Protein Family IF01338

Metagenome Isolate
248 Members
76 Samples
224 Scaffolds
146.33 Avg Length

🧬 Representative Sequence

ID
3300005201|Ga0072941_1080669|Ga0072941_10806693
Length
135 aa
Sequence
MNLHNLKPAEGSTKKTKRIGRGEGSGHGGTSTRGHFEGGQMPMQRRLPKFGFNNINRVEYKAINVSTLQALAEKCSIDTITVDTLVEHGLASKNSRVKILGNGELNVKLNVTAHAFSKSAVAAIEAKQGVATKL*

📊 Sample Types

Isolate 9.7%
Metagenome 90.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 29.7%
Blattidae 25.7%
Kalotermitidae 18.9%
Unclassified 9.5%
Rhinotermitidae 5.4%
Termopsidae 5.4%
Passalidae 2.7%
Hodotermitidae 1.4%
Tenebrionidae 1.4%

🌳 Taxonomy

Archaea 0
Bacteria 239
Eukaryota 0
Viruses 0
Unclassified 9

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2922326829 Bacteroides sp. 224 Isolate Blattidae
2 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
3 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
4 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
5 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
6 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
7 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
8 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
9 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
10 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
11 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
12 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
13 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
14 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
15 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
16 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
17 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
18 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
19 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
20 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
21 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
22 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
23 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
24 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
25 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
26 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
27 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
28 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
29 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
30 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
31 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
32 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
33 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
34 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
35 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
36 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
37 2920168565 Paludibacter sp. 221 Isolate Blattidae
38 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
39 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
40 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
41 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
42 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
43 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
44 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
45 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
46 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
47 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
48 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
49 3004667792 Bacteroides sp. 519 Isolate Blattidae
50 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
51 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
52 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
53 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
54 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
55 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
