Protein Family IF01322
Metagenome
Isolate
148
Members
47
Samples
143
Scaffolds
77.73
Avg Length
Representative Sequence
- ID
- 3300005201|Ga0072941_1048646|Ga0072941_10486463
- Length
- 79 aa
- Sequence
- MNLEIITPEKTVYSGPAESVTLPGLINGIFTILDRHAPIISALTKGVVTYSVDGKKTEITTNGGFVEAKNNNVSVCIE*
Sample Types
Isolate
3.4%
Metagenome
96.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
39.1%
Kalotermitidae
26.1%
Unclassified
13.0%
Termopsidae
8.7%
Rhinotermitidae
6.5%
Passalidae
4.3%
Blattidae
2.2%
Taxonomy
Archaea
0
Bacteria
144
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 2 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 3 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 4 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 5 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 6 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 7 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 8 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 9 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 10 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 11 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 12 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 13 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 14 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 15 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 16 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 17 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 18 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 19 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 20 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 21 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 22 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 23 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 24 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 25 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 26 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 27 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 28 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 29 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 30 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 31 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 32 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 33 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 34 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 35 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 36 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 37 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 38 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 39 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 40 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 41 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 42 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 43 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 44 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 45 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 46 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 47 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466715_501308 | 3300042616 | Bacteria | 12254 |
