Protein Family IF01375

Metagenome Isolate
166 Members
96 Samples
128 Scaffolds
365.68 Avg Length

🧬 Representative Sequence

ID
3300005201|Ga0072941_1365953|Ga0072941_13659531
Length
418 aa
Sequence
MAVMQSFSIIPPGESGITLKIERIFPEANTSGPKNANLAGFLSAGVRWRPISVAQRPDRDFSIEDLLLMVILKSQRDALLSPLQSVSGIVERRHTLPILSNVLLEKRDDTLTLIATDVTVAARKLQDILRSLPDTAPVTLDLDEKRLLVRAGKSRFTLQTLPADDFPRMAITEGAHKTLKVTQREFRTLIGKTQYAMAAQDVRYYLNGLMLMVDGPELRSVATXGHRLAYNSMAISADLERQEMILPRKTVLELNRLLSDSDDSLEITLGANQIRFAFGDIVLVSKLIDGKFPDYERVIPGELTHHMTVHRQALHSAMSRAAILTNDKFHGVRVILGENTLKIIAANAEQEEAEEEIEVQYTGVPLDIGFNVTYLLDVLNNLAGDTVVWSFNDANSSALITMPDNDRFKYVVMPMRI*

📊 Sample Types

Isolate 22.9%
Metagenome 77.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 26.1%
Termitidae 16.3%
Kalotermitidae 15.2%
Formicidae 12.0%
Ixodidae 5.4%
Argasidae 4.3%
Termopsidae 3.3%
Apidae 3.3%
Drosophilidae 3.3%
Rhinotermitidae 3.3%
Passalidae 2.2%
Culicidae 2.2%
Gryllidae 1.1%
Alydidae 1.1%
Hodotermitidae 1.1%

🌳 Taxonomy

Archaea 0
Bacteria 154
Eukaryota 0
Viruses 0
Unclassified 12

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2603880172 Burkholderiales C Isolate Unclassified
2 2671180705 Pseudoalteromonas piscicida S2040 Isolate Unclassified
3 2772190782 Francisella persica ATCC VR-331 Isolate Argasidae
4 3000478755 Entomomonas asaccharolytica F2A Isolate Gryllidae
5 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
6 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
7 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
8 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
9 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
10 2874209778 Francisella tularensis holarctica FT16C-B1 Isolate Ixodidae
11 2902896024 Pseudoalteromonas sp. S1612 Isolate Unclassified
12 2506210010 Francisella tularensis tularensis FSC041 Isolate
13 2506210015 Francisella tularensis holarctica FSC185 Isolate
14 2820084079 Unclassified Proteobacteria Lab288P4bin103 Isolate Unclassified
15 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
16 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
17 3300007149 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut Metagenome Drosophilidae
18 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
19 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
20 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
21 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
22 637000113 Francisella tularensis tularensis FSC 198 Isolate
23 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
24 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
25 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
26 2870361953 Entomomonas moraniae QZS01 Isolate Apidae
27 2871595141 Francisella tularensis 503 Isolate Ixodidae
28 2891720358 Azoarcus nasutitermitis CC-YHH838 Isolate Unclassified
29 2902916284 Pseudoalteromonas rubra S1946 Isolate Unclassified
30 2788500057 Francisella-like endosymbiont F-Om Isolate Argasidae
31 2820050117 Unclassified Proteobacteria Th196P3bin129 Isolate Unclassified
32 2820086750 Unclassified Proteobacteria Lab288P3bin98 Isolate Unclassified
33 2820132692 Unclassified Proteobacteria Emb289P3bin76 Isolate Unclassified
34 2820157249 Unclassified Proteobacteria Cu122P4bin11 Isolate Unclassified
35 2820161938 Unclassified Proteobacteria Cu122P3bin14 Isolate Unclassified