56 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
57 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
58 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
59 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
60 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
61 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
62 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
63 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
64 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
65 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
66 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
67 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
68 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
69 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
70 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
71 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
72 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
73 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
74 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
75 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
76 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_058096 3300042612 Bacteria 11192
2 Ga0123357_10019205 3300009784 Bacteria 9102
3 Ga0123357_10057959 3300009784 Bacteria 5203
4 Ga0123357_10064406 3300009784 Bacteria 4898
5 Ga0123357_10159037 3300009784 Bacteria 2715
6 Ga0123357_10377655 3300009784 Bacteria 1320
7 Ga0123355_10001369 3300009826 Bacteria 33944
8 Ga0123356_10536129 3300010049 Bacteria 1330
9 Ga0123356_11768701 3300010049 Bacteria 768
10 Ga0123354_10111676 3300010882 Bacteria 3604
11 Ga0123354_10397951 3300010882 Unclassified 1169
12 Ga0466715_137824 3300042616 Bacteria 1409
13 Ga0466735_035640 3300042624 Bacteria 1743
14 Ga0466735_043327 3300042624 Bacteria 1572
15 Ga0466735_087275 3300042624 Bacteria 8538
16 Ga0466735_133122 3300042624 Bacteria 2677
17 Ga0466709_208437 3300042648 Bacteria 82349
18 Ga0466693_412658 3300042592 Unclassified 1387
19 Ga0466691_103922 3300042593 Bacteria 19126
20 Ga0466696_033396 3300042596 Unclassified 1840
21 Ga0466701_076335 3300042598 Bacteria 60822
22 Ga0466698_374367 3300042610 Bacteria 1742
23 IMNBL1DRAFT_c0000355 3300000062 Bacteria 38787
24 IMNBL1DRAFT_c0000682 3300000062 Bacteria 27226
25 IMNBL1DRAFT_c0051540 3300000062 Bacteria 1295
26 Ga0068305_10003312 3300005083 Bacteria 66359
27 Ga0068305_10026156 3300005083 Bacteria 20761
28 Ga0466697_161541 3300042611 Bacteria 2598
29 Ga0466705_346556 3300042612 Unclassified 1764
30 Ga0123353_10529325 3300010167 Bacteria 1707
31 Ga0466711_095236 3300042615 Bacteria 15743
32 Ga0466711_141717 3300042615 Bacteria 15726
33 Ga0466715_025469 3300042616 Bacteria 20577
34 Ga0466728_139914 3300042620 Bacteria 13626
35 Ga0466735_012338 3300042624 Bacteria 1490
36 Ga0466735_060463 3300042624 Bacteria 1011
37 Ga0466735_080555 3300042624 Bacteria 12371
38 Ga0466735_129234 3300042624 Bacteria 4257
39 Ga0466725_037990 3300042654 Bacteria 18222
40 Ga0466727_082800 3300042655 Bacteria 3545
41 Ga0466657_098945 3300042582 Bacteria 51985
42 Ga0466690_075785 3300042590 Bacteria 45904
43 Ga0466693_019228 3300042592 Bacteria 2315
44 Ga0466695_284405 3300042595 Bacteria 1191
45 Ga0466696_057822 3300042596 Bacteria 24547
46 Ga0466701_084874 3300042598 Bacteria 1026
47 Ga0466706_118256 3300042599 Bacteria 1244
48 Ga0466706_237229 3300042599 Bacteria 5073
49 Ga0466706_252632 3300042599 Bacteria 4964
50 Ga0466707_048580 3300042601 Bacteria 11796
51 Ga0466707_248411 3300042601 Bacteria 1679
52 Ga0466707_360699 3300042601 Bacteria 17316
53 Ga0466713_027800 3300042602 Bacteria 40167
54 2227194703 2225789004 Bacteria 7845
55 2227517976 2225789004 Bacteria 3399
56 IMNBL1DRAFT_c0000677 3300000062 Bacteria 27305
57 JGI24702J35022_10002597 3300002462 Bacteria 10970
