Protein Family IF01326

Metagenome Isolate
118 Members
40 Samples
110 Scaffolds
159.62 Avg Length

🧬 Representative Sequence

ID
3300005201|Ga0072941_1051489|Ga0072941_10514894
Length
171 aa
Sequence
MILYHGSLKAIEKPDLSFSRDNTDFGKGFYTTTIKSQVEKWASRFKRKFGYGTLSLYEVDEITLRKNVSVLEFETYSVEWLDFVAKCRQGELSSPSELPSKAGLSGNFDLVIGGIANDDVFNTLTLYFRGYIEKEEALKRLRYEKPNIQYCFKNQNVTDKYLKYKGMEMV*

📊 Sample Types

Isolate 6.8%
Metagenome 93.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 50.0%
Unclassified 23.7%
Kalotermitidae 13.2%
Rhinotermitidae 5.3%
Hodotermitidae 2.6%
Termopsidae 2.6%
Passalidae 2.6%

🌳 Taxonomy

Archaea 1
Bacteria 111
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
2 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
3 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
4 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
5 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
6 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
7 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
8 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
9 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
10 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
11 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
12 2740892547 Fibrobacteria bacterium GUT77 MC_77 Isolate Unclassified
13 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
14 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
15 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
16 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
17 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
18 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
19 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
20 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
21 2781125643 Treponema sp. Co191P3bin45 Isolate Unclassified
22 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
23 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
24 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
25 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
26 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
27 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
28 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
29 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
30 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
31 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
32 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
33 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified
34 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
35 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
36 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
37 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
38 2778260941 Unclassified Fibrobacteres Th196P3bin8 Isolate Unclassified
39 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
40 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_181922 3300042612 Bacteria 7107
2 Ga0466731_196710 3300042622 Bacteria 4464
3 Ga0466704_607316 3300042643 Bacteria 30733
4 Ga0123356_10264454 3300010049 Bacteria 1806
5 Ga0123353_10414746 3300010167 Unclassified 1998
6 Ga0466694_220026 3300042594 Bacteria 5821
7 Ga0466699_141077 3300042597 Bacteria 1468
8 JGI24695J34938_10211080 3300002450 Bacteria 812
9 Ga0072941_1051489 3300005201 Bacteria 4102
10 Ga0466729_228072 3300042621 Bacteria 3308
11 Ga0466702_288960 3300042635 Bacteria 2522
12 Ga0466704_220215 3300042643 Bacteria 4851
13 Ga0466728_020376 3300042620 Bacteria 2176
14 Ga0123356_10078324 3300010049 Bacteria 3119
15 Ga0123354_10349739 3300010882 Unclassified 1319
16 Ga0264413_112783 3300024493 Bacteria 1206
17 Ga0466692_033141 3300042591 Bacteria 1293
18 Ga0466694_101913 3300042594 Bacteria 1681
19 Ga0466699_120529 3300042597 Bacteria 1426
20 Ga0466706_078466 3300042599 Bacteria 2338
21 Ga0466707_398908 3300042601 Bacteria 3301
22 Ga0466720_224450 3300042607 Bacteria 13432
23 JGI24698J34947_10021789 3300002449 Unclassified 3443
24 JGI24695J34938_10016770 3300002450 Bacteria 3714