36 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
37 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
38 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
39 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
40 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
41 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
42 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
43 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
44 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
45 2843904799 Shewanella khirikhana TH2012 Isolate Unclassified
46 2687453753 Burkholderiales bacterium B_Cag25 Isolate Unclassified
47 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
48 3300002938 Larval gut metagenome for colony PL005 Metagenome Formicidae
49 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
50 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
51 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
52 2834230000 Pandoraea novymonadis E262 Isolate Unclassified
53 2528768159 Alteromonadaceae bacterium Bs31 Isolate Unclassified
54 2820071837 Unclassified Proteobacteria Nt197P3bin132 Isolate Unclassified
55 2820077244 Unclassified Proteobacteria Lab288P4bin72 Isolate Unclassified
56 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
57 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Formicidae
58 3300007139 Ant gut microbial communities from Cephalotes pellans, Brazil Metagenome Formicidae
59 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
60 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
61 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
62 8024031916 Cupriavidus pauculus BHJ32i Isolate Alydidae
63 2791354885 Francisella endosymbiont of Ornithodoros moubata FLE-Om Isolate Argasidae
64 2806310685 Francisella persica ATCC VR-331 Isolate Argasidae
65 2820047982 Unclassified Proteobacteria Th196P3bin67 Isolate Unclassified
66 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
67 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
68 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
69 3300005309 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 1 gut Metagenome Drosophilidae
70 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
71 3300007153 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut Metagenome Drosophilidae
72 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
73 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
74 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
75 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
76 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
77 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
78 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
79 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
80 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
81 2871564055 Francisella tularensis holarctica FT9C-G7 Isolate Ixodidae
82 2874203443 Francisella tularensis holarctica FT8C-4F Isolate Ixodidae
83 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
84 2687453742 Burkholderiales bacterium B_Cag20 Isolate Unclassified
85 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Formicidae
86 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
87 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
