Protein Family IF01307

Metagenome Isolate
114 Members
30 Samples
107 Scaffolds
217.45 Avg Length

🧬 Representative Sequence

ID
3300005201|Ga0072941_1024066|Ga0072941_10240662
Length
234 aa
Sequence
MTFWVRNGRFKGGKMKVVLITALNKDFDKKLTAVFARENYKTYAMGNEQQQIDGVTLLPLDPKEAAAVLQKDAGHIDIYIDVSDERSSSDNFNIRDGMNEQVIRELYEANVLRPMAMLEAFMPLLENGEGKRLCFLTSAEASINETRAVDGFGYKMAKAGLHNFLQITRNVLAPKGYTIRAYDPMYHEVTAELSAEAALNYFTRRRGIEGGDNLRDDEGNIVFRDAYGRQHSW*

📊 Sample Types

Isolate 6.1%
Metagenome 93.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 75.0%
Unclassified 25.0%

🌳 Taxonomy

Archaea 1
Bacteria 104
Eukaryota 0
Viruses 0
Unclassified 9

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2030936001 Nasutitermes corniger hindgut microbial communities from Florida, USA Metagenome Termitidae
2 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
3 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
4 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
5 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
6 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
7 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
8 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
9 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
10 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
11 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
12 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
13 2781125664 Treponema sp. Emb289P3bin139 Isolate Unclassified
14 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
15 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
16 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
17 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
18 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
19 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
20 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
21 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
22 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
23 2781125647 Treponema sp. Co191P3bin16 Isolate Unclassified
24 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
25 2820267566 Unclassified Firmicutes Th196P3bin33 Isolate Unclassified
26 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
27 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
28 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
29 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
30 2781125636 Treponema sp. Co191P1bin67 Isolate Unclassified