25 JGI24695J34938_10158103 3300002450 Bacteria 931
26 Ga0072940_1456761 3300005200 Bacteria 1026
27 Ga0466702_450733 3300042635 Bacteria 1440
28 Ga0466704_217619 3300042643 Unclassified 4236
29 Ga0466718_044901 3300042617 Bacteria 1404
30 Ga0123356_10969046 3300010049 Bacteria 1021
31 Ga0123356_11128918 3300010049 Bacteria 951
32 Ga0123356_12225745 3300010049 Bacteria 685
33 Ga0466692_092183 3300042591 Unclassified 2196
34 Ga0466694_088741 3300042594 Bacteria 10468
35 Ga0466694_130916 3300042594 Bacteria 1851
36 Ga0466699_242677 3300042597 Bacteria 1660
37 Ga0466699_387306 3300042597 Bacteria 3360
38 Ga0466699_438806 3300042597 Bacteria 1198
39 Ga0466719_276638 3300042606 Bacteria 1577
40 JGI24698J34947_10242280 3300002449 Bacteria 678
41 JGI24695J34938_10021496 3300002450 Bacteria 3155
42 JGI24695J34938_10025109 3300002450 Archaea 2854
43 JGI24695J34938_10029844 3300002450 Bacteria 2545
44 Ga0466735_014108 3300042624 Bacteria 1102
45 Ga0466702_002316 3300042635 Bacteria 4905
46 Ga0466711_387637 3300042615 Bacteria 1764
47 Ga0466711_427566 3300042615 Bacteria 2511
48 Ga0466718_041885 3300042617 Bacteria 1129
49 Ga0466718_048999 3300042617 Bacteria 1854
50 Ga0123355_10377370 3300009826 Bacteria 1851
51 Ga0123356_13162203 3300010049 Bacteria 573
52 Ga0466692_043275 3300042591 Bacteria 10877
53 Ga0466699_036314 3300042597 Bacteria 4649
54 Ga0466699_351640 3300042597 Bacteria 3953
55 Ga0466707_177561 3300042601 Bacteria 1234
56 Ga0466719_272166 3300042606 Bacteria 1175
57 2227505757 2225789004 Bacteria 3681
58 JGI24695J34938_10067532 3300002450 Bacteria 1504
59 JGI24695J34938_10132132 3300002450 Bacteria 1018
60 JGI24696J40584_12948453 3300002834 Bacteria 2006
61 Ga0466705_260225 3300042612 Bacteria 20910
62 Ga0466732_184963 3300042656 Bacteria 4445
63 Ga0466732_259017 3300042656 Bacteria 1285
64 Ga0466732_325779 3300042656 Bacteria 1105
65 Ga0466702_105857 3300042635 Bacteria 2528
66 Ga0466712_214885 3300042614 Bacteria 1949
67 Ga0466729_041397 3300042621 Bacteria 19082
68 Ga0123356_10045186 3300010049 Bacteria 4098
69 Ga0123356_10431217 3300010049 Bacteria 1462
70 Ga0466699_269077 3300042597 Bacteria 1386
71 Ga0466719_492045 3300042606 Bacteria 1655
72 Ga0466720_212953 3300042607 Bacteria 1330
73 Ga0466698_167184 3300042610 Bacteria 1341
74 Ga0072940_1439151 3300005200 Bacteria 1405
75 Ga0072940_1446784 3300005200 Bacteria 627
76 Ga0072941_1012878 3300005201 Bacteria 3559
77 Ga0072941_1073307 3300005201 Bacteria 3348
78 Ga0466704_444018 3300042643 Bacteria 28632
79 Ga0466712_285131 3300042614 Bacteria 5312
80 Ga0123356_10264348 3300010049 Bacteria 1806
81 Ga0466694_160045 3300042594 Bacteria 3060
82 Ga0466699_055770 3300042597 Bacteria 6106
83 Ga0466699_170681 3300042597 Bacteria 3025
84 Ga0072940_1373873 3300005200 Bacteria 969
85 Ga0466705_017558 3300042612 Bacteria 9084
86 Ga0466731_061379 3300042622 Bacteria 4698
87 Ga0466702_155404 3300042635 Bacteria 1948
88 Ga0466705_420995 3300042612 Bacteria 4461
89 Ga0466712_044226 3300042614 Unclassified 3999
90 Ga0264413_107103 3300024493 Bacteria 5646
91 Ga0466699_271128 3300042597 Bacteria 5177
92 Ga0466698_133142 3300042610 Bacteria 8120
93 AustNasuHG_c1001314 3300000089 Bacteria 8915
94 JGI24695J34938_10000099 3300002450 Bacteria 75735
95 JGI24695J34938_10000556 3300002450 Bacteria 36040
96 JGI24695J34938_10002273 3300002450 Bacteria 14839
97 Ga0123357_10001124 3300009784 Bacteria 27781
98 Ga0466705_094458 3300042612 Bacteria 5517
99 Ga0123355_10385771 3300009826 Bacteria 1821
100 Ga0123356_10310890 3300010049 Bacteria 1685
101 Ga0123356_10853397 3300010049 Bacteria 1082
102 Ga0466694_392433 3300042594 Bacteria 1947
103 Ga0466699_387881 3300042597 Bacteria 1523
104 Ga0466706_097149 3300042599 Bacteria 2869
105 Ga0466706_121984 3300042599 Bacteria 1031
106 Ga0466706_233374 3300042599 Bacteria 7667
107 Ga0466707_213094 3300042601 Bacteria 1438
108 Ga0072941_1024181 3300005201 Bacteria 1828
109 Ga0072941_1026874 3300005201 Bacteria 4933
110 Ga0072941_1044218 3300005201 Bacteria 3717

