Protein Family IF01326
Metagenome
Isolate
118
Members
40
Samples
110
Scaffolds
159.62
Avg Length
Representative Sequence
- ID
- 3300005201|Ga0072941_1051489|Ga0072941_10514894
- Length
- 171 aa
- Sequence
- MILYHGSLKAIEKPDLSFSRDNTDFGKGFYTTTIKSQVEKWASRFKRKFGYGTLSLYEVDEITLRKNVSVLEFETYSVEWLDFVAKCRQGELSSPSELPSKAGLSGNFDLVIGGIANDDVFNTLTLYFRGYIEKEEALKRLRYEKPNIQYCFKNQNVTDKYLKYKGMEMV*
Sample Types
Isolate
6.8%
Metagenome
93.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
50.0%
Unclassified
23.7%
Kalotermitidae
13.2%
Rhinotermitidae
5.3%
Hodotermitidae
2.6%
Termopsidae
2.6%
Passalidae
2.6%
Taxonomy
Archaea
1
Bacteria
111
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 2 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 3 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 4 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 5 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 6 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 7 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 8 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 9 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 10 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 11 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 12 | 2740892547 | Fibrobacteria bacterium GUT77 MC_77 | Isolate | Unclassified |
| 13 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 14 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 15 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 16 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 17 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 18 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 19 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 20 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 21 | 2781125643 | Treponema sp. Co191P3bin45 | Isolate | Unclassified |
| 22 | 2781125650 | Treponema sp. Co191P3bin64 | Isolate | Unclassified |
| 23 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 24 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 25 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 26 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 27 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 28 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 29 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 30 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 31 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 32 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 33 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 34 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 35 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 36 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 37 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 38 | 2778260941 | Unclassified Fibrobacteres Th196P3bin8 | Isolate | Unclassified |
| 39 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 40 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_181922 | 3300042612 | Bacteria | 7107 |
