | 0.86 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.