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042635 Ga0466702_450733 Ga0466702_450733_483_929 148
2 3300042622 Ga0466731_061379 Ga0466731_061379_2598_3074 149
3 3300005200 Ga0072940_1373873 Ga0072940_13738733 150
4 3300042597 Ga0466699_242677 Ga0466699_242677_467_937 156
5 3300042615 Ga0466711_387637 Ga0466711_387637_739_1209 156
6 3300042621 Ga0466729_228072 Ga0466729_228072_181_651 156
7 3300042601 Ga0466707_213094 Ga0466707_213094_167_640 157
8 3300042601 Ga0466707_398908 Ga0466707_398908_1961_2434 157
9 3300042615 Ga0466711_427566 Ga0466711_427566_1730_2203 157
10 3300042624 Ga0466735_014108 Ga0466735_014108_231_704 157
11 3300010049 Ga0123356_10078324 Ga0123356_100783245 158
12 3300010049 Ga0123356_10431217 Ga0123356_104312173 158
13 3300010882 Ga0123354_10349739 Ga0123354_103497393 158
14 3300024493 Ga0264413_107103 Ga0264413_1071032 158
15 3300042591 Ga0466692_033141 Ga0466692_033141_438_914 158
16 3300042594 Ga0466694_088741 Ga0466694_088741_9221_9697 158
17 3300042594 Ga0466694_101913 Ga0466694_101913_925_1401 158
18 3300042594 Ga0466694_130916 Ga0466694_130916_579_1055 158
19 3300042594 Ga0466694_160045 Ga0466694_160045_143_619 158
20 3300042594 Ga0466694_392433 Ga0466694_392433_119_595 158
21 3300042597 Ga0466699_036314 Ga0466699_036314_2062_2538 158
22 3300042597 Ga0466699_055770 Ga0466699_055770_388_864 158
23 3300042597 Ga0466699_141077 Ga0466699_141077_53_529 158
24 3300042597 Ga0466699_170681 Ga0466699_170681_1578_2054 158
25 3300042597 Ga0466699_351640 Ga0466699_351640_3175_3651 158
26 3300042597 Ga0466699_387306 Ga0466699_387306_2733_3209 158
27 3300042597 Ga0466699_387881 Ga0466699_387881_584_1060 158
28 3300042601 Ga0466707_177561 Ga0466707_177561_203_679 158
29 3300042607 Ga0466720_212953 Ga0466720_212953_182_658 158
30 3300042610 Ga0466698_133142 Ga0466698_133142_2079_2555 158
31 3300042610 Ga0466698_167184 Ga0466698_167184_515_991 158
32 3300042614 Ga0466712_285131 Ga0466712_285131_3034_3510 158
33 3300042617 Ga0466718_041885 Ga0466718_041885_116_592 158
34 3300042617 Ga0466718_048999 Ga0466718_048999_1057_1533 158
35 3300042622 Ga0466731_196710 Ga0466731_196710_1091_1567 158
36 3300042635 Ga0466702_002316 Ga0466702_002316_3136_3612 158
37 3300042635 Ga0466702_288960 Ga0466702_288960_1450_1926 158
38 3300042656 Ga0466732_184963 Ga0466732_184963_3749_4225 158
39 3300042656 Ga0466732_259017 Ga0466732_259017_524_1000 158
40 3300042656 Ga0466732_325779 Ga0466732_325779_331_807 158
41 iso_pr_bacteria 2740892547 2743913358 158
42 iso_pr_bacteria 2781125632 2781270135 158
43 iso_pr_bacteria 2781125643 2781293235 158
44 iso_pr_bacteria 2781125644 2781295417 158
45 iso_pr_bacteria 2781125650 2781308580 158
46 iso_pr_bacteria 2781125659 2781329196 158
47 3300000089 AustNasuHG_c1001314 AustNasuHG_10013145 159
48 3300002450 JGI24695J34938_10000099 JGI24695J34938_1000009963 159
49 3300002450 JGI24695J34938_10000556 JGI24695J34938_1000055636 159
50 3300002450 JGI24695J34938_10002273 JGI24695J34938_100022733 159
51 3300002450 JGI24695J34938_10016770 JGI24695J34938_100167703 159
52 3300002450 JGI24695J34938_10021496 JGI24695J34938_100214963 159
53 3300002450 JGI24695J34938_10025109 JGI24695J34938_100251094 159
54 3300002450 JGI24695J34938_10067532 JGI24695J34938_100675323 159
55 3300002450 JGI24695J34938_10132132 JGI24695J34938_101321323 159
56 3300002450 JGI24695J34938_10158103 JGI24695J34938_101581032 159
57 3300002450 JGI24695J34938_10211080 JGI24695J34938_102110801 159
58 3300005200 Ga0072940_1446784 Ga0072940_14467841 159
59 3300010049 Ga0123356_10045186 Ga0123356_100451867 159
60 3300010049 Ga0123356_10264348 Ga0123356_102643483 159
61 3300010049 Ga0123356_10264454 Ga0123356_102644542 159