| 2 | Ga0466731_196710 | 3300042622 | Bacteria | 4464 |
| 3 | Ga0466704_607316 | 3300042643 | Bacteria | 30733 |
| 4 | Ga0123356_10264454 | 3300010049 | Bacteria | 1806 |
| 5 | Ga0123353_10414746 | 3300010167 | Unclassified | 1998 |
| 6 | Ga0466694_220026 | 3300042594 | Bacteria | 5821 |
| 7 | Ga0466699_141077 | 3300042597 | Bacteria | 1468 |
| 8 | JGI24695J34938_10211080 | 3300002450 | Bacteria | 812 |
| 9 | Ga0072941_1051489 | 3300005201 | Bacteria | 4102 |
| 10 | Ga0466729_228072 | 3300042621 | Bacteria | 3308 |
| 11 | Ga0466702_288960 | 3300042635 | Bacteria | 2522 |
| 12 | Ga0466704_220215 | 3300042643 | Bacteria | 4851 |
| 13 | Ga0466728_020376 | 3300042620 | Bacteria | 2176 |
| 14 | Ga0123356_10078324 | 3300010049 | Bacteria | 3119 |
| 15 | Ga0123354_10349739 | 3300010882 | Unclassified | 1319 |
| 16 | Ga0264413_112783 | 3300024493 | Bacteria | 1206 |
| 17 | Ga0466692_033141 | 3300042591 | Bacteria | 1293 |
| 18 | Ga0466694_101913 | 3300042594 | Bacteria | 1681 |
| 19 | Ga0466699_120529 | 3300042597 | Bacteria | 1426 |
| 20 | Ga0466706_078466 | 3300042599 | Bacteria | 2338 |
| 21 | Ga0466707_398908 | 3300042601 | Bacteria | 3301 |
| 22 | Ga0466720_224450 | 3300042607 | Bacteria | 13432 |
| 23 | JGI24698J34947_10021789 | 3300002449 | Unclassified | 3443 |
| 24 | JGI24695J34938_10016770 | 3300002450 | Bacteria | 3714 |
| 25 | JGI24695J34938_10158103 | 3300002450 | Bacteria | 931 |
| 26 | Ga0072940_1456761 | 3300005200 | Bacteria | 1026 |
| 27 | Ga0466702_450733 | 3300042635 | Bacteria | 1440 |
| 28 | Ga0466704_217619 | 3300042643 | Unclassified | 4236 |
| 29 | Ga0466718_044901 | 3300042617 | Bacteria | 1404 |
| 30 | Ga0123356_10969046 | 3300010049 | Bacteria | 1021 |
| 31 | Ga0123356_11128918 | 3300010049 | Bacteria | 951 |
| 32 | Ga0123356_12225745 | 3300010049 | Bacteria | 685 |
| 33 | Ga0466692_092183 | 3300042591 | Unclassified | 2196 |
| 34 | Ga0466694_088741 | 3300042594 | Bacteria | 10468 |
| 35 | Ga0466694_130916 | 3300042594 | Bacteria | 1851 |
| 36 | Ga0466699_242677 | 3300042597 | Bacteria | 1660 |
| 37 | Ga0466699_387306 | 3300042597 | Bacteria | 3360 |
| 38 | Ga0466699_438806 | 3300042597 | Bacteria | 1198 |
| 39 | Ga0466719_276638 | 3300042606 | Bacteria | 1577 |
| 40 | JGI24698J34947_10242280 | 3300002449 | Bacteria | 678 |
| 41 | JGI24695J34938_10021496 | 3300002450 | Bacteria | 3155 |
| 42 | JGI24695J34938_10025109 | 3300002450 | Archaea | 2854 |
| 43 | JGI24695J34938_10029844 | 3300002450 | Bacteria | 2545 |
| 44 | Ga0466735_014108 | 3300042624 | Bacteria | 1102 |
| 45 | Ga0466702_002316 | 3300042635 | Bacteria | 4905 |
| 46 | Ga0466711_387637 | 3300042615 | Bacteria | 1764 |
| 47 | Ga0466711_427566 | 3300042615 | Bacteria | 2511 |
| 48 | Ga0466718_041885 | 3300042617 | Bacteria | 1129 |
| 49 | Ga0466718_048999 | 3300042617 | Bacteria | 1854 |
| 50 | Ga0123355_10377370 | 3300009826 | Bacteria | 1851 |
| 51 | Ga0123356_13162203 | 3300010049 | Bacteria | 573 |
| 52 | Ga0466692_043275 | 3300042591 | Bacteria | 10877 |