| 2 | Ga0466713_035478 | 3300042602 | Bacteria | 46123 |
| 3 | Ga0466716_271544 | 3300042605 | Bacteria | 1456 |
| 4 | Ga0466716_456868 | 3300042605 | Bacteria | 3420 |
| 5 | Ga0466722_180069 | 3300042609 | Bacteria | 8217 |
| 6 | Ga0123357_10044974 | 3300009784 | Bacteria | 5992 |
| 7 | Ga0123353_10676403 | 3300010167 | Bacteria | 1455 |
| 8 | Ga0466735_072164 | 3300042624 | Bacteria | 9859 |
| 9 | Ga0466735_083454 | 3300042624 | Bacteria | 1509 |
| 10 | Ga0466656_055288 | 3300042550 | Bacteria | 2154 |
| 11 | Ga0466690_196376 | 3300042590 | Bacteria | 23671 |
| 12 | Ga0466692_138989 | 3300042591 | Bacteria | 1927 |
| 13 | Ga0466693_334634 | 3300042592 | Bacteria | 1413 |
| 14 | Ga0466696_499451 | 3300042596 | Bacteria | 6526 |
| 15 | 2227630172 | 2225789004 | Bacteria | 11449 |
| 16 | IMNBL1DRAFT_c0006908 | 3300000062 | Bacteria | 6085 |
| 17 | IMNBL1DRAFT_c0142273 | 3300000062 | Bacteria | 619 |
| 18 | JGI24702J35022_10712704 | 3300002462 | Bacteria | 624 |
| 19 | JGI24699J35502_11132843 | 3300002509 | Bacteria | 7751 |
| 20 | Ga0068302_10127927 | 3300005071 | Bacteria | 842 |
| 21 | Ga0466711_100795 | 3300042615 | Bacteria | 3093 |
| 22 | Ga0466726_153404 | 3300042619 | Bacteria | 17099 |
| 23 | Ga0466716_328087 | 3300042605 | Bacteria | 1141 |
| 24 | Ga0466719_331592 | 3300042606 | Bacteria | 1071 |
| 25 | Ga0123353_10429605 | 3300010167 | Bacteria | 1954 |
| 26 | Ga0123353_11137669 | 3300010167 | Bacteria | 1032 |
| 27 | Ga0123354_10000296 | 3300010882 | Bacteria | 45682 |
| 28 | Ga0123354_10000685 | 3300010882 | Bacteria | 36047 |
| 29 | Ga0466735_045857 | 3300042624 | Bacteria | 1341 |
| 30 | Ga0466735_145966 | 3300042624 | Bacteria | 4628 |
| 31 | Ga0466703_206568 | 3300042636 | Bacteria | 4996 |
| 32 | Ga0466727_082046 | 3300042655 | Bacteria | 3407 |
| 33 | Ga0466692_169657 | 3300042591 | Bacteria | 2135 |
| 34 | IMNBL1DRAFT_c0000013 | 3300000062 | Bacteria | 180832 |
| 35 | IMNBL1DRAFT_c0015177 | 3300000062 | Bacteria | 3352 |
| 36 | Ga0466729_173707 | 3300042621 | Bacteria | 1559 |
| 37 | Ga0466700_041000 | 3300042600 | Bacteria | 6996 |
| 38 | Ga0466719_336517 | 3300042606 | Bacteria | 3259 |
| 39 | Ga0123357_10112708 | 3300009784 | Bacteria | 3460 |
| 40 | Ga0123356_10014859 | 3300010049 | Bacteria | 7475 |
| 41 | Ga0123356_10083576 | 3300010049 | Bacteria | 3025 |
| 42 | Ga0123354_10209159 | 3300010882 | Bacteria | 2115 |
| 43 | Ga0466696_374757 | 3300042596 | Bacteria | 1683 |
| 44 | JGI24702J35022_10000113 | 3300002462 | Bacteria | 38522 |
| 45 | JGI24702J35022_10005457 | 3300002462 | Bacteria | 7424 |
| 46 | JGI24705J35276_11996246 | 3300002504 | Bacteria | 843 |
| 47 | Ga0466711_399050 | 3300042615 | Bacteria | 5437 |
| 48 | Ga0466715_123526 | 3300042616 | Bacteria | 19351 |
| 49 | Ga0466715_206806 | 3300042616 | Bacteria | 30290 |
| 50 | Ga0466723_258360 | 3300042618 | Bacteria | 3492 |
| 51 | Ga0466701_053727 | 3300042598 | Bacteria | 58706 |
| 52 | Ga0466707_063557 | 3300042601 | Bacteria | 1004 |
| 53 | Ga0123357_10010099 | 3300009784 | Bacteria | 11976 |
| 54 | Ga0123353_11789963 | 3300010167 | Bacteria | 764 |
| 55 | Ga0466735_016838 | 3300042624 | Bacteria | 28411 |
| 56 | Ga0466735_033740 | 3300042624 | Bacteria | 3668 |