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Nasutiter_Contig26122 2030936001 Bacteria 1839
2 JGI24698J34947_10024235 3300002449 Bacteria 3242
3 JGI24698J34947_10029700 3300002449 Bacteria 2887
4 Ga0072941_1000318 3300005201 Bacteria 17818
5 Ga0072941_1015277 3300005201 Bacteria 2513
6 Ga0072941_1024066 3300005201 Bacteria 1983
7 Ga0072941_1226138 3300005201 Bacteria 1811
8 Ga0466712_036891 3300042614 Bacteria 2538
9 Ga0466698_241290 3300042610 Bacteria 1103
10 Ga0123356_10003305 3300010049 Bacteria 16938
11 JGI24698J34947_10060908 3300002449 Bacteria 1860
12 JGI24698J34947_10073512 3300002449 Bacteria 1631
13 JGI24695J34938_10000482 3300002450 Bacteria 38779
14 JGI24695J34938_10004973 3300002450 Bacteria 8482
15 JGI24695J34938_10022311 3300002450 Bacteria 3076
16 Ga0466712_045657 3300042614 Bacteria 1862
17 Ga0466712_052210 3300042614 Bacteria 1836
18 Ga0466718_011860 3300042617 Bacteria 3541
19 Ga0466718_144135 3300042617 Bacteria 2023
20 Ga0264413_146509 3300024493 Bacteria 2535
21 Ga0466693_284844 3300042592 Bacteria 28082
22 Ga0466694_213195 3300042594 Bacteria 1615
23 Ga0123356_10001385 3300010049 Bacteria 26877
24 Ga0123353_10089624 3300010167 Bacteria 4952
25 Ga0123353_10241233 3300010167 Bacteria 2808
26 JGI24698J34947_10018280 3300002449 Unclassified 3790
27 JGI24698J34947_10080561 3300002449 Bacteria 1529
28 Ga0072941_1046618 3300005201 Bacteria 1656
29 Ga0466712_005865 3300042614 Bacteria 26501
30 Ga0466718_007609 3300042617 Bacteria 2731
31 Ga0466699_172400 3300042597 Bacteria 1563
32 Ga0466699_211444 3300042597 Bacteria 1764
33 Ga0123357_10209582 3300009784 Bacteria 2193
34 Ga0123356_10000073 3300010049 Bacteria 106706
35 Ga0466731_405126 3300042622 Bacteria 1366
36 Ga0466732_383957 3300042656 Bacteria 1377
37 JGI24698J34947_10066342 3300002449 Bacteria 1756
38 JGI24695J34938_10022538 3300002450 Unclassified 3056
39 Ga0072941_1059041 3300005201 Bacteria 1398
40 Ga0072941_1111772 3300005201 Bacteria 2208
41 Ga0466712_128075 3300042614 Bacteria 17619
42 Ga0466718_061796 3300042617 Bacteria 2493
43 Ga0264413_107518 3300024493 Bacteria 40797
44 Ga0466694_308894 3300042594 Bacteria 1147
45 Ga0466699_065829 3300042597 Bacteria 14339
46 Ga0123356_10004244 3300010049 Bacteria 14833
47 Ga0123356_10071794 3300010049 Bacteria 3250
48 Ga0123353_10083082 3300010167 Bacteria 5153
49 AustNasuHG_c1000066 3300000089 Bacteria 28642
50 JGI24698J34947_10053115 3300002449 Bacteria 2029
51 JGI24698J34947_10065353 3300002449 Bacteria 1774
52 JGI24698J34947_10106199 3300002449 Bacteria 1250
53 JGI24695J34938_10044835 3300002450 Bacteria 1965
54 Ga0072940_1030110 3300005200 Bacteria 16965
55 Ga0072941_1033305 3300005201 Bacteria 4313
56 Ga0466712_115774 3300042614 Unclassified 1241
57 Ga0466718_109220 3300042617 Bacteria 21117
58 Ga0466717_083268 3300042604 Bacteria 1373
59 Ga0466721_309567 3300042608 Bacteria 7454
60 Ga0466694_391389 3300042594 Bacteria 2063
61 Ga0466699_046007 3300042597 Bacteria 5692
62 Ga0466699_076449 3300042597 Bacteria 17970
63 Ga0466699_243244 3300042597 Bacteria 7863
64 Ga0123356_10010149 3300010049 Bacteria 9262
65 Ga0123356_10711950 3300010049 Bacteria 1173
66 Ga0123353_10184804 3300010167 Unclassified 3297
67 JGI24698J34947_10013768 3300002449 Bacteria 4406
68 JGI24698J34947_10024876 3300002449 Bacteria 3192
69 JGI24698J34947_10052177 3300002449 Bacteria 2053
70 JGI24698J34947_10154415 3300002449 Unclassified 948
71 Ga0072941_1011847 3300005201 Bacteria 41565
72 Ga0072941_1024065 3300005201 Unclassified 3381
73 Ga0072941_1192249 3300005201 Archaea 7840
74 Ga0466712_171947 3300042614 Bacteria 1220
75 Ga0466718_024708 3300042617 Bacteria 1474
76 Ga0466731_234789 3300042622 Bacteria 1534
77 Ga0466731_355891 3300042622 Bacteria 4828
78 JGI24698J34947_10055684 3300002449 Bacteria 1969
79 JGI24698J34947_10082653 3300002449 Unclassified 1501
80 Ga0072941_1024067 3300005201 Bacteria 2833
81 Ga0072941_1024068 3300005201 Bacteria 1992
82 Ga0072941_1293103 3300005201 Bacteria 1873
83 Ga0466712_056730 3300042614 Unclassified 3510
84 Ga0466712_084042 3300042614 Bacteria 1920
85 Ga0466712_113057 3300042614 Bacteria 2326
86 Ga0466720_045377 3300042607 Bacteria 41381
87 Ga0466697_003069 3300042611 Bacteria 1500
88 Ga0415639_016609 3300038395 Bacteria 8642
89 Ga0466693_364438 3300042592 Bacteria 1016
90 Ga0466694_042514 3300042594 Bacteria 25116
91 Ga0123353_10041131 3300010167 Bacteria 7298
92 Ga0123353_10679409 3300010167 Bacteria 1450
93 JGI24698J34947_10078501 3300002449 Bacteria 1557
94 JGI24698J34947_10169048 3300002449 Unclassified 887
95 JGI24695J34938_10022394 3300002450 Bacteria 3068
96 Ga0072941_1017058 3300005201 Bacteria 18391
97 Ga0072941_1029825 3300005201 Bacteria 5051
98 Ga0072941_1065148 3300005201 Bacteria 3264
99 Ga0466712_035773 3300042614 Bacteria 1032
100 Ga0466720_019008 3300042607 Bacteria 18978
101 Ga0466698_344710 3300042610 Bacteria 2415
102 Ga0415639_174852 3300038395 Bacteria 1216
103 Ga0466699_143611 3300042597 Bacteria 11418
104 Ga0466699_238936 3300042597 Bacteria 1905
105 Ga0466699_296485 3300042597 Bacteria 3447
106 Ga0123356_10083522 3300010049 Bacteria 3026
107 Ga0466731_243320 3300042622 Bacteria 4506