58 JGI24699J35502_11114554 3300002509 Bacteria 2866
59 Ga0068305_10296985 3300005083 Bacteria 2453
60 Ga0123357_10097966 3300009784 Bacteria 3792
61 Ga0123357_10137196 3300009784 Bacteria 3020
62 Ga0466711_030146 3300042615 Bacteria 6235
63 Ga0466715_076088 3300042616 Bacteria 9712
64 Ga0466723_362486 3300042618 Bacteria 1099
65 Ga0466726_346162 3300042619 Bacteria 2462
66 Ga0466735_064263 3300042624 Bacteria 2824
67 Ga0466735_141295 3300042624 Bacteria 3256
68 Ga0466730_079377 3300042625 Bacteria 4647
69 Ga0466703_417292 3300042636 Bacteria 5033
70 Ga0466704_552057 3300042643 Bacteria 6449
71 Ga0466704_619871 3300042643 Bacteria 22946
72 Ga0466709_000304 3300042648 Bacteria 8299
73 Ga0466690_383037 3300042590 Bacteria 7258
74 Ga0466691_204814 3300042593 Bacteria 23707
75 Ga0466695_042940 3300042595 Bacteria 2765
76 Ga0466696_286290 3300042596 Bacteria 1325
77 Ga0466706_003151 3300042599 Bacteria 1202
78 Ga0466706_177219 3300042599 Bacteria 25525
79 Ga0466706_237799 3300042599 Bacteria 2044
80 Ga0466714_059082 3300042603 Bacteria 46712
81 Ga0466714_096666 3300042603 Bacteria 172614
82 Ga0466714_101031 3300042603 Bacteria 79046
83 Ga0466716_237498 3300042605 Bacteria 3703
84 Ga0466716_495889 3300042605 Bacteria 3680
85 Ga0466719_246678 3300042606 Bacteria 8577
86 Ga0466722_025001 3300042609 Bacteria 4342
87 Ga0466722_077240 3300042609 Bacteria 7055
88 IMNBL1DRAFT_c0003207 3300000062 Bacteria 10697
89 JGI24702J35022_10005168 3300002462 Bacteria 7657
90 JGI24705J35276_12223223 3300002504 Bacteria 2489
91 Ga0068302_10032438 3300005071 Bacteria 4288
92 Ga0466697_139202 3300042611 Bacteria 1770
93 Ga0562377_0004 3300056842 Bacteria 3525959
94 Ga0466710_086506 3300042613 Bacteria 1237
95 Ga0466715_154449 3300042616 Bacteria 23802
96 Ga0466728_117468 3300042620 Bacteria 23405
97 Ga0466731_131517 3300042622 Bacteria 1948
98 Ga0466735_011934 3300042624 Bacteria 2884
99 Ga0466735_025800 3300042624 Bacteria 1791
100 Ga0466703_105741 3300042636 Bacteria 30105
101 Ga0466703_374219 3300042636 Bacteria 24808
102 Ga0466704_115291 3300042643 Bacteria 19465
103 Ga0466704_249780 3300042643 Bacteria 8800
104 Ga0466708_014146 3300042652 Bacteria 33245
105 Ga0466690_130793 3300042590 Bacteria 15221
106 Ga0466693_298718 3300042592 Bacteria 1556
107 Ga0466696_077742 3300042596 Bacteria 7588
108 Ga0466706_064416 3300042599 Bacteria 22081
109 Ga0466706_098228 3300042599 Bacteria 39742
110 Ga0466706_126288 3300042599 Bacteria 17453
111 Ga0466706_261195 3300042599 Bacteria 2955
112 Ga0466713_129806 3300042602 Bacteria 35433
113 Ga0466697_018053 3300042611 Bacteria 1879
114 2227184690 2225789004 Bacteria 1484
115 JGI24705J35276_11899521 3300002504 Bacteria 750
116 Ga0466733_122413 3300042659 Bacteria 26318
117 Ga0123356_10087291 3300010049 Bacteria 2963
118 Ga0123356_12115928 3300010049 Bacteria 703
119 Ga0123353_10470657 3300010167 Unclassified 1843
120 Ga0123353_12822873 3300010167 Bacteria 568
121 Ga0123354_10119434 3300010882 Bacteria 3415
122 Ga0466715_044375 3300042616 Bacteria 14700
123 Ga0466723_123534 3300042618 Bacteria 8663
124 Ga0466723_184116 3300042618 Bacteria 30069
125 Ga0466728_235463 3300042620 Bacteria 2137
126 Ga0466735_060130 3300042624 Bacteria 1341
127 Ga0466703_369160 3300042636 Bacteria 28465
128 Ga0466709_083357 3300042648 Bacteria 39489
129 Ga0466709_118201 3300042648 Bacteria 25211
130 Ga0466709_129005 3300042648 Bacteria 13583
131 Ga0466727_225049 3300042655 Bacteria 48864
132 Ga0466657_266564 3300042582 Bacteria 1996
133 Ga0466690_136616 3300042590 Bacteria 29160
134 Ga0466692_024662 3300042591 Bacteria 1399
135 Ga0466692_142563 3300042591 Bacteria 9391
136 Ga0466701_074471 3300042598 Bacteria 3074
137 Ga0466707_194386 3300042601 Bacteria 27039
138 Ga0466713_096596 3300042602 Bacteria 406546
139 Ga0466722_108524 3300042609 Bacteria 6122