| 57 | Ga0466735_208275 | 3300042624 | Bacteria | 1053 |
| 58 | Ga0466692_052812 | 3300042591 | Bacteria | 38556 |
| 59 | Ga0466692_105261 | 3300042591 | Bacteria | 18499 |
| 60 | Ga0466692_109685 | 3300042591 | Bacteria | 126606 |
| 61 | Ga0466694_404552 | 3300042594 | Bacteria | 1277 |
| 62 | 2227518514 | 2225789004 | Bacteria | 3389 |
| 63 | IMNBL1DRAFT_c0053988 | 3300000062 | Bacteria | 1248 |
| 64 | JGI24702J35022_10197463 | 3300002462 | Bacteria | 1150 |
| 65 | Ga0466723_130585 | 3300042618 | Bacteria | 7655 |
| 66 | Ga0466723_235111 | 3300042618 | Bacteria | 13674 |
| 67 | Ga0466719_506368 | 3300042606 | Unclassified | 1895 |
| 68 | Ga0123357_10003885 | 3300009784 | Bacteria | 17329 |
| 69 | Ga0123357_10506470 | 3300009784 | Bacteria | 998 |
| 70 | Ga0123353_11979964 | 3300010167 | Bacteria | 715 |
| 71 | Ga0123354_10066431 | 3300010882 | Bacteria | 5267 |
| 72 | Ga0123354_10746865 | 3300010882 | Bacteria | 671 |
| 73 | Ga0466735_069375 | 3300042624 | Bacteria | 1146 |
| 74 | Ga0466735_225275 | 3300042624 | Bacteria | 1002 |
| 75 | Ga0466703_415956 | 3300042636 | Bacteria | 38924 |
| 76 | Ga0466704_009030 | 3300042643 | Bacteria | 11297 |
| 77 | Ga0466656_307241 | 3300042550 | Bacteria | 34645 |
| 78 | Ga0466690_160070 | 3300042590 | Bacteria | 10336 |
| 79 | Ga0466694_273082 | 3300042594 | Bacteria | 2078 |
| 80 | Ga0466694_355591 | 3300042594 | Bacteria | 3605 |
| 81 | JGI24702J35022_10360149 | 3300002462 | Bacteria | 871 |
| 82 | JGI24702J35022_10499015 | 3300002462 | Bacteria | 746 |
| 83 | JGI24699J35502_11133587 | 3300002509 | Bacteria | 12286 |
| 84 | Ga0123357_10001032 | 3300009784 | Bacteria | 28568 |
| 85 | Ga0466697_238755 | 3300042611 | Bacteria | 1130 |
| 86 | Ga0466728_221211 | 3300042620 | Bacteria | 8066 |
| 87 | Ga0466729_169615 | 3300042621 | Bacteria | 2403 |
| 88 | Ga0466700_179274 | 3300042600 | Bacteria | 9448 |
| 89 | Ga0466700_337276 | 3300042600 | Bacteria | 2512 |
| 90 | Ga0466707_405332 | 3300042601 | Bacteria | 8121 |
| 91 | Ga0466719_001026 | 3300042606 | Bacteria | 4745 |
| 92 | Ga0466719_095416 | 3300042606 | Bacteria | 7592 |
| 93 | Ga0123356_10133304 | 3300010049 | Bacteria | 2438 |
| 94 | Ga0123356_13025762 | 3300010049 | Bacteria | 587 |
| 95 | Ga0123354_10155272 | 3300010882 | Bacteria | 2749 |
| 96 | Ga0123354_10241462 | 3300010882 | Bacteria | 1857 |
| 97 | Ga0466703_053508 | 3300042636 | Bacteria | 8515 |
| 98 | Ga0466727_320987 | 3300042655 | Bacteria | 5191 |
| 99 | Ga0466656_273470 | 3300042550 | Bacteria | 1354 |
| 100 | Ga0466690_156317 | 3300042590 | Bacteria | 10842 |
| 101 | Ga0466699_327335 | 3300042597 | Bacteria | 1020 |
| 102 | 2227545599 | 2225789004 | Unclassified | 593 |
| 103 | JGI24698J34947_10025622 | 3300002449 | Bacteria | 3137 |
| 104 | JGI24705J35276_12215299 | 3300002504 | Bacteria | 1997 |
| 105 | JGI24699J35502_10403833 | 3300002509 | Bacteria | 565 |
| 106 | JGI24699J35502_11133718 | 3300002509 | Bacteria | 14148 |
| 107 | Ga0068302_10453838 | 3300005071 | Bacteria | 890 |
| 108 | Ga0466697_274465 | 3300042611 | Bacteria | 2620 |
| 109 | Ga0466705_065239 | 3300042612 | Bacteria | 11019 |
| 110 | Ga0466711_111293 | 3300042615 | Bacteria | 45504 |
