Protein Family IF01368

Metagenome Isolate
137 Members
48 Samples
134 Scaffolds
278.62 Avg Length

🧬 Representative Sequence

ID
3300005201|Ga0072941_1243860|Ga0072941_12438602
Length
329 aa
Sequence
MKKMFKTLHGIESFFLYPHNLLQNYEKFPFVLNFSNKCCTFVRFFITNMKQTQHFYIDVQEILREKAPHTADKTPSFVVKALSKIIHQNEINQFLKESEGATGVDFMNHAVDFFNLRFNIVGEDNLPDFDNKCIFASNHPLGGPDGISLASFLGNRYGHRIKYIVNDILYFLQPLQSIFVPVNKHGEQGRSAAKLLNDSFASEDQILTFPAGLCSRKIKGKICDLDWKKMFVVKAVEYQRNVVPVYFEAKNSRFFYAIANLRRLFKVKFNIEMLFLPHELFKIKRSKRSTFTIYFGKPIPWQTFDSSKSPQQWTDWVKQTVYNLNGKK*

📊 Sample Types

Isolate 2.2%
Metagenome 97.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 42.6%
Kalotermitidae 29.8%
Unclassified 8.5%
Termopsidae 6.4%
Rhinotermitidae 6.4%
Blattidae 4.3%
Hodotermitidae 2.1%