88 2791354884 Francisella endosymbiont of Amblyomma maculatum FLE-Am Isolate Ixodidae
89 2820103659 Unclassified Proteobacteria Emb289P4bin67 Isolate Unclassified
90 2820123897 Unclassified Proteobacteria Emb289P4bin18 Isolate Unclassified
91 2820164216 Unclassified Proteobacteria Cu122P1bin22 Isolate Unclassified
92 3300007141 Ant gut microbial communities from Cephalotes maculatus, Brazil Metagenome Formicidae
93 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
94 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
95 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
96 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466715_343602 3300042616 Bacteria 1781
2 Ga0466728_292145 3300042620 Bacteria 10451
3 Ga0466692_142523 3300042591 Bacteria 9997
4 Ga0466706_282413 3300042599 Bacteria 6525
5 Ga0466707_054320 3300042601 Bacteria 54616
6 Ga0466707_367869 3300042601 Bacteria 1718
7 Ga0466717_111275 3300042604 Bacteria 2067
8 Ga0466722_112339 3300042609 Bacteria 3789
9 Ga0466729_263890 3300042621 Unclassified 4230
10 Ga0466735_092715 3300042624 Bacteria 4096
11 Ga0466703_259944 3300042636 Bacteria 27101
12 Ga0466704_440395 3300042643 Bacteria 4766
13 Ga0466704_441627 3300042643 Bacteria 13322
14 Ga0466725_185922 3300042654 Bacteria 18138
15 CVPL010W_10011167 3300002931 Bacteria 7550
16 Ga0072941_1002102 3300005201 Bacteria 12676
17 Ga0103266_1000318 3300007067 Bacteria 19255
18 Ga0466712_055531 3300042614 Bacteria 4424
19 Ga0466711_259947 3300042615 Bacteria 12551
20 Ga0466729_084932 3300042621 Bacteria 104590
21 Ga0466707_175120 3300042601 Bacteria 20435
22 Ga0466719_263560 3300042606 Bacteria 7051
23 Ga0466734_111112 3300042623 Bacteria 27338
24 Ga0466708_181947 3300042652 Bacteria 11987
25 Ga0466725_035713 3300042654 Bacteria 27389
26 IMNBL1DRAFT_c0002865 3300000062 Bacteria 11567
27 Ga0074278_114570 3300005721 Bacteria 27768
28 Ga0103261_1001266 3300007083 Bacteria 4034
29 Ga0102740_1000253 3300007140 Bacteria 55288
30 Ga0103264_1001792 3300007188 Bacteria 22626
31 Ga0123357_10000155 3300009784 Bacteria 61105
32 Ga0466711_224167 3300042615 Bacteria 2951
33 Ga0466726_082639 3300042619 Bacteria 2281
34 Ga0466729_011795 3300042621 Unclassified 4966
35 Ga0466691_000707 3300042593 Bacteria 9801
36 Ga0466701_014755 3300042598 Bacteria 5785
37 Ga0466719_026538 3300042606 Bacteria 1289
38 Ga0466722_113168 3300042609 Bacteria 4253
39 Ga0466722_128749 3300042609 Bacteria 4571
40 Ga0466734_129726 3300042623 Bacteria 1570
41 Ga0466702_034958 3300042635 Bacteria 3418
42 Ga0466708_215602 3300042652 Bacteria 15739
43 Ga0466725_093902 3300042654 Bacteria 73980
44 2227546574 2225789004 Bacteria 2911
45 Ga0074306_1020492 3300005309 Bacteria 2719
46 Ga0466710_254923 3300042613 Bacteria 4891
47 Ga0466715_227407 3300042616 Bacteria 5453
48 Ga0466726_109562 3300042619 Bacteria 11213
49 Ga0123356_10174098 3300010049 Bacteria 2166
50 Ga0123354_10000178 3300010882 Bacteria 53052
51 Ga0466657_117791 3300042582 Bacteria 208686
52 Ga0466716_221773 3300042605 Bacteria 38218
53 Ga0466719_226570 3300042606 Bacteria 8878
54 Ga0466704_360892 3300042643 Bacteria 6186
55 Ga0466709_131011 3300042648 Bacteria 4830
56 Ga0466708_379955 3300042652 Bacteria 9249
57 HBC_ctgsDRAFT_1000082 3300000333 Bacteria 24348
58 Ga0072941_1365953 3300005201 Bacteria 1797