| 111 | Ga0466715_275956 | 3300042616 | Bacteria | 10320 |
| 112 | Ga0466726_093986 | 3300042619 | Bacteria | 1887 |
| 113 | Ga0466729_184389 | 3300042621 | Bacteria | 9008 |
| 114 | Ga0466701_076167 | 3300042598 | Bacteria | 1773 |
| 115 | Ga0466707_023988 | 3300042601 | Bacteria | 2240 |
| 116 | Ga0466707_175281 | 3300042601 | Bacteria | 1750 |
| 117 | Ga0466707_207598 | 3300042601 | Unclassified | 1659 |
| 118 | Ga0466707_280256 | 3300042601 | Bacteria | 8588 |
| 119 | Ga0123357_10147211 | 3300009784 | Bacteria | 2872 |
| 120 | Ga0123357_10214003 | 3300009784 | Bacteria | 2157 |
| 121 | Ga0123357_10517731 | 3300009784 | Unclassified | 977 |
| 122 | Ga0123356_10855241 | 3300010049 | Bacteria | 1081 |
| 123 | Ga0123354_10795574 | 3300010882 | Bacteria | 638 |
| 124 | Ga0466729_258755 | 3300042621 | Bacteria | 2800 |
| 125 | Ga0466734_138136 | 3300042623 | Bacteria | 1270 |
| 126 | Ga0466735_073312 | 3300042624 | Bacteria | 2568 |
| 127 | Ga0466704_178296 | 3300042643 | Bacteria | 9653 |
| 128 | Ga0466692_204226 | 3300042591 | Bacteria | 1028 |
| 129 | Ga0466691_205599 | 3300042593 | Bacteria | 5015 |
| 130 | 2227473150 | 2225789004 | Bacteria | 907 |
| 131 | JGI24705J35276_12236151 | 3300002504 | Bacteria | 7558 |
| 132 | JGI24696J40584_12946738 | 3300002834 | Bacteria | 1914 |
| 133 | Ga0072941_1048646 | 3300005201 | Bacteria | 1911 |
| 134 | Ga0466732_409480 | 3300042656 | Bacteria | 1477 |
| 135 | Ga0466722_216688 | 3300042609 | Bacteria | 1381 |
| 136 | Ga0123353_11375553 | 3300010167 | Bacteria | 910 |
| 137 | Ga0123353_12907860 | 3300010167 | Bacteria | 558 |
| 138 | Ga0123354_10122218 | 3300010882 | Bacteria | 3353 |
| 139 | Ga0123354_10795569 | 3300010882 | Bacteria | 638 |
| 140 | Ga0466694_118251 | 3300042594 | Bacteria | 1096 |
| 141 | 2227496140 | 2225789004 | Bacteria | 764 |
| 142 | IMNBL1DRAFT_c0001635 | 3300000062 | Bacteria | 16581 |
| 143 | Ga0072941_1398804 | 3300005201 | Bacteria | 890 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 2225789004 | 2227473150 | 2227921727 | 77 |
| 2 | 2225789004 | 2227496140 | 2227973574 | 77 |
| 3 | 2225789004 | 2227518514 | 2228019438 | 77 |
| 4 | 2225789004 | 2227545599 | 2228070906 | 77 |
| 5 | 2225789004 | 2227630172 | 2228213825 | 77 |
| 6 | 3300042550 | Ga0466656_055288 | Ga0466656_055288_1830_2063 | 77 |
| 7 | 3300042550 | Ga0466656_273470 | Ga0466656_273470_903_1136 | 77 |
| 8 | 3300042550 | Ga0466656_307241 | Ga0466656_307241_17492_17725 | 77 |
| 9 | 3300042590 | Ga0466690_160070 | Ga0466690_160070_7812_8045 | 77 |
| 10 | 3300042590 | Ga0466690_196376 | Ga0466690_196376_21031_21264 | 77 |
| 11 | 3300042591 | Ga0466692_052812 | Ga0466692_052812_31344_31577 | 77 |
| 12 | 3300042591 | Ga0466692_105261 | Ga0466692_105261_9535_9768 | 77 |
| 13 | 3300042591 | Ga0466692_109685 | Ga0466692_109685_20663_20896 | 77 |
| 14 | 3300042591 | Ga0466692_138989 | Ga0466692_138989_1330_1563 | 77 |
| 15 | 3300042591 | Ga0466692_169657 | Ga0466692_169657_1855_2088 | 77 |
| 16 | 3300042591 | Ga0466692_204226 | Ga0466692_204226_715_948 | 77 |
| 17 | 3300042592 | Ga0466693_334634 | Ga0466693_334634_497_730 | 77 |
| 18 | 3300042593 | Ga0466691_205599 | Ga0466691_205599_2630_2863 | 77 |
| 19 | 3300042594 | Ga0466694_118251 | Ga0466694_118251_374_607 | 77 |