🌳 Taxonomy

Archaea 0
Bacteria 130
Eukaryota 0
Viruses 0
Unclassified 7

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
2 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
3 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
4 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
5 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
6 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
7 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
8 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
9 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
10 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
11 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
12 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
13 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
14 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
15 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
16 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
17 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
18 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
19 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
20 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
21 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
22 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
23 2910926975 Dysgonomonas sp. 25 Isolate Blattidae
24 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
25 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
26 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
27 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
28 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
29 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
30 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
31 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
32 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
33 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
34 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
35 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
36 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
37 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
38 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
39 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
40 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
41 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
42 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
43 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
44 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
45 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
46 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
47 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
48 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_372178 3300042612 Bacteria 6400
2 Ga0466700_005213 3300042600 Bacteria 12166
3 Ga0466707_287995 3300042601 Unclassified 3216
4 Ga0466714_039715 3300042603 Bacteria 1270
5 Ga0466714_159167 3300042603 Bacteria 6826
6 Ga0466716_174213 3300042605 Bacteria 2307
7 Ga0466716_223899 3300042605 Bacteria 2290
8 Ga0466719_059687 3300042606 Bacteria 12859
9 Ga0466715_357754 3300042616 Bacteria 33665
10 Ga0466726_050555 3300042619 Bacteria 2293
11 Ga0466726_073698 3300042619 Bacteria 5973
12 Ga0123357_10051110 3300009784 Bacteria 5590
13 Ga0466704_512771 3300042643 Bacteria 9386
14 Ga0466708_138620 3300042652 Bacteria 12149
15 Ga0466727_137119 3300042655 Bacteria 2254
16 JGI24695J34938_10071719 3300002450 Bacteria 1446
17 Ga0068305_10033366 3300005083 Bacteria 9897
18 Ga0466690_034574 3300042590 Bacteria 15477
19 Ga0466690_434293 3300042590 Bacteria 6161
20 Ga0466707_054338 3300042601 Bacteria 5942
21 Ga0466714_071171 3300042603 Bacteria 8163
22 Ga0466719_280972 3300042606 Bacteria 5448
23 Ga0466697_047479 3300042611 Bacteria 73888
24 Ga0466715_307695 3300042616 Bacteria 18061
25 Ga0466728_311970 3300042620 Bacteria 3523
26 Ga0466729_175636 3300042621 Bacteria 14158
27 Ga0123357_10025848 3300009784 Bacteria 7925
28 Ga0123356_10228717 3300010049 Bacteria 1922
29 Ga0123354_10010911 3300010882 Bacteria 14018
30 Ga0123354_10171615 3300010882 Bacteria 2520
31 Ga0123354_10366774 3300010882 Unclassified 1262
32 Ga0466703_027233 3300042636 Bacteria 2689
33 Ga0466704_142532 3300042643 Bacteria 7952
34 Ga0466704_322171 3300042643 Bacteria 8368
35 Ga0466727_050078 3300042655 Bacteria 14037
36 JGI24702J35022_10008813 3300002462 Bacteria 5693
37 Ga0068305_10104738 3300005083 Bacteria 7226