140 Ga0466722_143981 3300042609 Bacteria 20003
141 2227623535 2225789004 Bacteria 2170
142 IMNBL1DRAFT_c0000119 3300000062 Bacteria 71190
143 Ga0068305_10010112 3300005083 Bacteria 17726
144 Ga0466733_098924 3300042659 Bacteria 10647
145 Ga0123353_10140364 3300010167 Bacteria 3871
146 Ga0123354_10002374 3300010882 Bacteria 24762
147 Ga0466710_341133 3300042613 Bacteria 2344
148 Ga0466710_437818 3300042613 Bacteria 1073
149 Ga0466711_050658 3300042615 Bacteria 24311
150 Ga0466715_265725 3300042616 Bacteria 12007
151 Ga0466728_019967 3300042620 Bacteria 2767
152 Ga0466703_020705 3300042636 Bacteria 5568
153 Ga0466703_021523 3300042636 Bacteria 4183
154 Ga0466703_180446 3300042636 Bacteria 15145
155 Ga0466703_265124 3300042636 Unclassified 2329
156 Ga0466704_055849 3300042643 Bacteria 53217
157 Ga0466704_477103 3300042643 Bacteria 9640
158 Ga0466708_340350 3300042652 Bacteria 78722
159 Ga0466725_046272 3300042654 Bacteria 2002
160 Ga0466690_032772 3300042590 Bacteria 29534
161 Ga0466690_175771 3300042590 Bacteria 56622
162 Ga0466690_261027 3300042590 Bacteria 17850
163 Ga0466691_039529 3300042593 Bacteria 29822
164 Ga0466696_436433 3300042596 Bacteria 22667
165 Ga0466701_086347 3300042598 Unclassified 3426
166 Ga0466706_096820 3300042599 Bacteria 3200
167 Ga0466706_176055 3300042599 Bacteria 1069
168 Ga0466707_123522 3300042601 Bacteria 8117
169 Ga0466707_269466 3300042601 Bacteria 1305
170 Ga0466707_374739 3300042601 Bacteria 28797
171 Ga0466713_030797 3300042602 Bacteria 38314
172 Ga0466713_112803 3300042602 Bacteria 145809
173 Ga0466716_532094 3300042605 Bacteria 21649
174 2227363336 2225789004 Bacteria 1124
175 Ga0123357_10000330 3300009784 Bacteria 44905
176 Ga0466697_101303 3300042611 Bacteria 1406
177 Ga0466705_339741 3300042612 Unclassified 1635
178 Ga0123356_10074292 3300010049 Bacteria 3198
179 Ga0123354_10000176 3300010882 Bacteria 53249
180 Ga0123354_10159030 3300010882 Bacteria 2693
181 Ga0466711_092510 3300042615 Bacteria 9915
182 Ga0466711_212221 3300042615 Bacteria 10563
183 Ga0466711_212781 3300042615 Bacteria 3826
184 Ga0466711_289238 3300042615 Bacteria 45865
185 Ga0466723_373256 3300042618 Bacteria 33738
186 Ga0466726_109952 3300042619 Bacteria 1112
187 Ga0466735_008034 3300042624 Bacteria 5195
188 Ga0466725_280895 3300042654 Bacteria 1088
189 Ga0466727_063087 3300042655 Bacteria 8570
190 Ga0466727_260920 3300042655 Bacteria 6356
191 Ga0265387_1001514 3300024582 Bacteria 3401
192 Ga0466691_191064 3300042593 Bacteria 4342
193 Ga0466701_098566 3300042598 Bacteria 20155
194 Ga0466706_259354 3300042599 Bacteria 1724
195 Ga0466700_440838 3300042600 Bacteria 1078
196 Ga0466707_398960 3300042601 Bacteria 15809
197 Ga0466722_210785 3300042609 Bacteria 4412
198 IMNBL1DRAFT_c0003005 3300000062 Bacteria 11178
199 IMNBL1DRAFT_c0003450 3300000062 Bacteria 10155
200 Ga0072941_1080669 3300005201 Bacteria 5010
201 Ga0466705_023652 3300042612 Bacteria 16774
202 Ga0123357_10229301 3300009784 Bacteria 2040
203 Ga0123356_10785714 3300010049 Bacteria 1123
204 Ga0466705_502503 3300042612 Bacteria 16070
205 Ga0466711_185967 3300042615 Bacteria 6230
206 Ga0466711_228133 3300042615 Bacteria 7712
207 Ga0466715_013468 3300042616 Bacteria 26887
208 Ga0466715_119604 3300042616 Bacteria 22555
209 Ga0466715_381837 3300042616 Bacteria 3395
210 Ga0466729_106187 3300042621 Bacteria 19633
211 Ga0466729_112686 3300042621 Bacteria 10506
212 Ga0466729_256895 3300042621 Bacteria 1920
213 Ga0466735_017313 3300042624 Bacteria 6644
214 Ga0466703_073446 3300042636 Bacteria 8423
215 Ga0466704_415186 3300042643 Bacteria 17633
216 Ga0466727_298973 3300042655 Bacteria 9257
217 Ga0265387_1041842 3300024582 Bacteria 789
218 Ga0466656_344865 3300042550 Bacteria 2382
219 Ga0466657_015820 3300042582 Bacteria 1199
220 Ga0466713_072740 3300042602 Bacteria 29878
221 Ga0466716_335360 3300042605 Bacteria 11224