| 20 | 3300042594 | Ga0466694_273082 | Ga0466694_273082_613_846 | 77 |
| 21 | 3300042594 | Ga0466694_355591 | Ga0466694_355591_475_708 | 77 |
| 22 | 3300042594 | Ga0466694_404552 | Ga0466694_404552_586_819 | 77 |
| 23 | 3300042596 | Ga0466696_374757 | Ga0466696_374757_776_1009 | 77 |
| 24 | 3300042596 | Ga0466696_499451 | Ga0466696_499451_1756_1989 | 77 |
| 25 | 3300042597 | Ga0466699_327335 | Ga0466699_327335_473_706 | 77 |
| 26 | 3300042598 | Ga0466701_076167 | Ga0466701_076167_563_796 | 77 |
| 27 | 3300042600 | Ga0466700_041000 | Ga0466700_041000_465_698 | 77 |
| 28 | 3300042600 | Ga0466700_179274 | Ga0466700_179274_7216_7449 | 77 |
| 29 | 3300042600 | Ga0466700_337276 | Ga0466700_337276_1040_1273 | 77 |
| 30 | 3300042601 | Ga0466707_023988 | Ga0466707_023988_1129_1362 | 77 |
| 31 | 3300042601 | Ga0466707_063557 | Ga0466707_063557_436_669 | 77 |
| 32 | 3300042601 | Ga0466707_175281 | Ga0466707_175281_1444_1677 | 77 |
| 33 | 3300042601 | Ga0466707_207598 | Ga0466707_207598_461_694 | 77 |
| 34 | 3300042601 | Ga0466707_280256 | Ga0466707_280256_5171_5404 | 77 |
| 35 | 3300042601 | Ga0466707_405332 | Ga0466707_405332_4635_4868 | 77 |
| 36 | 3300042602 | Ga0466713_035478 | Ga0466713_035478_6272_6505 | 77 |
| 37 | 3300042605 | Ga0466716_271544 | Ga0466716_271544_633_866 | 77 |
| 38 | 3300042605 | Ga0466716_328087 | Ga0466716_328087_516_749 | 77 |
| 39 | 3300042605 | Ga0466716_456868 | Ga0466716_456868_1212_1445 | 77 |
| 40 | 3300042606 | Ga0466719_001026 | Ga0466719_001026_1256_1489 | 77 |
| 41 | 3300042606 | Ga0466719_095416 | Ga0466719_095416_4590_4823 | 77 |
| 42 | 3300042606 | Ga0466719_331592 | Ga0466719_331592_209_442 | 77 |
| 43 | 3300042606 | Ga0466719_336517 | Ga0466719_336517_27_260 | 77 |
| 44 | 3300042606 | Ga0466719_506368 | Ga0466719_506368_1112_1345 | 77 |
| 45 | 3300042609 | Ga0466722_180069 | Ga0466722_180069_2643_2876 | 77 |
| 46 | 3300042609 | Ga0466722_216688 | Ga0466722_216688_670_903 | 77 |
| 47 | 3300042611 | Ga0466697_238755 | Ga0466697_238755_481_714 | 77 |
| 48 | 3300042611 | Ga0466697_274465 | Ga0466697_274465_1747_1980 | 77 |
| 49 | 3300042612 | Ga0466705_065239 | Ga0466705_065239_6595_6828 | 77 |
| 50 | 3300042615 | Ga0466711_100795 | Ga0466711_100795_657_890 | 77 |
| 51 | 3300042615 | Ga0466711_111293 | Ga0466711_111293_38034_38267 | 77 |
| 52 | 3300042616 | Ga0466715_123526 | Ga0466715_123526_1840_2073 | 77 |
| 53 | 3300042616 | Ga0466715_206806 | Ga0466715_206806_123_356 | 77 |
| 54 | 3300042616 | Ga0466715_275956 | Ga0466715_275956_5869_6102 | 77 |
| 55 | 3300042618 | Ga0466723_130585 | Ga0466723_130585_2507_2740 | 77 |
| 56 | 3300042618 | Ga0466723_235111 | Ga0466723_235111_5387_5620 | 77 |
| 57 | 3300042618 | Ga0466723_258360 | Ga0466723_258360_2375_2608 | 77 |
| 58 | 3300042619 | Ga0466726_093986 | Ga0466726_093986_170_403 | 77 |
| 59 | 3300042619 | Ga0466726_153404 | Ga0466726_153404_14214_14447 | 77 |
| 60 | 3300042620 | Ga0466728_221211 | Ga0466728_221211_6298_6531 | 77 |
| 61 | 3300042621 | Ga0466729_169615 | Ga0466729_169615_378_611 | 77 |
| 62 | 3300042621 | Ga0466729_173707 | Ga0466729_173707_687_920 | 77 |
| 63 | 3300042621 | Ga0466729_184389 | Ga0466729_184389_8561_8794 | 77 |