59 Ga0102736_1000454 3300007052 Bacteria 21362
60 Ga0102736_1005510 3300007052 Unclassified 1614
61 Ga0103260_1004207 3300007139 Unclassified 2220
62 Ga0102737_1001345 3300007142 Unclassified 6936
63 Ga0104040_1042772 3300007149 Unclassified 1389
64 Ga0123357_10000050 3300009784 Bacteria 93540
65 Ga0466705_403146 3300042612 Bacteria 4561
66 Ga0466711_504254 3300042615 Bacteria 36018
67 Ga0466715_143205 3300042616 Bacteria 113538
68 Ga0466723_361554 3300042618 Bacteria 3686
69 Ga0466726_105855 3300042619 Bacteria 3940
70 Ga0466729_191972 3300042621 Bacteria 13642
71 Ga0160460_102993 3300012845 Unclassified 3274
72 Ga0466692_032953 3300042591 Bacteria 10700
73 Ga0466691_216509 3300042593 Bacteria 4242
74 Ga0466719_070793 3300042606 Bacteria 4984
75 Ga0466703_042381 3300042636 Bacteria 10524
76 Ga0466724_18188 3300042649 Bacteria 4343
77 Ga0466708_126712 3300042652 Unclassified 2936
78 Ga0466708_359657 3300042652 Bacteria 31241
79 JGI24702J35022_10001591 3300002462 Bacteria 14048
80 Ga0103266_1006274 3300007067 Bacteria 1504
81 Ga0466715_033333 3300042616 Bacteria 10550
82 Ga0466723_186104 3300042618 Bacteria 14358
83 Ga0123354_10000044 3300010882 Bacteria 93974
84 Ga0160472_100187 3300012839 Bacteria 80370
85 Ga0466696_092686 3300042596 Bacteria 6001
86 Ga0466701_007049 3300042598 Bacteria 22470
87 Ga0466722_019062 3300042609 Bacteria 26115
88 Ga0466708_264321 3300042652 Bacteria 36169
89 CVPL010W_10001199 3300002931 Bacteria 37871
90 Ga0104050_1000859 3300007153 Bacteria 4944
91 Ga0103264_1001113 3300007188 Bacteria 11998
92 Ga0103264_1006536 3300007188 Bacteria 5600
93 Ga0466705_009003 3300042612 Bacteria 28618
94 Ga0466710_229986 3300042613 Bacteria 101001
95 Ga0466715_113616 3300042616 Bacteria 16248
96 Ga0466657_209042 3300042582 Bacteria 4557
97 Ga0466692_053225 3300042591 Bacteria 32811
98 Ga0466706_015935 3300042599 Bacteria 13682
99 Ga0466713_052916 3300042602 Bacteria 3767
100 Ga0466719_020545 3300042606 Bacteria 13069
101 Ga0466704_254151 3300042643 Bacteria 8695
102 Ga0466704_457140 3300042643 Bacteria 2164
103 Ga0466708_129698 3300042652 Bacteria 22151
104 Ga0466725_074889 3300042654 Bacteria 25778
105 Ga0466727_225331 3300042655 Bacteria 8130
106 CVPL005W_1000459 3300002934 Bacteria 36337
107 CVPL005W_1000524 3300002934 Bacteria 22151
108 CVPL005L_10000019 3300002938 Bacteria 97133
109 Ga0102738_1003066 3300007141 Unclassified 2465
110 Ga0102737_1001098 3300007142 Bacteria 7923
111 Ga0103264_1001150 3300007188 Bacteria 11755
112 Ga0466705_191533 3300042612 Unclassified 1630
113 Ga0466710_361075 3300042613 Bacteria 2490
114 Ga0123356_10014197 3300010049 Unclassified 7662
115 Ga0466657_212213 3300042582 Bacteria 50857
116 Ga0466690_339922 3300042590 Bacteria 10336
117 Ga0466691_212251 3300042593 Bacteria 12208
118 Ga0466695_281258 3300042595 Bacteria 5503
119 Ga0466701_090907 3300042598 Bacteria 9317
120 Ga0466717_235491 3300042604 Bacteria 3197
121 Ga0466719_096451 3300042606 Bacteria 7786
122 Ga0466735_213396 3300042624 Bacteria 4128
123 Ga0466709_058772 3300042648 Bacteria 3117
124 JGI24698J34947_10079805 3300002449 Bacteria 1539
125 CVPL010W_10007015 3300002931 Bacteria 11282
126 Ga0072941_1002103 3300005201 Bacteria 4399
127 Ga0102740_1000832 3300007140 Bacteria 8374
128 Ga0102737_1000815 3300007142 Unclassified 9629