| 53 | Ga0466699_036314 | 3300042597 | Bacteria | 4649 |
| 54 | Ga0466699_351640 | 3300042597 | Bacteria | 3953 |
| 55 | Ga0466707_177561 | 3300042601 | Bacteria | 1234 |
| 56 | Ga0466719_272166 | 3300042606 | Bacteria | 1175 |
| 57 | 2227505757 | 2225789004 | Bacteria | 3681 |
| 58 | JGI24695J34938_10067532 | 3300002450 | Bacteria | 1504 |
| 59 | JGI24695J34938_10132132 | 3300002450 | Bacteria | 1018 |
| 60 | JGI24696J40584_12948453 | 3300002834 | Bacteria | 2006 |
| 61 | Ga0466705_260225 | 3300042612 | Bacteria | 20910 |
| 62 | Ga0466732_184963 | 3300042656 | Bacteria | 4445 |
| 63 | Ga0466732_259017 | 3300042656 | Bacteria | 1285 |
| 64 | Ga0466732_325779 | 3300042656 | Bacteria | 1105 |
| 65 | Ga0466702_105857 | 3300042635 | Bacteria | 2528 |
| 66 | Ga0466712_214885 | 3300042614 | Bacteria | 1949 |
| 67 | Ga0466729_041397 | 3300042621 | Bacteria | 19082 |
| 68 | Ga0123356_10045186 | 3300010049 | Bacteria | 4098 |
| 69 | Ga0123356_10431217 | 3300010049 | Bacteria | 1462 |
| 70 | Ga0466699_269077 | 3300042597 | Bacteria | 1386 |
| 71 | Ga0466719_492045 | 3300042606 | Bacteria | 1655 |
| 72 | Ga0466720_212953 | 3300042607 | Bacteria | 1330 |
| 73 | Ga0466698_167184 | 3300042610 | Bacteria | 1341 |
| 74 | Ga0072940_1439151 | 3300005200 | Bacteria | 1405 |
| 75 | Ga0072940_1446784 | 3300005200 | Bacteria | 627 |
| 76 | Ga0072941_1012878 | 3300005201 | Bacteria | 3559 |
| 77 | Ga0072941_1073307 | 3300005201 | Bacteria | 3348 |
| 78 | Ga0466704_444018 | 3300042643 | Bacteria | 28632 |
| 79 | Ga0466712_285131 | 3300042614 | Bacteria | 5312 |
| 80 | Ga0123356_10264348 | 3300010049 | Bacteria | 1806 |
| 81 | Ga0466694_160045 | 3300042594 | Bacteria | 3060 |
| 82 | Ga0466699_055770 | 3300042597 | Bacteria | 6106 |
| 83 | Ga0466699_170681 | 3300042597 | Bacteria | 3025 |
| 84 | Ga0072940_1373873 | 3300005200 | Bacteria | 969 |
| 85 | Ga0466705_017558 | 3300042612 | Bacteria | 9084 |
| 86 | Ga0466731_061379 | 3300042622 | Bacteria | 4698 |
| 87 | Ga0466702_155404 | 3300042635 | Bacteria | 1948 |
| 88 | Ga0466705_420995 | 3300042612 | Bacteria | 4461 |
| 89 | Ga0466712_044226 | 3300042614 | Unclassified | 3999 |
| 90 | Ga0264413_107103 | 3300024493 | Bacteria | 5646 |
| 91 | Ga0466699_271128 | 3300042597 | Bacteria | 5177 |
| 92 | Ga0466698_133142 | 3300042610 | Bacteria | 8120 |
| 93 | AustNasuHG_c1001314 | 3300000089 | Bacteria | 8915 |
| 94 | JGI24695J34938_10000099 | 3300002450 | Bacteria | 75735 |
| 95 | JGI24695J34938_10000556 | 3300002450 | Bacteria | 36040 |
| 96 | JGI24695J34938_10002273 | 3300002450 | Bacteria | 14839 |
| 97 | Ga0123357_10001124 | 3300009784 | Bacteria | 27781 |
| 98 | Ga0466705_094458 | 3300042612 | Bacteria | 5517 |
| 99 | Ga0123355_10385771 | 3300009826 | Bacteria | 1821 |
| 100 | Ga0123356_10310890 | 3300010049 | Bacteria | 1685 |
| 101 | Ga0123356_10853397 | 3300010049 | Bacteria | 1082 |
| 102 | Ga0466694_392433 | 3300042594 | Bacteria | 1947 |
| 103 | Ga0466699_387881 | 3300042597 | Bacteria | 1523 |
| 104 | Ga0466706_097149 | 3300042599 | Bacteria | 2869 |