| 64 | 3300042621 | Ga0466729_258755 | Ga0466729_258755_561_794 | 77 |
| 65 | 3300042623 | Ga0466734_138136 | Ga0466734_138136_444_677 | 77 |
| 66 | 3300042624 | Ga0466735_016838 | Ga0466735_016838_1635_1868 | 77 |
| 67 | 3300042624 | Ga0466735_033740 | Ga0466735_033740_975_1208 | 77 |
| 68 | 3300042624 | Ga0466735_045857 | Ga0466735_045857_999_1232 | 77 |
| 69 | 3300042624 | Ga0466735_069375 | Ga0466735_069375_343_576 | 77 |
| 70 | 3300042624 | Ga0466735_072164 | Ga0466735_072164_1565_1798 | 77 |
| 71 | 3300042624 | Ga0466735_073312 | Ga0466735_073312_116_349 | 77 |
| 72 | 3300042624 | Ga0466735_083454 | Ga0466735_083454_620_853 | 77 |
| 73 | 3300042624 | Ga0466735_145966 | Ga0466735_145966_544_777 | 77 |
| 74 | 3300042624 | Ga0466735_208275 | Ga0466735_208275_435_668 | 77 |
| 75 | 3300042624 | Ga0466735_225275 | Ga0466735_225275_194_427 | 77 |
| 76 | 3300042636 | Ga0466703_053508 | Ga0466703_053508_1327_1560 | 77 |
| 77 | 3300042636 | Ga0466703_206568 | Ga0466703_206568_2415_2648 | 77 |
| 78 | 3300042636 | Ga0466703_415956 | Ga0466703_415956_3170_3403 | 77 |
| 79 | 3300042643 | Ga0466704_009030 | Ga0466704_009030_8630_8863 | 77 |
| 80 | 3300042643 | Ga0466704_178296 | Ga0466704_178296_9092_9325 | 77 |
| 81 | 3300042655 | Ga0466727_082046 | Ga0466727_082046_1507_1740 | 77 |
| 82 | 3300042655 | Ga0466727_320987 | Ga0466727_320987_3244_3477 | 77 |
| 83 | 3300042656 | Ga0466732_409480 | Ga0466732_409480_1169_1402 | 77 |
| 84 | iso_pr_bacteria | 2820759988 | 2820760342 | 77 |
| 85 | iso_pr_bacteria | 2940216256 | 2940217833 | 77 |
| 86 | iso_pr_bacteria | 2967483437 | 2967483911 | 77 |
| 87 | iso_pr_bacteria | 643348524 | 643422773 | 77 |
| 88 | 3300000062 | IMNBL1DRAFT_c0000013 | IMNBL1DRAFT_0000013109 | 78 |
| 89 | 3300000062 | IMNBL1DRAFT_c0001635 | IMNBL1DRAFT_000163516 | 78 |
| 90 | 3300000062 | IMNBL1DRAFT_c0015177 | IMNBL1DRAFT_00151777 | 78 |
| 91 | 3300002462 | JGI24702J35022_10000113 | JGI24702J35022_100001136 | 78 |
| 92 | 3300002462 | JGI24702J35022_10005457 | JGI24702J35022_100054573 | 78 |
| 93 | 3300002462 | JGI24702J35022_10197463 | JGI24702J35022_101974632 | 78 |
| 94 | 3300002462 | JGI24702J35022_10712704 | JGI24702J35022_107127042 | 78 |
| 95 | 3300002504 | JGI24705J35276_11996246 | JGI24705J35276_119962462 | 78 |
| 96 | 3300002504 | JGI24705J35276_12215299 | JGI24705J35276_122152992 | 78 |
| 97 | 3300002504 | JGI24705J35276_12236151 | JGI24705J35276_1223615110 | 78 |
| 98 | 3300002509 | JGI24699J35502_10403833 | JGI24699J35502_104038332 | 78 |
| 99 | 3300002509 | JGI24699J35502_11132843 | JGI24699J35502_111328432 | 78 |
| 100 | 3300002509 | JGI24699J35502_11133718 | JGI24699J35502_111337187 | 78 |
| 101 | 3300002834 | JGI24696J40584_12946738 | JGI24696J40584_129467383 | 78 |
| 102 | 3300005071 | Ga0068302_10127927 | Ga0068302_101279272 | 78 |
| 103 | 3300005071 | Ga0068302_10453838 | Ga0068302_104538382 | 78 |
| 104 | 3300009784 | Ga0123357_10001032 | Ga0123357_1000103220 | 78 |
| 105 | 3300009784 | Ga0123357_10003885 | Ga0123357_1000388510 | 78 |
| 106 | 3300009784 | Ga0123357_10010099 | Ga0123357_100100992 | 78 |
| 107 | 3300009784 | Ga0123357_10044974 | Ga0123357_100449744 | 78 |
| 108 | 3300009784 | Ga0123357_10112708 | Ga0123357_101127082 | 78 |