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042614 Ga0466712_005865 Ga0466712_005865_13033_13686 188
2 3300002450 JGI24695J34938_10044835 JGI24695J34938_100448352 190
3 3300010049 Ga0123356_10000073 Ga0123356_1000007320 191
4 iso_pr_bacteria 2781125636 2781280972 194
5 3300010049 Ga0123356_10010149 Ga0123356_100101497 203
6 3300010167 Ga0123353_10679409 Ga0123353_106794092 204
7 3300042610 Ga0466698_344710 Ga0466698_344710_443_1099 204
8 3300010167 Ga0123353_10241233 Ga0123353_102412333 206
9 3300042597 Ga0466699_076449 Ga0466699_076449_6163_6789 208
10 3300042622 Ga0466731_234789 Ga0466731_234789_85_756 209
11 3300042597 Ga0466699_065829 Ga0466699_065829_6160_6792 210
12 3300010167 Ga0123353_10083082 Ga0123353_100830824 211
13 3300042597 Ga0466699_243244 Ga0466699_243244_259_897 212
14 3300042597 Ga0466699_046007 Ga0466699_046007_678_1319 213
15 3300042597 Ga0466699_143611 Ga0466699_143611_8314_8955 213
16 3300042597 Ga0466699_296485 Ga0466699_296485_628_1269 213
17 3300042622 Ga0466731_405126 Ga0466731_405126_212_910 213
18 3300010167 Ga0123353_10184804 Ga0123353_101848043 215
19 3300042597 Ga0466699_238936 Ga0466699_238936_814_1461 215
20 3300010049 Ga0123356_10083522 Ga0123356_100835224 216
21 3300042597 Ga0466699_172400 Ga0466699_172400_355_1005 216
22 3300042614 Ga0466712_113057 Ga0466712_113057_511_1161 216
23 2030936001 Nasutiter_Contig26122 Nasutiterm_1916320 217
24 3300002450 JGI24695J34938_10000482 JGI24695J34938_1000048218 217
25 3300002450 JGI24695J34938_10022311 JGI24695J34938_100223113 217
26 3300024493 Ga0264413_146509 Ga0264413_1465093 217
27 3300038395 Ga0415639_016609 Ga0415639_016609_7662_8315 217
28 3300042592 Ga0466693_364438 Ga0466693_364438_202_855 217
29 3300042594 Ga0466694_213195 Ga0466694_213195_30_683 217
30 3300042594 Ga0466694_308894 Ga0466694_308894_278_931 217
31 3300042594 Ga0466694_391389 Ga0466694_391389_604_1257 217
32 3300042597 Ga0466699_211444 Ga0466699_211444_627_1280 217
33 3300042607 Ga0466720_019008 Ga0466720_019008_8775_9428 217
34 3300042607 Ga0466720_045377 Ga0466720_045377_39879_40532 217
35 3300042608 Ga0466721_309567 Ga0466721_309567_5876_6529 217
36 3300042610 Ga0466698_241290 Ga0466698_241290_213_866 217
37 3300042611 Ga0466697_003069 Ga0466697_003069_814_1467 217
38 3300042614 Ga0466712_036891 Ga0466712_036891_260_913 217
39 3300042617 Ga0466718_011860 Ga0466718_011860_184_837 217
40 3300042617 Ga0466718_024708 Ga0466718_024708_362_1015 217
41 3300042617 Ga0466718_144135 Ga0466718_144135_806_1459 217
42 3300042622 Ga0466731_243320 Ga0466731_243320_2978_3631 217
43 3300042622 Ga0466731_355891 Ga0466731_355891_2331_2984 217
44 3300042656 Ga0466732_383957 Ga0466732_383957_577_1230 217
45 iso_pr_bacteria 2781125646 2781302361 217
46 iso_pr_bacteria 2781125660 2781330638 217
47 iso_pr_bacteria 2781125661 2781333514 217
48 iso_pr_bacteria 2781125664 2781339673 217
49 iso_pr_bacteria 2820267566 2820268327 217
50 3300002449 JGI24698J34947_10013768 JGI24698J34947_100137684 218
51 3300002449 JGI24698J34947_10024876 JGI24698J34947_100248761 218
52 3300002449 JGI24698J34947_10029700 JGI24698J34947_100297003 218
53 3300002449 JGI24698J34947_10053115 JGI24698J34947_100531153 218
54 3300002449 JGI24698J34947_10055684 JGI24698J34947_100556842 218
55 3300002449 JGI24698J34947_10065353 JGI24698J34947_100653531 218
56 3300002449 JGI24698J34947_10066342 JGI24698J34947_100663422 218
57 3300002449 JGI24698J34947_10073512 JGI24698J34947_100735121 218