38 Ga0068305_10109873 3300005083 Bacteria 10062
39 Ga0068305_10284306 3300005083 Bacteria 1907
40 Ga0123357_10002573 3300009784 Bacteria 20350
41 Ga0466697_254209 3300042611 Bacteria 2781
42 Ga0466690_019839 3300042590 Bacteria 17453
43 Ga0466696_102295 3300042596 Bacteria 4407
44 Ga0466717_302323 3300042604 Bacteria 1850
45 Ga0466716_090621 3300042605 Bacteria 10421
46 Ga0466711_478228 3300042615 Bacteria 14896
47 Ga0466726_149087 3300042619 Bacteria 6832
48 Ga0123356_10331775 3300010049 Bacteria 1638
49 Ga0123353_10142406 3300010167 Unclassified 3839
50 Ga0123353_10449557 3300010167 Bacteria 1897
51 Ga0123354_10135542 3300010882 Unclassified 3081
52 Ga0123354_10172327 3300010882 Bacteria 2512
53 Ga0466709_326213 3300042648 Bacteria 2816
54 Ga0466725_036706 3300042654 Bacteria 4211
55 JGI24702J35022_10111807 3300002462 Bacteria 1502
56 JGI24705J35276_12144525 3300002504 Bacteria 1155
57 Ga0072941_1243860 3300005201 Bacteria 2012
58 Ga0072941_1564361 3300005201 Bacteria 867
59 Ga0466696_274193 3300042596 Bacteria 2858
60 Ga0466696_444495 3300042596 Bacteria 11679
61 Ga0466713_021200 3300042602 Bacteria 9214
62 Ga0466717_017801 3300042604 Bacteria 1966
63 Ga0466723_354948 3300042618 Bacteria 23912
64 Ga0123357_10216796 3300009784 Unclassified 2134
65 Ga0466703_004065 3300042636 Bacteria 3948
66 Ga0466709_279392 3300042648 Bacteria 3466
67 Ga0466656_113263 3300042550 Bacteria 33316
68 Ga0466713_089856 3300042602 Bacteria 11701
69 Ga0466726_255530 3300042619 Bacteria 1020
70 Ga0466728_168100 3300042620 Bacteria 21352
71 Ga0123357_10102512 3300009784 Bacteria 3684
72 Ga0123353_10139025 3300010167 Bacteria 3893
73 Ga0123354_10087805 3300010882 Bacteria 4332
74 Ga0466735_007097 3300042624 Bacteria 4390
75 Ga0466703_202519 3300042636 Bacteria 22773
76 Ga0466704_378524 3300042643 Bacteria 1141
77 Ga0466709_376503 3300042648 Bacteria 12791
78 Ga0466727_176346 3300042655 Bacteria 17609
79 JGI24699J35502_11134096 3300002509 Bacteria 30204
80 Ga0123357_10003534 3300009784 Bacteria 17964
81 Ga0466697_068071 3300042611 Bacteria 1404
82 Ga0466657_170521 3300042582 Bacteria 1120
83 Ga0466692_064946 3300042591 Bacteria 2358
84 Ga0466701_093074 3300042598 Bacteria 1597
85 Ga0466713_034207 3300042602 Bacteria 23348
86 Ga0466698_345727 3300042610 Bacteria 4641
87 Ga0466710_449550 3300042613 Bacteria 2146
88 Ga0466712_196457 3300042614 Bacteria 1034
89 Ga0466711_248904 3300042615 Bacteria 12581
90 Ga0466711_285989 3300042615 Bacteria 7430
91 Ga0466715_039490 3300042616 Bacteria 5544
92 Ga0123357_10014331 3300009784 Bacteria 10340
93 Ga0466735_090148 3300042624 Bacteria 4650
94 Ga0466703_048823 3300042636 Bacteria 16130
95 Ga0466703_178721 3300042636 Bacteria 4856
96 JGI24699J35502_11133304 3300002509 Bacteria 9709
97 Ga0466690_315922 3300042590 Unclassified 1060
98 Ga0466692_050164 3300042591 Bacteria 17757
99 Ga0466691_103514 3300042593 Bacteria 21087
100 Ga0466701_005269 3300042598 Bacteria 2486
101 Ga0466706_121373 3300042599 Bacteria 45048
102 Ga0466713_085895 3300042602 Bacteria 8607
103 Ga0466717_172285 3300042604 Bacteria 3739
104 Ga0466716_103170 3300042605 Bacteria 1877
105 Ga0466722_248749 3300042609 Bacteria 1544
106 Ga0466710_174493 3300042613 Bacteria 17548
107 Ga0466711_347465 3300042615 Unclassified 12854
108 Ga0466728_045596 3300042620 Bacteria 30767
109 Ga0123354_10135326 3300010882 Bacteria 3085
110 Ga0466731_263774 3300042622 Bacteria 2855
111 Ga0466703_383278 3300042636 Bacteria 7909
112 Ga0466708_028589 3300042652 Bacteria 12607
113 Ga0466727_291191 3300042655 Bacteria 8080
114 Ga0466656_021695 3300042550 Bacteria 3322
115 Ga0466657_322145 3300042582 Bacteria 1658
116 Ga0466690_035961 3300042590 Bacteria 3798
117 Ga0466706_118381 3300042599 Bacteria 1804
118 Ga0466713_051688 3300042602 Bacteria 6951
119 Ga0466713_119808 3300042602 Bacteria 48294
120 Ga0466714_068131 3300042603 Bacteria 8263
121 Ga0466716_174456 3300042605 Bacteria 3307
122 Ga0466719_081974 3300042606 Bacteria 6153
123 Ga0466710_026203 3300042613 Bacteria 15115
124 Ga0466715_030204 3300042616 Bacteria 32308
125 Ga0466715_198412 3300042616 Bacteria 6443
126 Ga0466723_160240 3300042618 Bacteria 6713
127 Ga0466728_132211 3300042620 Bacteria 29619
128 Ga0123354_10016000 3300010882 Bacteria 11752
129 Ga0123354_10316172 3300010882 Bacteria 1449
130 Ga0466704_249834 3300042643 Bacteria 14240
131 Ga0466704_385577 3300042643 Bacteria 3104
132 Ga0466725_461920 3300042654 Bacteria 38511
133 JGI24702J35022_10127382 3300002462 Bacteria 1411
134 JGI24705J35276_12238178 3300002504 Bacteria 16911