62 3300010049 Ga0123356_10310890 Ga0123356_103108901 159
63 3300010049 Ga0123356_10853397 Ga0123356_108533972 159
64 3300010049 Ga0123356_10969046 Ga0123356_109690462 159
65 3300010049 Ga0123356_11128918 Ga0123356_111289181 159
66 3300010049 Ga0123356_13162203 Ga0123356_131622031 159
67 3300010167 Ga0123353_10414746 Ga0123353_104147462 159
68 3300024493 Ga0264413_112783 Ga0264413_1127833 159
69 3300042591 Ga0466692_043275 Ga0466692_043275_1531_2010 159
70 3300042591 Ga0466692_092183 Ga0466692_092183_634_1113 159
71 3300042594 Ga0466694_220026 Ga0466694_220026_2552_3031 159
72 3300042597 Ga0466699_269077 Ga0466699_269077_388_867 159
73 3300042597 Ga0466699_271128 Ga0466699_271128_4006_4485 159
74 3300042599 Ga0466706_078466 Ga0466706_078466_1712_2191 159
75 3300042599 Ga0466706_233374 Ga0466706_233374_5029_5508 159
76 3300042606 Ga0466719_272166 Ga0466719_272166_55_534 159
77 3300042607 Ga0466720_224450 Ga0466720_224450_3080_3559 159
78 3300042612 Ga0466705_017558 Ga0466705_017558_1716_2195 159
79 3300042614 Ga0466712_044226 Ga0466712_044226_2512_2991 159
80 3300042614 Ga0466712_214885 Ga0466712_214885_605_1084 159
81 3300042635 Ga0466702_105857 Ga0466702_105857_1881_2360 159
82 iso_pr_bacteria 2778260941 2778358946 159
83 3300002449 JGI24698J34947_10021789 JGI24698J34947_100217893 160
84 3300002449 JGI24698J34947_10242280 JGI24698J34947_102422802 160
85 3300002450 JGI24695J34938_10029844 JGI24695J34938_100298443 160
86 3300002834 JGI24696J40584_12948453 JGI24696J40584_129484532 160
87 3300005200 Ga0072940_1439151 Ga0072940_14391512 160
88 3300005201 Ga0072941_1012878 Ga0072941_10128785 160
89 3300005201 Ga0072941_1024181 Ga0072941_10241813 160
90 3300005201 Ga0072941_1026874 Ga0072941_102687412 160
91 3300005201 Ga0072941_1044218 Ga0072941_10442184 160
92 3300005201 Ga0072941_1073307 Ga0072941_10733074 160
93 3300009826 Ga0123355_10377370 Ga0123355_103773702 160
94 3300009826 Ga0123355_10385771 Ga0123355_103857713 160
95 3300010049 Ga0123356_12225745 Ga0123356_122257452 160
96 iso_pr_bacteria 2781125666 2781344744 161
97 3300009784 Ga0123357_10001124 Ga0123357_100011245 162
98 3300042599 Ga0466706_097149 Ga0466706_097149_1258_1746 162
99 3300042599 Ga0466706_121984 Ga0466706_121984_130_618 162
100 3300042606 Ga0466719_492045 Ga0466719_492045_619_1110 163
101 3300042612 Ga0466705_094458 Ga0466705_094458_483_974 163
102 3300042612 Ga0466705_181922 Ga0466705_181922_3081_3572 163
103 3300042612 Ga0466705_260225 Ga0466705_260225_8653_9144 163
104 3300042612 Ga0466705_420995 Ga0466705_420995_570_1061 163
105 3300042617 Ga0466718_044901 Ga0466718_044901_238_729 163
106 3300042621 Ga0466729_041397 Ga0466729_041397_10726_11217 163
107 3300042635 Ga0466702_155404 Ga0466702_155404_1102_1593 163
108 3300042643 Ga0466704_217619 Ga0466704_217619_2368_2859 163
109 3300042643 Ga0466704_444018 Ga0466704_444018_12421_12912 163
110 3300042643 Ga0466704_607316 Ga0466704_607316_28824_29315 163
111 3300005200 Ga0072940_1456761 Ga0072940_14567612 164
112 3300042606 Ga0466719_276638 Ga0466719_276638_296_790 164
113 3300042620 Ga0466728_020376 Ga0466728_020376_1494_1988 164
114 3300042643 Ga0466704_220215 Ga0466704_220215_3239_3739 166
115 3300042597 Ga0466699_438806 Ga0466699_438806_586_1089 167
116 2225789004 2227505757 2227993368 168
117 3300005201 Ga0072941_1051489 Ga0072941_10514894 171
118 3300042597 Ga0466699_120529 Ga0466699_120529_777_1367 196

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13151 DUF3990 Protein of unknown function (DUF3990) 1 162 0.94

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.84 0.84 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.