58 3300002449 JGI24698J34947_10078501 JGI24698J34947_100785012 218
59 3300002449 JGI24698J34947_10082653 JGI24698J34947_100826532 218
60 3300002449 JGI24698J34947_10154415 JGI24698J34947_101544151 218
61 3300002449 JGI24698J34947_10169048 JGI24698J34947_101690481 218
62 3300002450 JGI24695J34938_10022394 JGI24695J34938_100223941 218
63 3300002450 JGI24695J34938_10022538 JGI24695J34938_100225382 218
64 3300005201 Ga0072941_1015277 Ga0072941_10152772 218
65 3300005201 Ga0072941_1017058 Ga0072941_101705819 218
66 3300005201 Ga0072941_1033305 Ga0072941_10333054 218
67 3300005201 Ga0072941_1065148 Ga0072941_10651482 218
68 3300005201 Ga0072941_1226138 Ga0072941_12261382 218
69 3300005201 Ga0072941_1293103 Ga0072941_12931032 218
70 3300010049 Ga0123356_10001385 Ga0123356_100013853 218
71 3300010049 Ga0123356_10004244 Ga0123356_100042443 218
72 3300010049 Ga0123356_10071794 Ga0123356_100717943 218
73 3300010167 Ga0123353_10041131 Ga0123353_100411312 218
74 3300042617 Ga0466718_061796 Ga0466718_061796_91_783 218
75 3300005201 Ga0072941_1000318 Ga0072941_10003183 219
76 3300024493 Ga0264413_107518 Ga0264413_10751810 219
77 3300042614 Ga0466712_035773 Ga0466712_035773_193_852 219
78 3300042614 Ga0466712_045657 Ga0466712_045657_519_1178 219
79 3300042614 Ga0466712_052210 Ga0466712_052210_31_690 219
80 3300042614 Ga0466712_084042 Ga0466712_084042_1231_1890 219
81 3300042614 Ga0466712_115774 Ga0466712_115774_356_1015 219
82 3300042614 Ga0466712_128075 Ga0466712_128075_2023_2682 219
83 3300042614 Ga0466712_171947 Ga0466712_171947_514_1173 219
84 3300002449 JGI24698J34947_10018280 JGI24698J34947_100182802 220
85 3300002449 JGI24698J34947_10024235 JGI24698J34947_100242352 220
86 3300002449 JGI24698J34947_10052177 JGI24698J34947_100521772 220
87 3300002449 JGI24698J34947_10080561 JGI24698J34947_100805612 220
88 3300002449 JGI24698J34947_10106199 JGI24698J34947_101061991 220
89 3300005201 Ga0072941_1011847 Ga0072941_101184742 220
90 3300005201 Ga0072941_1046618 Ga0072941_10466182 220
91 3300005201 Ga0072941_1059041 Ga0072941_10590412 220
92 3300005201 Ga0072941_1024067 Ga0072941_10240673 221
93 3300042604 Ga0466717_083268 Ga0466717_083268_681_1346 221
94 3300042614 Ga0466712_056730 Ga0466712_056730_2502_3167 221
95 3300002449 JGI24698J34947_10060908 JGI24698J34947_100609081 222
96 3300005201 Ga0072941_1111772 Ga0072941_11117721 222
97 3300002450 JGI24695J34938_10004973 JGI24695J34938_100049733 223
98 3300005201 Ga0072941_1029825 Ga0072941_10298253 223
99 3300000089 AustNasuHG_c1000066 AustNasuHG_100006610 224
100 3300005201 Ga0072941_1024065 Ga0072941_10240652 224
101 3300005201 Ga0072941_1024068 Ga0072941_10240682 224
102 3300009784 Ga0123357_10209582 Ga0123357_102095822 224
103 3300042594 Ga0466694_042514 Ga0466694_042514_10219_10893 224
104 3300005200 Ga0072940_1030110 Ga0072940_10301104 225
105 3300042617 Ga0466718_007609 Ga0466718_007609_31_708 225
106 3300042617 Ga0466718_109220 Ga0466718_109220_8439_9116 225
107 3300010049 Ga0123356_10003305 Ga0123356_1000330512 226
108 3300010049 Ga0123356_10711950 Ga0123356_107119502 226
109 3300042592 Ga0466693_284844 Ga0466693_284844_25895_26578 227
110 iso_pr_bacteria 2781125647 2781303197 227
111 3300038395 Ga0415639_174852 Ga0415639_174852_189_878 229
112 3300010167 Ga0123353_10089624 Ga0123353_100896244 233
113 3300005201 Ga0072941_1024066 Ga0072941_10240662 234
114 3300005201 Ga0072941_1192249 Ga0072941_11922491 239