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042590 Ga0466690_315922 Ga0466690_315922_11_709 232
2 3300042652 Ga0466708_138620 Ga0466708_138620_9360_10106 243
3 3300042620 Ga0466728_132211 Ga0466728_132211_9612_10361 249
4 3300042652 Ga0466708_028589 Ga0466708_028589_3108_3872 254
5 3300042619 Ga0466726_255530 Ga0466726_255530_218_988 256
6 3300042648 Ga0466709_376503 Ga0466709_376503_6720_7538 263
7 3300042616 Ga0466715_307695 Ga0466715_307695_16148_16969 267
8 3300042643 Ga0466704_322171 Ga0466704_322171_4816_5649 268
9 3300042601 Ga0466707_054338 Ga0466707_054338_912_1724 270
10 3300042606 Ga0466719_081974 Ga0466719_081974_813_1652 270
11 3300042615 Ga0466711_347465 Ga0466711_347465_4242_5054 270
12 3300042619 Ga0466726_050555 Ga0466726_050555_1456_2268 270
13 3300042620 Ga0466728_045596 Ga0466728_045596_15276_16088 270
14 3300042620 Ga0466728_168100 Ga0466728_168100_16346_17158 270
15 3300042582 Ga0466657_322145 Ga0466657_322145_604_1419 271
16 3300042593 Ga0466691_103514 Ga0466691_103514_3300_4115 271
17 3300042602 Ga0466713_119808 Ga0466713_119808_20303_21118 271
18 3300042603 Ga0466714_068131 Ga0466714_068131_1775_2590 271
19 3300042603 Ga0466714_159167 Ga0466714_159167_5771_6586 271
20 3300042606 Ga0466719_059687 Ga0466719_059687_9768_10583 271
21 3300042643 Ga0466704_378524 Ga0466704_378524_270_1085 271
22 3300005083 Ga0068305_10033366 Ga0068305_100333665 272
23 3300042603 Ga0466714_071171 Ga0466714_071171_3525_4343 272
24 3300042615 Ga0466711_478228 Ga0466711_478228_4102_4920 272
25 3300042619 Ga0466726_073698 Ga0466726_073698_454_1272 272
26 3300042620 Ga0466728_311970 Ga0466728_311970_1072_1890 272
27 3300042582 Ga0466657_170521 Ga0466657_170521_172_993 273
28 3300042590 Ga0466690_434293 Ga0466690_434293_4071_4892 273
29 3300042596 Ga0466696_102295 Ga0466696_102295_1811_2632 273
30 3300042601 Ga0466707_287995 Ga0466707_287995_1341_2162 273
31 3300042605 Ga0466716_103170 Ga0466716_103170_264_1085 273
32 3300042605 Ga0466716_174213 Ga0466716_174213_297_1118 273
33 3300042605 Ga0466716_174456 Ga0466716_174456_1278_2099 273
34 3300042605 Ga0466716_223899 Ga0466716_223899_957_1778 273
35 3300042609 Ga0466722_248749 Ga0466722_248749_450_1271 273
36 3300042613 Ga0466710_026203 Ga0466710_026203_10481_11302 273
37 3300042616 Ga0466715_030204 Ga0466715_030204_5925_6746 273
38 3300042636 Ga0466703_178721 Ga0466703_178721_2564_3385 273
39 3300042655 Ga0466727_291191 Ga0466727_291191_5172_5993 273
40 3300042590 Ga0466690_035961 Ga0466690_035961_1066_1890 274
41 3300042591 Ga0466692_064946 Ga0466692_064946_603_1427 274
42 3300042604 Ga0466717_017801 Ga0466717_017801_838_1662 274
43 3300042604 Ga0466717_172285 Ga0466717_172285_2798_3622 274
44 3300042604 Ga0466717_302323 Ga0466717_302323_613_1437 274
45 3300042606 Ga0466719_280972 Ga0466719_280972_746_1570 274
46 3300042610 Ga0466698_345727 Ga0466698_345727_629_1453 274
47 3300042611 Ga0466697_047479 Ga0466697_047479_49937_50761 274
48 3300042611 Ga0466697_068071 Ga0466697_068071_176_1000 274
49 3300042613 Ga0466710_174493 Ga0466710_174493_13078_13902 274
50 3300042618 Ga0466723_160240 Ga0466723_160240_1753_2577 274
51 3300042622 Ga0466731_263774 Ga0466731_263774_937_1761 274
52 3300042636 Ga0466703_004065 Ga0466703_004065_2300_3124 274
53 3300042636 Ga0466703_027233 Ga0466703_027233_430_1254 274
54 3300042643 Ga0466704_385577 Ga0466704_385577_1601_2425 274
55 3300042648 Ga0466709_279392 Ga0466709_279392_1538_2362 274
56 3300002462 JGI24702J35022_10111807 JGI24702J35022_101118072 275
57 3300002504 JGI24705J35276_12238178 JGI24705J35276_122381784 275
58 3300005083 Ga0068305_10284306 Ga0068305_102843062 275
59 3300005201 Ga0072941_1564361 Ga0072941_15643611 275
60 3300010049 Ga0123356_10331775 Ga0123356_103317752 275
61 3300010167 Ga0123353_10142406 Ga0123353_101424063 275
62 3300010167 Ga0123353_10449557 Ga0123353_104495572 275
63 3300042591 Ga0466692_050164 Ga0466692_050164_1940_2767 275
64 3300042598 Ga0466701_005269 Ga0466701_005269_1323_2150 275
65 3300042615 Ga0466711_248904 Ga0466711_248904_6717_7544 275
66 3300042655 Ga0466727_050078 Ga0466727_050078_3567_4394 275
67 iso_pr_bacteria 2820757377 2820757591 275
68 iso_pr_bacteria 2940202316 2940203078 275
69 3300002509 JGI24699J35502_11133304 JGI24699J35502_111333048 276
70 3300042602 Ga0466713_021200 Ga0466713_021200_4667_5497 276