| 109 | 3300009784 | Ga0123357_10147211 | Ga0123357_101472113 | 78 |
| 110 | 3300009784 | Ga0123357_10214003 | Ga0123357_102140034 | 78 |
| 111 | 3300009784 | Ga0123357_10517731 | Ga0123357_105177312 | 78 |
| 112 | 3300010049 | Ga0123356_10014859 | Ga0123356_100148593 | 78 |
| 113 | 3300010049 | Ga0123356_10083576 | Ga0123356_100835763 | 78 |
| 114 | 3300010049 | Ga0123356_10855241 | Ga0123356_108552411 | 78 |
| 115 | 3300010049 | Ga0123356_13025762 | Ga0123356_130257622 | 78 |
| 116 | 3300010167 | Ga0123353_10429605 | Ga0123353_104296053 | 78 |
| 117 | 3300010167 | Ga0123353_10676403 | Ga0123353_106764032 | 78 |
| 118 | 3300010167 | Ga0123353_11375553 | Ga0123353_113755532 | 78 |
| 119 | 3300010167 | Ga0123353_11789963 | Ga0123353_117899632 | 78 |
| 120 | 3300010167 | Ga0123353_11979964 | Ga0123353_119799642 | 78 |
| 121 | 3300010167 | Ga0123353_12907860 | Ga0123353_129078602 | 78 |
| 122 | 3300010882 | Ga0123354_10000296 | Ga0123354_1000029620 | 78 |
| 123 | 3300010882 | Ga0123354_10000685 | Ga0123354_1000068537 | 78 |
| 124 | 3300010882 | Ga0123354_10066431 | Ga0123354_100664313 | 78 |
| 125 | 3300010882 | Ga0123354_10122218 | Ga0123354_101222182 | 78 |
| 126 | 3300010882 | Ga0123354_10155272 | Ga0123354_101552721 | 78 |
| 127 | 3300010882 | Ga0123354_10209159 | Ga0123354_102091593 | 78 |
| 128 | 3300010882 | Ga0123354_10241462 | Ga0123354_102414623 | 78 |
| 129 | 3300010882 | Ga0123354_10746865 | Ga0123354_107468652 | 78 |
| 130 | 3300010882 | Ga0123354_10795569 | Ga0123354_107955691 | 78 |
| 131 | 3300010882 | Ga0123354_10795574 | Ga0123354_107955741 | 78 |
| 132 | 3300042616 | Ga0466715_501308 | Ga0466715_501308_4524_4760 | 78 |
| 133 | 3300002449 | JGI24698J34947_10025622 | JGI24698J34947_100256223 | 79 |
| 134 | 3300005201 | Ga0072941_1048646 | Ga0072941_10486463 | 79 |
| 135 | 3300005201 | Ga0072941_1398804 | Ga0072941_13988042 | 79 |
| 136 | 3300010049 | Ga0123356_10133304 | Ga0123356_101333043 | 79 |
| 137 | 3300010167 | Ga0123353_11137669 | Ga0123353_111376693 | 79 |
| 138 | 3300042615 | Ga0466711_399050 | Ga0466711_399050_387_626 | 79 |
| 139 | iso_pr_bacteria | 2820762746 | 2820763085 | 79 |
| 140 | 3300000062 | IMNBL1DRAFT_c0006908 | IMNBL1DRAFT_00069083 | 80 |
| 141 | 3300000062 | IMNBL1DRAFT_c0053988 | IMNBL1DRAFT_00539882 | 80 |
| 142 | 3300002509 | JGI24699J35502_11133587 | JGI24699J35502_1113358712 | 80 |
| 143 | 3300042598 | Ga0466701_053727 | Ga0466701_053727_49165_49407 | 80 |
| 144 | 3300000062 | IMNBL1DRAFT_c0142273 | IMNBL1DRAFT_01422732 | 83 |
| 145 | 3300002462 | JGI24702J35022_10360149 | JGI24702J35022_103601492 | 84 |
| 146 | 3300002462 | JGI24702J35022_10499015 | JGI24702J35022_104990151 | 84 |
| 147 | 3300042590 | Ga0466690_156317 | Ga0466690_156317_9798_10055 | 85 |
| 148 | 3300009784 | Ga0123357_10506470 | Ga0123357_105064702 | 86 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02823 | ATP-synt_DE_N | ATP synthase, Delta/Epsilon chain, beta-sandwich domain | 1 | 77 | 0.96 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02823 | GO:0015986 | proton motive force-driven ATP synthesis | BP |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.86 | 0.86 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.