222 JGI24705J35276_11943024 3300002504 Unclassified 787
223 JGI24705J35276_12077883 3300002504 Bacteria 967
224 JGI24699J35502_11134150 3300002509 Bacteria 37878

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042612 Ga0466705_023652 Ga0466705_023652_8525_8971 128
2 3300042616 Ga0466715_137824 Ga0466715_137824_815_1261 128
3 3300042618 Ga0466723_373256 Ga0466723_373256_6143_6589 128
4 3300042643 Ga0466704_477103 Ga0466704_477103_2708_3154 128
5 3300000062 IMNBL1DRAFT_c0000677 IMNBL1DRAFT_000067727 130
6 3300005083 Ga0068305_10003312 Ga0068305_1000331227 130
7 3300042598 Ga0466701_086347 Ga0466701_086347_1303_1749 130
8 3300042603 Ga0466714_059082 Ga0466714_059082_14773_15219 130
9 3300042610 Ga0466698_374367 Ga0466698_374367_1068_1514 130
10 3300042611 Ga0466697_139202 Ga0466697_139202_843_1289 130
11 3300042624 Ga0466735_087275 Ga0466735_087275_3134_3580 130
12 3300010049 Ga0123356_10536129 Ga0123356_105361292 131
13 3300010049 Ga0123356_11768701 Ga0123356_117687012 131
14 3300010167 Ga0123353_10470657 Ga0123353_104706572 131
15 3300010882 Ga0123354_10000176 Ga0123354_1000017647 131
16 3300042615 Ga0466711_141717 Ga0466711_141717_6554_7000 131
17 3300002462 JGI24702J35022_10005168 JGI24702J35022_1000516811 132
18 3300042596 Ga0466696_436433 Ga0466696_436433_5931_6377 133
19 3300009784 Ga0123357_10159037 Ga0123357_101590372 134
20 3300042643 Ga0466704_552057 Ga0466704_552057_2643_3089 134
21 3300005201 Ga0072941_1080669 Ga0072941_10806693 135
22 3300002462 JGI24702J35022_10002597 JGI24702J35022_100025979 136
23 3300042582 Ga0466657_098945 Ga0466657_098945_51324_51770 136
24 3300010049 Ga0123356_12115928 Ga0123356_121159281 137
25 3300010167 Ga0123353_12822873 Ga0123353_128228731 137
26 3300042603 Ga0466714_101031 Ga0466714_101031_70780_71226 138
27 3300042599 Ga0466706_098228 Ga0466706_098228_8312_8758 139
28 3300042599 Ga0466706_237799 Ga0466706_237799_1111_1557 140
29 3300042603 Ga0466714_096666 Ga0466714_096666_20954_21400 140
30 3300042593 Ga0466691_204814 Ga0466691_204814_8562_9008 141
31 3300042596 Ga0466696_286290 Ga0466696_286290_197_643 141
32 3300042605 Ga0466716_237498 Ga0466716_237498_2121_2567 141
33 3300042616 Ga0466715_154449 Ga0466715_154449_14821_15267 141
34 3300042620 Ga0466728_117468 Ga0466728_117468_13153_13599 141
35 3300042648 Ga0466709_083357 Ga0466709_083357_22153_22599 141
36 3300010167 Ga0123353_10140364 Ga0123353_101403644 142
37 3300042616 Ga0466715_265725 Ga0466715_265725_2919_3365 142
38 3300042621 Ga0466729_256895 Ga0466729_256895_426_872 142
39 3300010049 Ga0123356_10087291 Ga0123356_100872913 143
40 3300042590 Ga0466690_261027 Ga0466690_261027_10744_11190 143
41 3300042624 Ga0466735_008034 Ga0466735_008034_3849_4295 143
42 3300042624 Ga0466735_035640 Ga0466735_035640_1057_1512 144
43 2225789004 2227184690 2227603764 148
44 2225789004 2227194703 2227618109 148
45 2225789004 2227363336 2227810947 148
46 2225789004 2227517976 2228018507 148
47 2225789004 2227623535 2228203672 148
48 3300024582 Ga0265387_1001514 Ga0265387_10015144 148
49 3300024582 Ga0265387_1041842 Ga0265387_10418422 148
50 3300042550 Ga0466656_344865 Ga0466656_344865_223_669 148
51 3300042582 Ga0466657_015820 Ga0466657_015820_541_987 148
52 3300042582 Ga0466657_266564 Ga0466657_266564_1224_1670 148
53 3300042590 Ga0466690_032772 Ga0466690_032772_26449_26895 148
54 3300042590 Ga0466690_075785 Ga0466690_075785_10026_10472 148
55 3300042590 Ga0466690_130793 Ga0466690_130793_2685_3131 148
56 3300042590 Ga0466690_136616 Ga0466690_136616_16394_16840 148
57 3300042590 Ga0466690_175771 Ga0466690_175771_41583_42029 148
58 3300042590 Ga0466690_383037 Ga0466690_383037_109_555 148
59 3300042591 Ga0466692_024662 Ga0466692_024662_227_673 148
60 3300042592 Ga0466693_019228 Ga0466693_019228_1367_1813 148
61 3300042592 Ga0466693_298718 Ga0466693_298718_555_1001 148