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
2zk7-assembly1.cif.gz_A-2 Structure of a C-terminal deletion mutant of Thermoplasma acidophilum aldohexose dehydrogenase (AldT) 0.828 16 184
3tox-assembly3.cif.gz_F Crystal structure of a short chain dehydrogenase in complex with NAD(P) from Sinorhizobium meliloti 1021 0.814 16 199
5wul-assembly1.cif.gz_A Serratia marcescens short-chain dehydrogenase/reductase F98A/F202L 0.809 16 183
5tf4-assembly2.cif.gz_F Crystal structure of enoyl-(acyl carrier protein) reductase from Bartonella henselae in complext with NAD 0.809 16 202
6ahe-assembly1.cif.gz_B Crystal structure of enoyl-ACP reductase from Acinetobacter baumannii in complex with NAD and AFN-1252 0.808 16 199
IDDescriptionScoreStartEndSuperfamily
4qedB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8279 14 183 3.40.50.720
af_Q2FVE2_1_206_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.819 62 183 3.40.50.720
af_Q54G79_5_301_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8158 16 183 3.40.50.720
af_K7KGR3_30_220_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.814 62 183 3.40.50.720
af_B5BM30_1_361_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8129 15 45 3.50.50.60
IDDescriptionScoreStartEndGO Terms
AF-A0A806JXW7-F1-model_v4 Short-chain dehydrogenase 0.9577 15 233
AF-A0A1C6GB81-F1-model_v4 Uncharacterized/unreviewed 0.9292 17 233
AF-A0A3E0JJF7-F1-model_v4 Uncharacterized/unreviewed 0.8979 14 184
AF-A0A146GEX8-F1-model_v4 Uncharacterized/unreviewed 0.8782 16 233 GO:0005737
GO:0016491

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.89 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.