| 105 | Ga0466706_121984 | 3300042599 | Bacteria | 1031 |
| 106 | Ga0466706_233374 | 3300042599 | Bacteria | 7667 |
| 107 | Ga0466707_213094 | 3300042601 | Bacteria | 1438 |
| 108 | Ga0072941_1024181 | 3300005201 | Bacteria | 1828 |
| 109 | Ga0072941_1026874 | 3300005201 | Bacteria | 4933 |
| 110 | Ga0072941_1044218 | 3300005201 | Bacteria | 3717 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042635 | Ga0466702_450733 | Ga0466702_450733_483_929 | 148 |
| 2 | 3300042622 | Ga0466731_061379 | Ga0466731_061379_2598_3074 | 149 |
| 3 | 3300005200 | Ga0072940_1373873 | Ga0072940_13738733 | 150 |
| 4 | 3300042597 | Ga0466699_242677 | Ga0466699_242677_467_937 | 156 |
| 5 | 3300042615 | Ga0466711_387637 | Ga0466711_387637_739_1209 | 156 |
| 6 | 3300042621 | Ga0466729_228072 | Ga0466729_228072_181_651 | 156 |
| 7 | 3300042601 | Ga0466707_213094 | Ga0466707_213094_167_640 | 157 |
| 8 | 3300042601 | Ga0466707_398908 | Ga0466707_398908_1961_2434 | 157 |
| 9 | 3300042615 | Ga0466711_427566 | Ga0466711_427566_1730_2203 | 157 |
| 10 | 3300042624 | Ga0466735_014108 | Ga0466735_014108_231_704 | 157 |
| 11 | 3300010049 | Ga0123356_10078324 | Ga0123356_100783245 | 158 |
| 12 | 3300010049 | Ga0123356_10431217 | Ga0123356_104312173 | 158 |
| 13 | 3300010882 | Ga0123354_10349739 | Ga0123354_103497393 | 158 |
| 14 | 3300024493 | Ga0264413_107103 | Ga0264413_1071032 | 158 |
| 15 | 3300042591 | Ga0466692_033141 | Ga0466692_033141_438_914 | 158 |
| 16 | 3300042594 | Ga0466694_088741 | Ga0466694_088741_9221_9697 | 158 |
| 17 | 3300042594 | Ga0466694_101913 | Ga0466694_101913_925_1401 | 158 |
| 18 | 3300042594 | Ga0466694_130916 | Ga0466694_130916_579_1055 | 158 |
| 19 | 3300042594 | Ga0466694_160045 | Ga0466694_160045_143_619 | 158 |
| 20 | 3300042594 | Ga0466694_392433 | Ga0466694_392433_119_595 | 158 |
| 21 | 3300042597 | Ga0466699_036314 | Ga0466699_036314_2062_2538 | 158 |
| 22 | 3300042597 | Ga0466699_055770 | Ga0466699_055770_388_864 | 158 |
| 23 | 3300042597 | Ga0466699_141077 | Ga0466699_141077_53_529 | 158 |
| 24 | 3300042597 | Ga0466699_170681 | Ga0466699_170681_1578_2054 | 158 |
| 25 | 3300042597 | Ga0466699_351640 | Ga0466699_351640_3175_3651 | 158 |
| 26 | 3300042597 | Ga0466699_387306 | Ga0466699_387306_2733_3209 | 158 |
| 27 | 3300042597 | Ga0466699_387881 | Ga0466699_387881_584_1060 | 158 |
| 28 | 3300042601 | Ga0466707_177561 | Ga0466707_177561_203_679 | 158 |
| 29 | 3300042607 | Ga0466720_212953 | Ga0466720_212953_182_658 | 158 |
| 30 | 3300042610 | Ga0466698_133142 | Ga0466698_133142_2079_2555 | 158 |
| 31 | 3300042610 | Ga0466698_167184 | Ga0466698_167184_515_991 | 158 |
| 32 | 3300042614 | Ga0466712_285131 | Ga0466712_285131_3034_3510 | 158 |
| 33 | 3300042617 | Ga0466718_041885 | Ga0466718_041885_116_592 | 158 |
| 34 | 3300042617 | Ga0466718_048999 | Ga0466718_048999_1057_1533 | 158 |
| 35 | 3300042622 | Ga0466731_196710 | Ga0466731_196710_1091_1567 | 158 |
| 36 | 3300042635 | Ga0466702_002316 | Ga0466702_002316_3136_3612 | 158 |
| 37 | 3300042635 | Ga0466702_288960 | Ga0466702_288960_1450_1926 | 158 |