62 3300042592 Ga0466693_412658 Ga0466693_412658_631_1077 148
63 3300042593 Ga0466691_039529 Ga0466691_039529_16731_17177 148
64 3300042593 Ga0466691_103922 Ga0466691_103922_7424_7870 148
65 3300042595 Ga0466695_042940 Ga0466695_042940_1670_2116 148
66 3300042596 Ga0466696_033396 Ga0466696_033396_708_1154 148
67 3300042596 Ga0466696_057822 Ga0466696_057822_1770_2216 148
68 3300042596 Ga0466696_077742 Ga0466696_077742_769_1215 148
69 3300042598 Ga0466701_074471 Ga0466701_074471_951_1397 148
70 3300042598 Ga0466701_076335 Ga0466701_076335_2869_3315 148
71 3300042598 Ga0466701_084874 Ga0466701_084874_490_936 148
72 3300042598 Ga0466701_098566 Ga0466701_098566_3240_3686 148
73 3300042599 Ga0466706_003151 Ga0466706_003151_530_976 148
74 3300042599 Ga0466706_064416 Ga0466706_064416_21513_21959 148
75 3300042599 Ga0466706_096820 Ga0466706_096820_2633_3079 148
76 3300042599 Ga0466706_118256 Ga0466706_118256_24_470 148
77 3300042599 Ga0466706_177219 Ga0466706_177219_13907_14353 148
78 3300042599 Ga0466706_237229 Ga0466706_237229_1484_1930 148
79 3300042599 Ga0466706_252632 Ga0466706_252632_3949_4395 148
80 3300042599 Ga0466706_259354 Ga0466706_259354_1156_1602 148
81 3300042600 Ga0466700_440838 Ga0466700_440838_231_677 148
82 3300042601 Ga0466707_048580 Ga0466707_048580_9002_9448 148
83 3300042601 Ga0466707_123522 Ga0466707_123522_2262_2708 148
84 3300042601 Ga0466707_194386 Ga0466707_194386_12928_13374 148
85 3300042601 Ga0466707_248411 Ga0466707_248411_482_928 148
86 3300042601 Ga0466707_269466 Ga0466707_269466_766_1212 148
87 3300042601 Ga0466707_360699 Ga0466707_360699_10188_10634 148
88 3300042601 Ga0466707_374739 Ga0466707_374739_11172_11618 148
89 3300042601 Ga0466707_398960 Ga0466707_398960_7170_7616 148
90 3300042602 Ga0466713_027800 Ga0466713_027800_9740_10186 148
91 3300042602 Ga0466713_072740 Ga0466713_072740_14394_14840 148
92 3300042602 Ga0466713_129806 Ga0466713_129806_9297_9743 148
93 3300042605 Ga0466716_335360 Ga0466716_335360_575_1021 148
94 3300042605 Ga0466716_495889 Ga0466716_495889_2455_2901 148
95 3300042605 Ga0466716_532094 Ga0466716_532094_8800_9246 148
96 3300042606 Ga0466719_246678 Ga0466719_246678_5528_5974 148
97 3300042609 Ga0466722_077240 Ga0466722_077240_3108_3554 148
98 3300042609 Ga0466722_108524 Ga0466722_108524_3105_3551 148
99 3300042609 Ga0466722_143981 Ga0466722_143981_6660_7106 148
100 3300042609 Ga0466722_210785 Ga0466722_210785_2247_2693 148
101 3300042611 Ga0466697_018053 Ga0466697_018053_355_801 148
102 3300042611 Ga0466697_101303 Ga0466697_101303_821_1267 148
103 3300042611 Ga0466697_161541 Ga0466697_161541_776_1222 148
104 3300042612 Ga0466705_058096 Ga0466705_058096_3583_4029 148
105 3300042612 Ga0466705_339741 Ga0466705_339741_76_522 148
106 3300042612 Ga0466705_346556 Ga0466705_346556_1243_1689 148
107 3300042612 Ga0466705_502503 Ga0466705_502503_9328_9774 148
108 3300042613 Ga0466710_086506 Ga0466710_086506_134_580 148
109 3300042613 Ga0466710_341133 Ga0466710_341133_361_807 148
110 3300042613 Ga0466710_437818 Ga0466710_437818_255_701 148
111 3300042615 Ga0466711_030146 Ga0466711_030146_1758_2204 148
112 3300042615 Ga0466711_092510 Ga0466711_092510_3874_4320 148
113 3300042615 Ga0466711_095236 Ga0466711_095236_12832_13278 148
114 3300042615 Ga0466711_212221 Ga0466711_212221_7651_8097 148
115 3300042615 Ga0466711_228133 Ga0466711_228133_3246_3692 148
116 3300042615 Ga0466711_289238 Ga0466711_289238_30929_31375 148
117 3300042616 Ga0466715_013468 Ga0466715_013468_24263_24709 148
118 3300042616 Ga0466715_025469 Ga0466715_025469_13091_13537 148
119 3300042616 Ga0466715_044375 Ga0466715_044375_11482_11928 148
120 3300042616 Ga0466715_076088 Ga0466715_076088_2440_2886 148
121 3300042616 Ga0466715_119604 Ga0466715_119604_8157_8603 148
122 3300042616 Ga0466715_381837 Ga0466715_381837_1637_2083 148