71 3300042602 Ga0466713_051688 Ga0466713_051688_2105_2935 276
72 3300042602 Ga0466713_085895 Ga0466713_085895_5561_6391 276
73 3300042624 Ga0466735_007097 Ga0466735_007097_2712_3542 276
74 3300042643 Ga0466704_142532 Ga0466704_142532_60_890 276
75 3300042643 Ga0466704_512771 Ga0466704_512771_2940_3770 276
76 3300042654 Ga0466725_036706 Ga0466725_036706_202_1032 276
77 3300042654 Ga0466725_461920 Ga0466725_461920_6443_7273 276
78 3300042655 Ga0466727_176346 Ga0466727_176346_1469_2299 276
79 3300042596 Ga0466696_274193 Ga0466696_274193_1751_2584 277
80 3300042596 Ga0466696_444495 Ga0466696_444495_5821_6654 277
81 3300042598 Ga0466701_093074 Ga0466701_093074_47_880 277
82 3300042616 Ga0466715_039490 Ga0466715_039490_2069_2902 277
83 3300042636 Ga0466703_048823 Ga0466703_048823_6461_7294 277
84 3300009784 Ga0123357_10002573 Ga0123357_100025739 278
85 3300010882 Ga0123354_10316172 Ga0123354_103161721 278
86 3300042550 Ga0466656_021695 Ga0466656_021695_752_1588 278
87 3300042590 Ga0466690_034574 Ga0466690_034574_3658_4494 278
88 3300042636 Ga0466703_202519 Ga0466703_202519_8896_9735 279
89 3300002462 JGI24702J35022_10127382 JGI24702J35022_101273821 280
90 3300042550 Ga0466656_113263 Ga0466656_113263_10712_11554 280
91 3300042590 Ga0466690_019839 Ga0466690_019839_12339_13181 280
92 3300042602 Ga0466713_089856 Ga0466713_089856_6376_7218 280
93 3300042605 Ga0466716_090621 Ga0466716_090621_9295_10137 280
94 3300042616 Ga0466715_357754 Ga0466715_357754_17951_18793 280
95 3300042621 Ga0466729_175636 Ga0466729_175636_5126_5968 280
96 3300042648 Ga0466709_326213 Ga0466709_326213_1930_2772 280
97 3300002509 JGI24699J35502_11134096 JGI24699J35502_111340969 281
98 3300009784 Ga0123357_10003534 Ga0123357_1000353414 281
99 3300009784 Ga0123357_10025848 Ga0123357_100258483 281
100 3300009784 Ga0123357_10102512 Ga0123357_101025122 281
101 3300010049 Ga0123356_10228717 Ga0123356_102287172 281
102 3300010167 Ga0123353_10139025 Ga0123353_101390254 281
103 3300010882 Ga0123354_10135326 Ga0123354_101353264 281
104 3300010882 Ga0123354_10135542 Ga0123354_101355423 281
105 3300010882 Ga0123354_10171615 Ga0123354_101716152 281
106 3300010882 Ga0123354_10172327 Ga0123354_101723273 281
107 3300010882 Ga0123354_10366774 Ga0123354_103667741 281
108 3300042603 Ga0466714_039715 Ga0466714_039715_85_930 281
109 3300042636 Ga0466703_383278 Ga0466703_383278_5626_6471 281
110 3300042600 Ga0466700_005213 Ga0466700_005213_10307_11155 282
111 3300042655 Ga0466727_137119 Ga0466727_137119_843_1694 283
112 3300010882 Ga0123354_10016000 Ga0123354_1001600011 284
113 3300009784 Ga0123357_10014331 Ga0123357_100143317 285
114 3300010882 Ga0123354_10087805 Ga0123354_100878052 286
115 3300042614 Ga0466712_196457 Ga0466712_196457_47_907 286
116 3300042616 Ga0466715_198412 Ga0466715_198412_4206_5081 286
117 iso_pr_bacteria 2910926975 2910929161 286
118 3300042643 Ga0466704_249834 Ga0466704_249834_13136_13999 287
119 3300042618 Ga0466723_354948 Ga0466723_354948_9579_10445 288
120 3300042599 Ga0466706_121373 Ga0466706_121373_9410_10279 289
121 3300042612 Ga0466705_372178 Ga0466705_372178_539_1435 289
122 3300042599 Ga0466706_118381 Ga0466706_118381_94_966 290
123 3300042602 Ga0466713_034207 Ga0466713_034207_19765_20637 290
124 3300005083 Ga0068305_10104738 Ga0068305_101047383 291
125 3300042619 Ga0466726_149087 Ga0466726_149087_5035_5910 291
126 3300042615 Ga0466711_285989 Ga0466711_285989_5470_6351 293
127 3300042613 Ga0466710_449550 Ga0466710_449550_886_1776 296
128 3300005083 Ga0068305_10109873 Ga0068305_101098734 297
129 3300002462 JGI24702J35022_10008813 JGI24702J35022_100088134 300
130 3300009784 Ga0123357_10051110 Ga0123357_100511104 302
131 3300002450 JGI24695J34938_10071719 JGI24695J34938_100717191 305
132 3300009784 Ga0123357_10216796 Ga0123357_102167962 305
133 3300010882 Ga0123354_10010911 Ga0123354_1001091110 305
134 3300042624 Ga0466735_090148 Ga0466735_090148_808_1734 308
135 3300002504 JGI24705J35276_12144525 JGI24705J35276_121445251 323
136 3300005201 Ga0072941_1243860 Ga0072941_12438602 329
137 3300042611 Ga0466697_254209 Ga0466697_254209_1072_2181 369

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF19576 Acyltransf_2 Acyltransferase 62 325 0.95

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.8 0.84 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.