| 38 | 3300042656 | Ga0466732_184963 | Ga0466732_184963_3749_4225 | 158 |
| 39 | 3300042656 | Ga0466732_259017 | Ga0466732_259017_524_1000 | 158 |
| 40 | 3300042656 | Ga0466732_325779 | Ga0466732_325779_331_807 | 158 |
| 41 | iso_pr_bacteria | 2740892547 | 2743913358 | 158 |
| 42 | iso_pr_bacteria | 2781125632 | 2781270135 | 158 |
| 43 | iso_pr_bacteria | 2781125643 | 2781293235 | 158 |
| 44 | iso_pr_bacteria | 2781125644 | 2781295417 | 158 |
| 45 | iso_pr_bacteria | 2781125650 | 2781308580 | 158 |
| 46 | iso_pr_bacteria | 2781125659 | 2781329196 | 158 |
| 47 | 3300000089 | AustNasuHG_c1001314 | AustNasuHG_10013145 | 159 |
| 48 | 3300002450 | JGI24695J34938_10000099 | JGI24695J34938_1000009963 | 159 |
| 49 | 3300002450 | JGI24695J34938_10000556 | JGI24695J34938_1000055636 | 159 |
| 50 | 3300002450 | JGI24695J34938_10002273 | JGI24695J34938_100022733 | 159 |
| 51 | 3300002450 | JGI24695J34938_10016770 | JGI24695J34938_100167703 | 159 |
| 52 | 3300002450 | JGI24695J34938_10021496 | JGI24695J34938_100214963 | 159 |
| 53 | 3300002450 | JGI24695J34938_10025109 | JGI24695J34938_100251094 | 159 |
| 54 | 3300002450 | JGI24695J34938_10067532 | JGI24695J34938_100675323 | 159 |
| 55 | 3300002450 | JGI24695J34938_10132132 | JGI24695J34938_101321323 | 159 |
| 56 | 3300002450 | JGI24695J34938_10158103 | JGI24695J34938_101581032 | 159 |
| 57 | 3300002450 | JGI24695J34938_10211080 | JGI24695J34938_102110801 | 159 |
| 58 | 3300005200 | Ga0072940_1446784 | Ga0072940_14467841 | 159 |
| 59 | 3300010049 | Ga0123356_10045186 | Ga0123356_100451867 | 159 |
| 60 | 3300010049 | Ga0123356_10264348 | Ga0123356_102643483 | 159 |
| 61 | 3300010049 | Ga0123356_10264454 | Ga0123356_102644542 | 159 |
| 62 | 3300010049 | Ga0123356_10310890 | Ga0123356_103108901 | 159 |
| 63 | 3300010049 | Ga0123356_10853397 | Ga0123356_108533972 | 159 |
| 64 | 3300010049 | Ga0123356_10969046 | Ga0123356_109690462 | 159 |
| 65 | 3300010049 | Ga0123356_11128918 | Ga0123356_111289181 | 159 |
| 66 | 3300010049 | Ga0123356_13162203 | Ga0123356_131622031 | 159 |
| 67 | 3300010167 | Ga0123353_10414746 | Ga0123353_104147462 | 159 |
| 68 | 3300024493 | Ga0264413_112783 | Ga0264413_1127833 | 159 |
| 69 | 3300042591 | Ga0466692_043275 | Ga0466692_043275_1531_2010 | 159 |
| 70 | 3300042591 | Ga0466692_092183 | Ga0466692_092183_634_1113 | 159 |
| 71 | 3300042594 | Ga0466694_220026 | Ga0466694_220026_2552_3031 | 159 |
| 72 | 3300042597 | Ga0466699_269077 | Ga0466699_269077_388_867 | 159 |
| 73 | 3300042597 | Ga0466699_271128 | Ga0466699_271128_4006_4485 | 159 |
| 74 | 3300042599 | Ga0466706_078466 | Ga0466706_078466_1712_2191 | 159 |
| 75 | 3300042599 | Ga0466706_233374 | Ga0466706_233374_5029_5508 | 159 |
| 76 | 3300042606 | Ga0466719_272166 | Ga0466719_272166_55_534 | 159 |
| 77 | 3300042607 | Ga0466720_224450 | Ga0466720_224450_3080_3559 | 159 |
| 78 | 3300042612 | Ga0466705_017558 | Ga0466705_017558_1716_2195 | 159 |
| 79 | 3300042614 | Ga0466712_044226 | Ga0466712_044226_2512_2991 | 159 |