123 3300042618 Ga0466723_123534 Ga0466723_123534_1644_2090 148
124 3300042618 Ga0466723_184116 Ga0466723_184116_1268_1714 148
125 3300042618 Ga0466723_362486 Ga0466723_362486_408_854 148
126 3300042619 Ga0466726_109952 Ga0466726_109952_656_1102 148
127 3300042619 Ga0466726_346162 Ga0466726_346162_1388_1834 148
128 3300042620 Ga0466728_019967 Ga0466728_019967_265_711 148
129 3300042620 Ga0466728_235463 Ga0466728_235463_36_482 148
130 3300042621 Ga0466729_106187 Ga0466729_106187_6563_7009 148
131 3300042621 Ga0466729_112686 Ga0466729_112686_7416_7862 148
132 3300042622 Ga0466731_131517 Ga0466731_131517_595_1041 148
133 3300042624 Ga0466735_011934 Ga0466735_011934_2133_2579 148
134 3300042624 Ga0466735_012338 Ga0466735_012338_427_873 148
135 3300042624 Ga0466735_017313 Ga0466735_017313_3766_4212 148
136 3300042624 Ga0466735_025800 Ga0466735_025800_1258_1704 148
137 3300042624 Ga0466735_043327 Ga0466735_043327_546_992 148
138 3300042624 Ga0466735_060130 Ga0466735_060130_77_523 148
139 3300042624 Ga0466735_060463 Ga0466735_060463_483_929 148
140 3300042624 Ga0466735_064263 Ga0466735_064263_249_695 148
141 3300042624 Ga0466735_080555 Ga0466735_080555_4450_4896 148
142 3300042624 Ga0466735_129234 Ga0466735_129234_559_1005 148
143 3300042624 Ga0466735_133122 Ga0466735_133122_1173_1619 148
144 3300042624 Ga0466735_141295 Ga0466735_141295_155_601 148
145 3300042636 Ga0466703_020705 Ga0466703_020705_2576_3022 148
146 3300042636 Ga0466703_021523 Ga0466703_021523_1203_1649 148
147 3300042636 Ga0466703_073446 Ga0466703_073446_4769_5215 148
148 3300042636 Ga0466703_105741 Ga0466703_105741_26962_27408 148
149 3300042636 Ga0466703_180446 Ga0466703_180446_9288_9734 148
150 3300042636 Ga0466703_265124 Ga0466703_265124_1189_1635 148
151 3300042636 Ga0466703_374219 Ga0466703_374219_18694_19140 148
152 3300042636 Ga0466703_417292 Ga0466703_417292_1492_1938 148
153 3300042643 Ga0466704_055849 Ga0466704_055849_31626_32072 148
154 3300042643 Ga0466704_115291 Ga0466704_115291_7103_7549 148
155 3300042643 Ga0466704_249780 Ga0466704_249780_5143_5589 148
156 3300042643 Ga0466704_415186 Ga0466704_415186_2671_3117 148
157 3300042643 Ga0466704_619871 Ga0466704_619871_3918_4364 148
158 3300042648 Ga0466709_000304 Ga0466709_000304_1232_1678 148
159 3300042648 Ga0466709_129005 Ga0466709_129005_2602_3048 148
160 3300042652 Ga0466708_014146 Ga0466708_014146_13438_13884 148
161 3300042652 Ga0466708_340350 Ga0466708_340350_66938_67384 148
162 3300042654 Ga0466725_037990 Ga0466725_037990_8714_9160 148
163 3300042654 Ga0466725_046272 Ga0466725_046272_1501_1947 148
164 3300042655 Ga0466727_082800 Ga0466727_082800_785_1231 148
165 3300042655 Ga0466727_225049 Ga0466727_225049_26034_26480 148
166 3300042655 Ga0466727_260920 Ga0466727_260920_3093_3539 148
167 3300042655 Ga0466727_298973 Ga0466727_298973_6454_6900 148
168 3300042659 Ga0466733_122413 Ga0466733_122413_11351_11797 148
169 iso_pr_bacteria 2820757377 2820758084 148
170 iso_pr_bacteria 2820759988 2820759996 148
171 iso_pr_bacteria 2920168565 2920170034 148
172 iso_pr_bacteria 2922326829 2922327970 148
173 iso_pr_bacteria 2940195863 2940197470 148
174 iso_pr_bacteria 2940202316 2940204412 148
175 iso_pr_bacteria 2940205530 2940208432 148
176 iso_pr_bacteria 2940212447 2940215366 148
177 iso_pr_bacteria 2940216256 2940217598 148
178 iso_pr_bacteria 2940298504 2940301420 148
179 iso_pr_bacteria 2940302308 2940305222 148
180 iso_pr_bacteria 2940306115 2940309019 148
181 iso_pr_bacteria 2940309933 2940312878 148
182 iso_pr_bacteria 2940313741 2940316691 148
183 iso_pr_bacteria 2940317558 2940320506 148
184 iso_pr_bacteria 2940321370 2940324262 148
185 iso_pr_bacteria 2940325180 2940328072 148
186 iso_pr_bacteria 2940328985 2940331899 148
187 iso_pr_bacteria 2940332795 2940335743 148
188 iso_pr_bacteria 2967483437 2967487589 148