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 iso_pr_bacteria 2820077244 2820078514 323
2 3300042619 Ga0466726_082639 Ga0466726_082639_340_1452 326
3 3300010882 Ga0123354_10000178 Ga0123354_1000017815 335
4 3300042606 Ga0466719_020545 Ga0466719_020545_9626_10633 335
5 3300042591 Ga0466692_032953 Ga0466692_032953_4015_5061 337
6 3300042621 Ga0466729_011795 Ga0466729_011795_1462_2574 343
7 3300042621 Ga0466729_263890 Ga0466729_263890_1541_2653 345
8 3300042613 Ga0466710_229986 Ga0466710_229986_38353_39459 346
9 3300002931 CVPL010W_10007015 CVPL010W_100070157 347
10 3300042621 Ga0466729_084932 Ga0466729_084932_100510_101616 348
11 3300007083 Ga0103261_1001266 Ga0103261_10012663 349
12 3300002931 CVPL010W_10001199 CVPL010W_1000119926 350
13 3300002934 CVPL005W_1000524 CVPL005W_100052411 350
14 3300042652 Ga0466708_215602 Ga0466708_215602_11727_12833 350
15 3300007188 Ga0103264_1001792 Ga0103264_100179214 351
16 iso_pr_bacteria 2820132692 2820132971 351
17 3300042591 Ga0466692_053225 Ga0466692_053225_2832_3938 352
18 3300042619 Ga0466726_105855 Ga0466726_105855_371_1477 352
19 3300002931 CVPL010W_10011167 CVPL010W_100111676 355
20 3300007142 Ga0102737_1000815 Ga0102737_10008152 355
21 3300042643 Ga0466704_440395 Ga0466704_440395_1897_3018 355
22 3300042643 Ga0466704_441627 Ga0466704_441627_4177_5298 355
23 3300002934 CVPL005W_1000459 CVPL005W_100045934 356
24 3300042612 Ga0466705_191533 Ga0466705_191533_435_1556 356
25 3300042635 Ga0466702_034958 Ga0466702_034958_1896_3002 357
26 3300042606 Ga0466719_263560 Ga0466719_263560_3143_4249 358
27 3300042618 Ga0466723_186104 Ga0466723_186104_6176_7288 358
28 3300042643 Ga0466704_457140 Ga0466704_457140_897_2018 359
29 3300042602 Ga0466713_052916 Ga0466713_052916_2568_3680 360
30 3300042609 Ga0466722_128749 Ga0466722_128749_3375_4487 360
31 3300042623 Ga0466734_111112 Ga0466734_111112_3028_4131 360
32 3300042652 Ga0466708_126712 Ga0466708_126712_1092_2204 360
33 3300007188 Ga0103264_1001150 Ga0103264_10011509 362
34 3300042591 Ga0466692_142523 Ga0466692_142523_6892_8019 363
35 3300042615 Ga0466711_259947 Ga0466711_259947_5698_6810 365
36 3300007052 Ga0102736_1000454 Ga0102736_100045415 366
37 iso_pr_bacteria 2843904799 2843908502 366
38 3300042582 Ga0466657_212213 Ga0466657_212213_10227_11330 367
39 3300042595 Ga0466695_281258 Ga0466695_281258_2329_3432 367
40 3300042598 Ga0466701_007049 Ga0466701_007049_2550_3653 367
41 3300042598 Ga0466701_014755 Ga0466701_014755_2678_3781 367
42 3300042598 Ga0466701_090907 Ga0466701_090907_5378_6481 367
43 3300042599 Ga0466706_282413 Ga0466706_282413_4716_5819 367
44 3300042604 Ga0466717_111275 Ga0466717_111275_309_1412 367
45 3300042604 Ga0466717_235491 Ga0466717_235491_1770_2873 367
46 3300042613 Ga0466710_254923 Ga0466710_254923_2491_3594 367
47 3300042613 Ga0466710_361075 Ga0466710_361075_622_1725 367
48 3300042649 Ga0466724_18188 Ga0466724_18188_2995_4098 367
49 3300042654 Ga0466725_074889 Ga0466725_074889_4221_5324 367
50 3300042654 Ga0466725_185922 Ga0466725_185922_3495_4598 367
51 iso_pr_bacteria 2506210010 2506290966 367
52 iso_pr_bacteria 2506210015 2506300830 367
53 iso_pr_bacteria 2528768159 2529054147 367
54 iso_pr_bacteria 2772190782 2772998715 367
55 iso_pr_bacteria 2788500057 2789389552 367
56 iso_pr_bacteria 2791354884 2791842223 367
57 iso_pr_bacteria 2791354885 2791844173 367
