Protein Family IF01336

Metagenome Isolate
115 Members
38 Samples
109 Scaffolds
260.51 Avg Length

🧬 Representative Sequence

ID
3300005201|Ga0072941_1068329|Ga0072941_10683292
Length
254 aa
Sequence
MPYKHGRPVIDLSPFFRIASAWGFYLTIPIAFLVNFSMFLTRYKHRYRMYNVKKAITVSNHTTFLDPVKIAALVLPRLIFQTLLEATVEFPILGTYTRILGGVPVPRGLKGYKKILESFKTRRYLHFYPEGECYLYNQNIREFKTGAFLIAAEMDIPVVPLVTVFSEGPFKPWSFWGRSLPLETLVVLDPVYPSQYVRRDQNGELDSASIREFAEAVRQKMQAEIDKRGGSSAFFRGHMDRIKGLNDKVPVSN*

📊 Sample Types

Isolate 4.3%
Metagenome 95.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 50.0%
Kalotermitidae 27.8%
Unclassified 13.9%
Blaberidae 2.8%
Rhinotermitidae 2.8%
Termopsidae 2.8%

🌳 Taxonomy

Archaea 0
Bacteria 107
Eukaryota 0
Viruses 0
Unclassified 8

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2772190975 Treponema sp. RmG30 Isolate Blaberidae
2 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
3 650716102 Treponema primitia ZAS-2 Isolate Unclassified
4 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
5 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
6 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
7 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
8 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
9 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
10 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
11 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
12 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
13 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
14 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
15 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
16 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
17 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
18 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
19 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
20 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
21 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
22 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
23 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
24 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
25 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
26 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
27 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
28 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
29 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
30 2781125652 Treponema sp. Cu122P5bin1 Isolate Unclassified
31 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
32 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
33 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
34 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
35 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
36 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
37 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
38 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466702_066788 3300042635 Bacteria 2391
2 Ga0466712_055330 3300042614 Unclassified 2870
3 Ga0466712_095931 3300042614 Bacteria 14319
4 Ga0466718_030218 3300042617 Bacteria 5732
5 Ga0466691_125200 3300042593 Bacteria 7452
6 Ga0466696_023950 3300042596 Bacteria 3809
7 Ga0466716_501654 3300042605 Bacteria 2499
8 Ga0466722_084381 3300042609 Bacteria 43243
9 JGI24698J34947_10018240 3300002449 Bacteria 3794
10 JGI24695J34938_10051701 3300002450 Bacteria 1796
11 JGI24696J40584_12957449 3300002834 Bacteria 3520
12 Ga0466712_210687 3300042614 Bacteria 11046
13 Ga0466715_001364 3300042616 Bacteria 11977
14 Ga0466718_159364 3300042617 Bacteria 5537
15 Ga0466718_161575 3300042617 Bacteria 1734
16 Ga0466690_305817 3300042590 Bacteria 1608
17 Ga0466691_219934 3300042593 Bacteria 9518
18 Ga0466694_076450 3300042594 Bacteria 26319
19 JGI24698J34947_10001464 3300002449 Bacteria 12432
20 JGI24698J34947_10002259 3300002449 Bacteria 10320
21 JGI24698J34947_10004929 3300002449 Bacteria 7314
22 JGI24698J34947_10034633 3300002449 Unclassified 2640
23 Ga0072941_1040268 3300005201 Bacteria 13976
24 Ga0072941_1045543 3300005201 Bacteria 3829