| 80 | 3300042614 | Ga0466712_214885 | Ga0466712_214885_605_1084 | 159 |
| 81 | 3300042635 | Ga0466702_105857 | Ga0466702_105857_1881_2360 | 159 |
| 82 | iso_pr_bacteria | 2778260941 | 2778358946 | 159 |
| 83 | 3300002449 | JGI24698J34947_10021789 | JGI24698J34947_100217893 | 160 |
| 84 | 3300002449 | JGI24698J34947_10242280 | JGI24698J34947_102422802 | 160 |
| 85 | 3300002450 | JGI24695J34938_10029844 | JGI24695J34938_100298443 | 160 |
| 86 | 3300002834 | JGI24696J40584_12948453 | JGI24696J40584_129484532 | 160 |
| 87 | 3300005200 | Ga0072940_1439151 | Ga0072940_14391512 | 160 |
| 88 | 3300005201 | Ga0072941_1012878 | Ga0072941_10128785 | 160 |
| 89 | 3300005201 | Ga0072941_1024181 | Ga0072941_10241813 | 160 |
| 90 | 3300005201 | Ga0072941_1026874 | Ga0072941_102687412 | 160 |
| 91 | 3300005201 | Ga0072941_1044218 | Ga0072941_10442184 | 160 |
| 92 | 3300005201 | Ga0072941_1073307 | Ga0072941_10733074 | 160 |
| 93 | 3300009826 | Ga0123355_10377370 | Ga0123355_103773702 | 160 |
| 94 | 3300009826 | Ga0123355_10385771 | Ga0123355_103857713 | 160 |
| 95 | 3300010049 | Ga0123356_12225745 | Ga0123356_122257452 | 160 |
| 96 | iso_pr_bacteria | 2781125666 | 2781344744 | 161 |
| 97 | 3300009784 | Ga0123357_10001124 | Ga0123357_100011245 | 162 |
| 98 | 3300042599 | Ga0466706_097149 | Ga0466706_097149_1258_1746 | 162 |
| 99 | 3300042599 | Ga0466706_121984 | Ga0466706_121984_130_618 | 162 |
| 100 | 3300042606 | Ga0466719_492045 | Ga0466719_492045_619_1110 | 163 |
| 101 | 3300042612 | Ga0466705_094458 | Ga0466705_094458_483_974 | 163 |
| 102 | 3300042612 | Ga0466705_181922 | Ga0466705_181922_3081_3572 | 163 |
| 103 | 3300042612 | Ga0466705_260225 | Ga0466705_260225_8653_9144 | 163 |
| 104 | 3300042612 | Ga0466705_420995 | Ga0466705_420995_570_1061 | 163 |
| 105 | 3300042617 | Ga0466718_044901 | Ga0466718_044901_238_729 | 163 |
| 106 | 3300042621 | Ga0466729_041397 | Ga0466729_041397_10726_11217 | 163 |
| 107 | 3300042635 | Ga0466702_155404 | Ga0466702_155404_1102_1593 | 163 |
| 108 | 3300042643 | Ga0466704_217619 | Ga0466704_217619_2368_2859 | 163 |
| 109 | 3300042643 | Ga0466704_444018 | Ga0466704_444018_12421_12912 | 163 |
| 110 | 3300042643 | Ga0466704_607316 | Ga0466704_607316_28824_29315 | 163 |
| 111 | 3300005200 | Ga0072940_1456761 | Ga0072940_14567612 | 164 |
| 112 | 3300042606 | Ga0466719_276638 | Ga0466719_276638_296_790 | 164 |
| 113 | 3300042620 | Ga0466728_020376 | Ga0466728_020376_1494_1988 | 164 |
| 114 | 3300042643 | Ga0466704_220215 | Ga0466704_220215_3239_3739 | 166 |
| 115 | 3300042597 | Ga0466699_438806 | Ga0466699_438806_586_1089 | 167 |
| 116 | 2225789004 | 2227505757 | 2227993368 | 168 |
| 117 | 3300005201 | Ga0072941_1051489 | Ga0072941_10514894 | 171 |
| 118 | 3300042597 | Ga0466699_120529 | Ga0466699_120529_777_1367 | 196 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF13151 | DUF3990 | Protein of unknown function (DUF3990) | 1 | 162 | 0.94 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.84 | 0.84 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.