58 iso_pr_bacteria 2806310685 2807225974 367
59 iso_pr_bacteria 2820123897 2820126040 367
60 iso_pr_bacteria 2820157249 2820157434 367
61 iso_pr_bacteria 2820157249 2820157769 367
62 iso_pr_bacteria 2820161938 2820162205 367
63 iso_pr_bacteria 2820164216 2820164955 367
64 iso_pr_bacteria 2871564055 2871565388 367
65 iso_pr_bacteria 2871595141 2871596745 367
66 iso_pr_bacteria 2874203443 2874204768 367
67 iso_pr_bacteria 2874209778 2874210609 367
68 iso_pr_bacteria 2902896024 2902896749 367
69 iso_pr_bacteria 2902916284 2902919816 367
70 iso_pr_bacteria 637000113 638059494 367
71 3300005309 Ga0074306_1020492 Ga0074306_10204921 368
72 3300005721 Ga0074278_114570 Ga0074278_1145707 368
73 3300007149 Ga0104040_1042772 Ga0104040_10427721 368
74 3300007153 Ga0104050_1000859 Ga0104050_10008593 368
75 3300009784 Ga0123357_10000050 Ga0123357_100000504 368
76 3300010049 Ga0123356_10174098 Ga0123356_101740982 368
77 3300010882 Ga0123354_10000044 Ga0123354_1000004468 368
78 3300042582 Ga0466657_117791 Ga0466657_117791_24579_25685 368
79 3300042582 Ga0466657_209042 Ga0466657_209042_1770_2876 368
80 3300042593 Ga0466691_000707 Ga0466691_000707_5094_6200 368
81 3300042599 Ga0466706_015935 Ga0466706_015935_4770_5876 368
82 3300042601 Ga0466707_175120 Ga0466707_175120_5134_6240 368
83 3300042606 Ga0466719_070793 Ga0466719_070793_1438_2544 368
84 3300042606 Ga0466719_226570 Ga0466719_226570_6918_8024 368
85 3300042614 Ga0466712_055531 Ga0466712_055531_3059_4165 368
86 3300042615 Ga0466711_224167 Ga0466711_224167_641_1747 368
87 3300042615 Ga0466711_504254 Ga0466711_504254_19738_20844 368
88 3300042616 Ga0466715_033333 Ga0466715_033333_2885_3991 368
89 3300042616 Ga0466715_113616 Ga0466715_113616_10522_11628 368
90 3300042616 Ga0466715_143205 Ga0466715_143205_20026_21132 368
91 3300042620 Ga0466728_292145 Ga0466728_292145_2994_4100 368
92 3300042623 Ga0466734_129726 Ga0466734_129726_427_1533 368
93 3300042636 Ga0466703_259944 Ga0466703_259944_4728_5834 368
94 3300042652 Ga0466708_129698 Ga0466708_129698_796_1902 368
95 3300042652 Ga0466708_181947 Ga0466708_181947_10523_11629 368
96 3300042652 Ga0466708_264321 Ga0466708_264321_29910_31016 368
97 3300042652 Ga0466708_359657 Ga0466708_359657_14422_15528 368
98 3300042654 Ga0466725_035713 Ga0466725_035713_13754_14860 368
99 3300042654 Ga0466725_093902 Ga0466725_093902_14497_15603 368
100 iso_pr_bacteria 2671180705 2673870627 368
101 iso_pr_bacteria 2820050117 2820050199 368
102 iso_pr_bacteria 2820071837 2820072492 368
103 iso_pr_bacteria 2820084079 2820084370 368
104 iso_pr_bacteria 2820086750 2820088306 368
105 3300000062 IMNBL1DRAFT_c0002865 IMNBL1DRAFT_00028652 369
106 3300002449 JGI24698J34947_10079805 JGI24698J34947_100798052 369
107 3300002462 JGI24702J35022_10001591 JGI24702J35022_100015919 369
108 3300005201 Ga0072941_1002103 Ga0072941_10021033 369
109 3300010049 Ga0123356_10014197 Ga0123356_100141973 369
110 3300042601 Ga0466707_054320 Ga0466707_054320_39019_40128 369
111 3300042606 Ga0466719_026538 Ga0466719_026538_99_1208 369
112 3300042616 Ga0466715_227407 Ga0466715_227407_4209_5318 369
113 3300042624 Ga0466735_092715 Ga0466735_092715_2584_3693 369
114 iso_pr_bacteria 2820047982 2820048742 369
115 iso_pr_bacteria 2820103659 2820104199 369
116 iso_pr_bacteria 2834230000 2834230673 369