25 Ga0466703_030641 3300042636 Bacteria 6965
26 Ga0466712_080364 3300042614 Bacteria 2673
27 Ga0466720_099903 3300042607 Bacteria 25510
28 Ga0466722_065259 3300042609 Bacteria 1991
29 JGI24698J34947_10005191 3300002449 Bacteria 7144
30 Ga0072940_1021688 3300005200 Bacteria 4149
31 Ga0072940_1022044 3300005200 Bacteria 5065
32 Ga0466732_446957 3300042656 Bacteria 15153
33 Ga0466708_014822 3300042652 Bacteria 8536
34 Ga0466712_045719 3300042614 Unclassified 3402
35 Ga0466712_058559 3300042614 Bacteria 28216
36 Ga0466712_077919 3300042614 Bacteria 28252
37 Ga0466718_112735 3300042617 Bacteria 2386
38 Ga0466693_206602 3300042592 Unclassified 2783
39 Ga0466694_008592 3300042594 Bacteria 11846
40 Ga0466695_218661 3300042595 Bacteria 43087
41 JGI24698J34947_10001772 3300002449 Bacteria 11509
42 JGI24698J34947_10004905 3300002449 Bacteria 7330
43 JGI24698J34947_10008325 3300002449 Bacteria 5688
44 JGI24698J34947_10029776 3300002449 Bacteria 2882
45 JGI24698J34947_10034382 3300002449 Bacteria 2653
46 JGI24698J34947_10055107 3300002449 Bacteria 1982
47 Ga0072941_1133291 3300005201 Bacteria 5016
48 Ga0466703_066674 3300042636 Bacteria 13204
49 Ga0123357_10060377 3300009784 Bacteria 5086
50 Ga0466712_017336 3300042614 Bacteria 30893
51 Ga0466712_082916 3300042614 Bacteria 3004
52 Ga0466712_202792 3300042614 Bacteria 9583
53 Ga0466723_207332 3300042618 Bacteria 6867
54 AustNasuHG_c1001560 3300000089 Bacteria 8255
55 JGI24698J34947_10001046 3300002449 Bacteria 14257
56 JGI24698J34947_10008050 3300002449 Bacteria 5786
57 JGI24698J34947_10072284 3300002449 Bacteria 1652
58 JGI24698J34947_10136498 3300002449 Unclassified 1040
59 JGI24695J34938_10014243 3300002450 Bacteria 4133
60 Ga0072941_1009359 3300005201 Bacteria 34397
61 Ga0072941_1018319 3300005201 Bacteria 8459
62 Ga0072941_1020573 3300005201 Bacteria 18138
63 Ga0466702_110946 3300042635 Bacteria 1442
64 Ga0466709_004059 3300042648 Bacteria 3889
65 Ga0466727_039206 3300042655 Bacteria 2962
66 Ga0123356_10009490 3300010049 Bacteria 9610
67 Ga0466712_036596 3300042614 Bacteria 17970
68 Ga0466712_197398 3300042614 Bacteria 4743
69 Ga0264413_115014 3300024493 Bacteria 12573
70 Ga0264413_123083 3300024493 Bacteria 7735
71 Ga0466693_419874 3300042592 Bacteria 3719
72 JGI24698J34947_10001342 3300002449 Bacteria 12947
73 JGI24698J34947_10026637 3300002449 Bacteria 3071
74 JGI24698J34947_10034682 3300002449 Bacteria 2638
75 JGI24698J34947_10039192 3300002449 Bacteria 2454
76 JGI24698J34947_10062103 3300002449 Bacteria 1836
77 JGI24695J34938_10000245 3300002450 Bacteria 52223
78 Ga0072940_1021687 3300005200 Bacteria 2550
79 Ga0072941_1018317 3300005201 Bacteria 2363
80 Ga0072941_1018320 3300005201 Bacteria 6689
81 Ga0072941_1029378 3300005201 Bacteria 4449
82 Ga0072941_1068329 3300005201 Bacteria 1891
83 Ga0466731_329935 3300042622 Bacteria 2818
84 Ga0123357_10157393 3300009784 Bacteria 2736
85 Ga0466712_076054 3300042614 Bacteria 15237
86 Ga0466712_279128 3300042614 Bacteria 7550
87 Ga0466723_193953 3300042618 Bacteria 4702
88 Ga0466728_247328 3300042620 Bacteria 5914
89 Ga0466707_204413 3300042601 Bacteria 2734
90 AustNasuHG_c1023137 3300000089 Unclassified 1988
91 Ga0072941_1001616 3300005201 Bacteria 13955
92 Ga0072941_1040161 3300005201 Bacteria 8770
93 Ga0072941_1053360 3300005201 Bacteria 4038
94 Ga0466731_000344 3300042622 Bacteria 14290
95 Ga0466709_005784 3300042648 Bacteria 3760
96 Ga0466708_296757 3300042652 Bacteria 8156
97 Ga0123353_10304127 3300010167 Bacteria 2432
98 Ga0466712_019913 3300042614 Bacteria 18083
99 Ga0466712_282134 3300042614 Bacteria 5606
100 Ga0466712_289247 3300042614 Bacteria 3994
101 Ga0466712_316838 3300042614 Bacteria 9868
102 Ga0466693_186633 3300042592 Bacteria 79738
103 Ga0466700_377206 3300042600 Bacteria 3694
104 JGI24698J34947_10002160 3300002449 Bacteria 10543
105 JGI24698J34947_10005082 3300002449 Bacteria 7205
106 JGI24698J34947_10009653 3300002449 Bacteria 5289
107 JGI24698J34947_10011838 3300002449 Unclassified 4791
108 JGI24695J34938_10000846 3300002450 Bacteria 28385
109 Ga0072941_1068330 3300005201 Unclassified 1409