189 iso_pr_bacteria 3004667792 3004671184 148
190 3300000062 IMNBL1DRAFT_c0000119 IMNBL1DRAFT_000011928 149
191 3300000062 IMNBL1DRAFT_c0000355 IMNBL1DRAFT_000035513 149
192 3300000062 IMNBL1DRAFT_c0000682 IMNBL1DRAFT_000068217 149
193 3300000062 IMNBL1DRAFT_c0003005 IMNBL1DRAFT_000300514 149
194 3300000062 IMNBL1DRAFT_c0003207 IMNBL1DRAFT_000320711 149
195 3300000062 IMNBL1DRAFT_c0003450 IMNBL1DRAFT_000345010 149
196 3300000062 IMNBL1DRAFT_c0051540 IMNBL1DRAFT_00515402 149
197 3300002504 JGI24705J35276_11899521 JGI24705J35276_118995212 149
198 3300002504 JGI24705J35276_11943024 JGI24705J35276_119430242 149
199 3300002504 JGI24705J35276_12077883 JGI24705J35276_120778832 149
200 3300002504 JGI24705J35276_12223223 JGI24705J35276_122232236 149
201 3300002509 JGI24699J35502_11114554 JGI24699J35502_111145542 149
202 3300005071 Ga0068302_10032438 Ga0068302_100324383 149
203 3300005083 Ga0068305_10010112 Ga0068305_1001011226 149
204 3300005083 Ga0068305_10026156 Ga0068305_1002615624 149
205 3300009784 Ga0123357_10000330 Ga0123357_1000033034 149
206 3300009784 Ga0123357_10019205 Ga0123357_1001920510 149
207 3300009784 Ga0123357_10057959 Ga0123357_100579596 149
208 3300009784 Ga0123357_10064406 Ga0123357_100644066 149
209 3300009784 Ga0123357_10097966 Ga0123357_100979666 149
210 3300009784 Ga0123357_10137196 Ga0123357_101371965 149
211 3300009784 Ga0123357_10229301 Ga0123357_102293011 149
212 3300009784 Ga0123357_10377655 Ga0123357_103776551 149
213 3300009826 Ga0123355_10001369 Ga0123355_1000136914 149
214 3300010049 Ga0123356_10074292 Ga0123356_100742923 149
215 3300010049 Ga0123356_10785714 Ga0123356_107857142 149
216 3300010167 Ga0123353_10529325 Ga0123353_105293255 149
217 3300010882 Ga0123354_10002374 Ga0123354_1000237414 149
218 3300010882 Ga0123354_10111676 Ga0123354_101116763 149
219 3300010882 Ga0123354_10119434 Ga0123354_101194344 149
220 3300010882 Ga0123354_10397951 Ga0123354_103979512 149
221 3300042595 Ga0466695_284405 Ga0466695_284405_689_1138 149
222 3300042602 Ga0466713_030797 Ga0466713_030797_30831_31280 149
223 3300042602 Ga0466713_096596 Ga0466713_096596_321541_321990 149
224 3300042602 Ga0466713_112803 Ga0466713_112803_19839_20288 149
225 3300042609 Ga0466722_025001 Ga0466722_025001_3403_3852 149
226 3300042615 Ga0466711_050658 Ga0466711_050658_7197_7646 149
227 3300042625 Ga0466730_079377 Ga0466730_079377_2680_3129 149
228 3300042636 Ga0466703_369160 Ga0466703_369160_6052_6501 149
229 3300042648 Ga0466709_208437 Ga0466709_208437_55102_55551 149
230 3300042655 Ga0466727_063087 Ga0466727_063087_780_1229 149
231 3300042659 Ga0466733_098924 Ga0466733_098924_7246_7695 149
232 3300056842 Ga0562377_0004 Ga0562377_0004_3476419_3476868 149
233 iso_pr_bacteria 2820762746 2820764322 149
234 iso_pr_bacteria 2910942425 2910944149 149
235 iso_pr_bacteria 8100166142 8100169600 149
236 3300002509 JGI24699J35502_11134150 JGI24699J35502_1113415025 150
237 3300005083 Ga0068305_10296985 Ga0068305_102969852 150
238 3300042591 Ga0466692_142563 Ga0466692_142563_2587_3039 150
239 3300042599 Ga0466706_261195 Ga0466706_261195_2020_2472 150
240 3300042654 Ga0466725_280895 Ga0466725_280895_618_1070 150
241 3300010882 Ga0123354_10159030 Ga0123354_101590302 151
242 3300042620 Ga0466728_139914 Ga0466728_139914_3398_3853 151
243 3300042648 Ga0466709_118201 Ga0466709_118201_7421_7876 151
244 3300042593 Ga0466691_191064 Ga0466691_191064_1080_1547 155
245 3300042615 Ga0466711_212781 Ga0466711_212781_2264_2734 156
246 3300042599 Ga0466706_176055 Ga0466706_176055_10_498 157
247 3300042615 Ga0466711_185967 Ga0466711_185967_1729_2202 157
248 3300042599 Ga0466706_126288 Ga0466706_126288_2870_3346 158

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A 22 131 0.86

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.57 0.78 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.