117 iso_pr_bacteria 2870361953 2870364516 369
118 iso_pr_bacteria 2891720358 2891722454 369
119 iso_pr_bacteria 3000478755 3000478756 369
120 2225789004 2227546574 2228072517 370
121 3300000333 HBC_ctgsDRAFT_1000082 HBC_ctgsDRAFT_100008217 370
122 3300009784 Ga0123357_10000155 Ga0123357_1000015537 370
123 3300042593 Ga0466691_212251 Ga0466691_212251_5282_6394 370
124 3300042593 Ga0466691_216509 Ga0466691_216509_1850_2962 370
125 3300042596 Ga0466696_092686 Ga0466696_092686_929_2041 370
126 3300042601 Ga0466707_367869 Ga0466707_367869_292_1404 370
127 3300042605 Ga0466716_221773 Ga0466716_221773_13120_14232 370
128 3300042606 Ga0466719_096451 Ga0466719_096451_5076_6188 370
129 3300042609 Ga0466722_112339 Ga0466722_112339_2027_3139 370
130 3300042609 Ga0466722_113168 Ga0466722_113168_2343_3455 370
131 3300042612 Ga0466705_403146 Ga0466705_403146_209_1321 370
132 3300042616 Ga0466715_343602 Ga0466715_343602_479_1591 370
133 3300042619 Ga0466726_109562 Ga0466726_109562_4362_5474 370
134 3300042621 Ga0466729_191972 Ga0466729_191972_6710_7822 370
135 3300042624 Ga0466735_213396 Ga0466735_213396_199_1311 370
136 3300042643 Ga0466704_254151 Ga0466704_254151_3943_5055 370
137 3300042648 Ga0466709_058772 Ga0466709_058772_792_1904 370
138 3300042648 Ga0466709_131011 Ga0466709_131011_1509_2621 370
139 3300042652 Ga0466708_379955 Ga0466708_379955_7406_8518 370
140 3300042655 Ga0466727_225331 Ga0466727_225331_1468_2580 370
141 iso_pr_bacteria 2603880172 2606033448 370
142 iso_pr_bacteria 2687453742 2689988580 370
143 iso_pr_bacteria 2687453753 2690038772 370
144 3300005201 Ga0072941_1002102 Ga0072941_10021023 371
145 3300007067 Ga0103266_1000318 Ga0103266_10003182 371
146 3300007139 Ga0103260_1004207 Ga0103260_10042072 371
147 3300007140 Ga0102740_1000253 Ga0102740_100025329 371
148 3300007141 Ga0102738_1003066 Ga0102738_10030662 371
149 3300007142 Ga0102737_1001345 Ga0102737_10013452 371
150 3300007188 Ga0103264_1001113 Ga0103264_100111311 371
151 3300042609 Ga0466722_019062 Ga0466722_019062_12547_13662 371
152 3300042612 Ga0466705_009003 Ga0466705_009003_21178_22293 371
153 3300042636 Ga0466703_042381 Ga0466703_042381_191_1306 371
154 3300042643 Ga0466704_360892 Ga0466704_360892_1881_2996 371
155 iso_pr_bacteria 8024031916 8024031917 371
156 3300012839 Ga0160472_100187 Ga0160472_10018711 372
157 3300012845 Ga0160460_102993 Ga0160460_1029932 372
158 3300002938 CVPL005L_10000019 CVPL005L_1000001934 373
159 3300007052 Ga0102736_1005510 Ga0102736_10055102 373
160 3300007067 Ga0103266_1006274 Ga0103266_10062742 373
161 3300007188 Ga0103264_1006536 Ga0103264_10065362 373
162 3300007140 Ga0102740_1000832 Ga0102740_10008324 374
163 3300007142 Ga0102737_1001098 Ga0102737_10010982 374
164 3300042590 Ga0466690_339922 Ga0466690_339922_1611_2753 380
165 3300042618 Ga0466723_361554 Ga0466723_361554_2270_3517 415
166 3300005201 Ga0072941_1365953 Ga0072941_13659531 418

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02768 DNA_pol3_beta_3 DNA polymerase III beta subunit, C-terminal domain 297 416 0.99
PF02767 DNA_pol3_beta_2 DNA polymerase III beta subunit, central domain 181 294 0.98
PF00712 DNA_pol3_beta DNA polymerase III beta subunit, N-terminal domain 118 169 0.97

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.7 0.78 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.