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042620 Ga0466728_247328 Ga0466728_247328_185_889 234
2 3300009784 Ga0123357_10060377 Ga0123357_100603775 251
3 3300024493 Ga0264413_115014 Ga0264413_1150148 251
4 3300024493 Ga0264413_123083 Ga0264413_1230835 251
5 3300042592 Ga0466693_206602 Ga0466693_206602_390_1145 251
6 3300042592 Ga0466693_419874 Ga0466693_419874_268_1023 251
7 3300042593 Ga0466691_125200 Ga0466691_125200_892_1647 251
8 3300042594 Ga0466694_076450 Ga0466694_076450_8596_9351 251
9 3300042595 Ga0466695_218661 Ga0466695_218661_6473_7228 251
10 3300042600 Ga0466700_377206 Ga0466700_377206_890_1645 251
11 3300042601 Ga0466707_204413 Ga0466707_204413_1861_2616 251
12 3300042607 Ga0466720_099903 Ga0466720_099903_14688_15443 251
13 3300042614 Ga0466712_017336 Ga0466712_017336_11382_12137 251
14 3300042614 Ga0466712_076054 Ga0466712_076054_7559_8314 251
15 3300042614 Ga0466712_082916 Ga0466712_082916_2083_2838 251
16 3300042614 Ga0466712_197398 Ga0466712_197398_569_1324 251
17 3300042617 Ga0466718_030218 Ga0466718_030218_3128_3883 251
18 3300042617 Ga0466718_112735 Ga0466718_112735_567_1322 251
19 3300042622 Ga0466731_000344 Ga0466731_000344_1365_2120 251
20 3300042622 Ga0466731_329935 Ga0466731_329935_1852_2607 251
21 3300042635 Ga0466702_066788 Ga0466702_066788_601_1356 251
22 3300042635 Ga0466702_110946 Ga0466702_110946_329_1084 251
23 3300042636 Ga0466703_066674 Ga0466703_066674_80_835 251
24 3300042655 Ga0466727_039206 Ga0466727_039206_2119_2874 251
25 3300042656 Ga0466732_446957 Ga0466732_446957_14308_15063 251
26 iso_pr_bacteria 2772190975 2773722105 251
27 iso_pr_bacteria 2781125652 2781312161 251
28 iso_pr_bacteria 2781125692 2781432155 251
29 iso_pr_bacteria 650716102 650881397 251
30 3300000089 AustNasuHG_c1001560 AustNasuHG_10015604 252
31 3300000089 AustNasuHG_c1023137 AustNasuHG_10231372 252
32 3300002449 JGI24698J34947_10005082 JGI24698J34947_100050826 252
33 3300002449 JGI24698J34947_10009653 JGI24698J34947_100096534 252
34 3300002449 JGI24698J34947_10011838 JGI24698J34947_100118382 252
35 3300002449 JGI24698J34947_10026637 JGI24698J34947_100266373 252
36 3300002449 JGI24698J34947_10034633 JGI24698J34947_100346333 252
37 3300002449 JGI24698J34947_10034682 JGI24698J34947_100346823 252
38 3300002449 JGI24698J34947_10055107 JGI24698J34947_100551072 252
39 3300002834 JGI24696J40584_12957449 JGI24696J40584_129574493 252
40 3300005200 Ga0072940_1021687 Ga0072940_10216872 252
41 3300005200 Ga0072940_1022044 Ga0072940_10220445 252
42 3300005201 Ga0072941_1009359 Ga0072941_100935930 252
43 3300005201 Ga0072941_1018320 Ga0072941_10183205 252
44 3300005201 Ga0072941_1020573 Ga0072941_102057315 252
45 3300005201 Ga0072941_1045543 Ga0072941_10455432 252
46 3300005201 Ga0072941_1068330 Ga0072941_10683302 252
47 3300009784 Ga0123357_10157393 Ga0123357_101573933 252
48 3300042590 Ga0466690_305817 Ga0466690_305817_565_1323 252
49 3300042593 Ga0466691_219934 Ga0466691_219934_6100_6858 252
50 3300042596 Ga0466696_023950 Ga0466696_023950_1256_2014 252
51 3300042609 Ga0466722_084381 Ga0466722_084381_32696_33454 252
52 3300042614 Ga0466712_282134 Ga0466712_282134_4158_4916 252
53 3300042617 Ga0466718_159364 Ga0466718_159364_4043_4801 252
54 3300042617 Ga0466718_161575 Ga0466718_161575_575_1333 252
55 3300042618 Ga0466723_193953 Ga0466723_193953_390_1148 252
56 3300042618 Ga0466723_207332 Ga0466723_207332_4956_5714 252
57 3300042636 Ga0466703_030641 Ga0466703_030641_1752_2510 252
58 3300042648 Ga0466709_004059 Ga0466709_004059_1272_2030 252
59 3300042648 Ga0466709_005784 Ga0466709_005784_1270_2028 252
60 3300042652 Ga0466708_014822 Ga0466708_014822_4797_5555 252
61 3300042652 Ga0466708_296757 Ga0466708_296757_2761_3519 252
62 3300002450 JGI24695J34938_10000245 JGI24695J34938_1000024524 253
63 3300010049 Ga0123356_10009490 Ga0123356_100094903 253
64 3300042614 Ga0466712_076054 Ga0466712_076054_8584_9345 253
65 3300002449 JGI24698J34947_10136498 JGI24698J34947_101364981 254
66 3300005201 Ga0072941_1068329 Ga0072941_10683292 254
67 3300042614 Ga0466712_077919 Ga0466712_077919_13280_14047 255
68 iso_pr_bacteria 2781125693 2781433431 255
69 3300002450 JGI24695J34938_10051701 JGI24695J34938_100517011 257
70 3300042614 Ga0466712_055330 Ga0466712_055330_1585_2358 257
71 3300042614 Ga0466712_058559 Ga0466712_058559_18803_19576 257
72 3300002449 JGI24698J34947_10005191 JGI24698J34947_100051915 258
73 3300002449 JGI24698J34947_10062103 JGI24698J34947_100621032 258
74 3300002449 JGI24698J34947_10008050 JGI24698J34947_100080503 259
75 3300042614 Ga0466712_019913 Ga0466712_019913_10380_11159 259
76 3300010167 Ga0123353_10304127 Ga0123353_103041272 261
77 3300042594 Ga0466694_008592 Ga0466694_008592_5100_5885 261
78 3300002449 JGI24698J34947_10039192 JGI24698J34947_100391922 271
79 3300002450 JGI24695J34938_10000846 JGI24695J34938_1000084611 271
80 3300002450 JGI24695J34938_10014243 JGI24695J34938_100142432 271
81 3300005200 Ga0072940_1021688 Ga0072940_10216883 271
82 3300005201 Ga0072941_1018317 Ga0072941_10183172 271
83 3300005201 Ga0072941_1018319 Ga0072941_10183193 271
84 3300005201 Ga0072941_1040161 Ga0072941_10401614 271
85 3300042609 Ga0466722_065259 Ga0466722_065259_1012_1827 271
86 3300002449 JGI24698J34947_10008325 JGI24698J34947_100083253 272
87 3300042592 Ga0466693_186633 Ga0466693_186633_54043_54861 272
88 3300042605 Ga0466716_501654 Ga0466716_501654_136_957 273
89 3300042614 Ga0466712_202792 Ga0466712_202792_2625_3446 273
90 3300042614 Ga0466712_210687 Ga0466712_210687_7790_8611 273
91 3300002449 JGI24698J34947_10001772 JGI24698J34947_100017727 274
92 3300042616 Ga0466715_001364 Ga0466715_001364_3030_3854 274
93 3300002449 JGI24698J34947_10029776 JGI24698J34947_100297762 275
94 3300042614 Ga0466712_095931 Ga0466712_095931_6631_7458 275
95 3300002449 JGI24698J34947_10001342 JGI24698J34947_100013428 276
96 3300005201 Ga0072941_1040268 Ga0072941_10402687 276
97 3300042614 Ga0466712_036596 Ga0466712_036596_4544_5374 276
98 3300042614 Ga0466712_045719 Ga0466712_045719_2060_2890 276
99 3300002449 JGI24698J34947_10001046 JGI24698J34947_1000104614 277
100 3300002449 JGI24698J34947_10002160 JGI24698J34947_100021604 277
101 3300002449 JGI24698J34947_10002259 JGI24698J34947_100022599 277
102 3300002449 JGI24698J34947_10004905 JGI24698J34947_100049054 277
103 3300002449 JGI24698J34947_10018240 JGI24698J34947_100182402 277
104 3300002449 JGI24698J34947_10034382 JGI24698J34947_100343822 277
105 3300005201 Ga0072941_1001616 Ga0072941_10016167 277
106 3300005201 Ga0072941_1029378 Ga0072941_10293783 277
107 3300005201 Ga0072941_1053360 Ga0072941_10533602 277
108 3300005201 Ga0072941_1133291 Ga0072941_11332914 277
109 3300042614 Ga0466712_289247 Ga0466712_289247_1546_2382 278
110 3300002449 JGI24698J34947_10001464 JGI24698J34947_100014643 279
111 3300002449 JGI24698J34947_10004929 JGI24698J34947_100049295 279
112 3300042614 Ga0466712_279128 Ga0466712_279128_2139_3005 288
113 3300042614 Ga0466712_316838 Ga0466712_316838_4437_5312 291
114 3300042614 Ga0466712_080364 Ga0466712_080364_96_1004 302
115 3300002449 JGI24698J34947_10072284 JGI24698J34947_100722842 309

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01553 Acyltransferase Acyltransferase 51 162 0.87

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01553 GO:0016746 acyltransferase activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.89 0.89 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.