Protein Family IF01299

Metagenome Isolate
211 Members
55 Samples
203 Scaffolds
321.16 Avg Length

🧬 Representative Sequence

ID
3300005201|Ga0072941_1019852|Ga0072941_10198527
Length
363 aa
Sequence
MRILFAGTPAIAVPSLEAIAAMSGGGDDFVLAGLLTKADSPKGRSGKPEPTECAVAAASSIPQLKPEKLDSAAREQAAALNADLLVSFAYGKIFGPKFLALFPLGGINIHPSLLPKYRGPTPISAAILNREAVTGITIQRLAAEMDSGDILVQETVPLNGRETTANLSETMAKKAAEILPAALRGIAGGTLTAKPQDHNAATYCSLIEKEDGLIDWNQSAAKIDAQIRAFDPWPLSWTTHGELQLFVLKAQALEGEYAAEPPVHLAGRSPAGLAKASPPFLLQRPLSGLSPCGLSQETQLNAVHLAGRVLGKDKDMGILIQTGDGILAVSELQYRTKKALEWKAFLNGARNFLGATLGNVAR*

📊 Sample Types

Isolate 3.8%
Metagenome 96.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 41.5%
Kalotermitidae 26.4%
Unclassified 18.9%
Termopsidae 5.7%
Rhinotermitidae 5.7%
Hodotermitidae 1.9%

🌳 Taxonomy

Archaea 0
Bacteria 204
Eukaryota 0
Viruses 0
Unclassified 7

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125695 Treponema sp. Th196P4bin30 Isolate Unclassified
2 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
3 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
4 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
5 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
6 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
7 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
8 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
9 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
10 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
11 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
12 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
13 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
14 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
15 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
16 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
17 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
18 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
19 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
20 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
21 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
22 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
23 2781125639 Treponema sp. Co191P1bin44 Isolate Unclassified
24 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
25 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
26 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
27 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
28 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
29 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
30 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
31 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
32 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
33 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
34 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
35 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
36 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
37 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
38 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
39 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
40 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
41 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
42 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
43 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
44 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
45 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
46 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
47 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
48 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
49 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
50 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
51 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
52 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
53 2781125689 Treponema sp. Mp193P4bin9 Isolate Unclassified
54 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
55 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_197675 3300042612 Bacteria 7780
2 Ga0123356_10034163 3300010049 Bacteria 4755
3 Ga0466712_070916 3300042614 Bacteria 20641
4 Ga0466712_217249 3300042614 Bacteria 27211
5 Ga0466735_158757 3300042624 Bacteria 1239
6 Ga0466704_567552 3300042643 Bacteria 13451
7 Ga0466708_081175 3300042652 Bacteria 2829
8 Ga0466727_093702 3300042655 Bacteria 11657
9 Ga0264413_109565 3300024493 Bacteria 11496
10 Ga0466690_324624 3300042590 Unclassified 4188
11 Ga0466693_358736 3300042592 Bacteria 5006
12 Ga0466691_003008 3300042593 Bacteria 4901
13 Ga0466696_089145 3300042596 Bacteria 4233
14 Ga0466696_093358 3300042596 Unclassified 7748
15 Ga0466699_147966 3300042597 Bacteria 13012
16 JGI24695J34938_10005041 3300002450 Bacteria 8402
17 Ga0072941_1030573 3300005201 Bacteria 4787
18 Ga0072941_1048488 3300005201 Bacteria 4532
19 Ga0072941_1079422 3300005201 Bacteria 5372
20 Ga0466719_297251 3300042606 Bacteria 8240
21 Ga0466720_023379 3300042607 Bacteria 5297
22 Ga0466720_103351 3300042607 Bacteria 1790
23 Ga0466720_108612 3300042607 Bacteria 122313
24 Ga0466720_128924 3300042607 Bacteria 3528
25 Ga0466720_141100 3300042607 Bacteria 3000
26 Ga0466720_206455 3300042607 Bacteria 6773
27 Ga0466722_138823 3300042609 Bacteria 2651
28 Ga0466722_175562 3300042609 Unclassified 6330
29 Ga0466733_063690 3300042659 Bacteria 1636
30 Ga0123355_10371531 3300009826 Bacteria 1873
31 Ga0123356_10050509 3300010049 Bacteria 3869
32 Ga0123356_10621285 3300010049 Bacteria 1246
33 Ga0466712_012767 3300042614 Bacteria 18385
34 Ga0466712_060583 3300042614 Bacteria 12544
35 Ga0466712_128666 3300042614 Bacteria 4277
36 Ga0466712_180234 3300042614 Bacteria 4497
37 Ga0466715_104842 3300042616 Bacteria 2505
38 Ga0466718_085804 3300042617 Bacteria 11821
39 Ga0466727_212472 3300042655 Bacteria 3113
40 Ga0466692_142303 3300042591 Bacteria 11124
41 Ga0466699_020661 3300042597 Bacteria 15510
42 Ga0466699_284827 3300042597 Bacteria 14833
43 AustNasuHG_c1000614 3300000089 Bacteria 12593
44 AustNasuHG_c1002956 3300000089 Bacteria 6122
45 JGI24698J34947_10016205 3300002449 Bacteria 4047
46 JGI24698J34947_10016623 3300002449 Bacteria 3992
47 JGI24698J34947_10021900 3300002449 Bacteria 3431
48 JGI24697J35500_11204314 3300002507 Unclassified 1702
49 Ga0072941_1048487 3300005201 Bacteria 6876
50 Ga0466716_088168 3300042605 Bacteria 5700
51 Ga0466722_237965 3300042609 Bacteria 34947
52 Ga0123356_10155161 3300010049 Bacteria 2279
53 Ga0466712_042651 3300042614 Bacteria 9830
54 Ga0466712_225880 3300042614 Bacteria 7293
55 Ga0466712_256060 3300042614 Bacteria 1462
56 Ga0466692_012116 3300042591 Bacteria 1653
57 Ga0466699_094667 3300042597 Bacteria 5557
58 Ga0466699_140170 3300042597 Bacteria 7515
59 Ga0466699_155356 3300042597 Bacteria 11502
60 Ga0466699_181525 3300042597 Bacteria 1114
61 Ga0466699_209802 3300042597 Bacteria 4825
62 Ga0466699_229331 3300042597 Bacteria 37974
63 JGI24698J34947_10002718 3300002449 Bacteria 9552
64 JGI24698J34947_10028573 3300002449 Bacteria 2952
65 JGI24695J34938_10020578 3300002450 Bacteria 3244
66 JGI24702J35022_10004971 3300002462 Bacteria 7845
67 Ga0072940_1068683 3300005200 Bacteria 2018
68 Ga0072941_1083713 3300005201 Bacteria 1957
69 Ga0466707_018467 3300042601 Bacteria 4537
70 Ga0466713_067680 3300042602 Bacteria 7133
71 Ga0466720_086184 3300042607 Bacteria 5835
72 Ga0466698_311902 3300042610 Bacteria 3609
73 Ga0466698_358157 3300042610 Bacteria 4816
74 Ga0466732_298068 3300042656 Bacteria 8109
75 Ga0123356_10004273 3300010049 Bacteria 14779
76 Ga0466705_418742 3300042612 Bacteria 34230
77 Ga0466712_113995 3300042614 Bacteria 6907
78 Ga0466712_234863 3300042614 Bacteria 1451
79 Ga0466718_156520 3300042617 Bacteria 1622
80 Ga0466723_141806 3300042618 Bacteria 3289
81 Ga0466728_107249 3300042620 Bacteria 2091
82 Ga0466728_239247 3300042620 Bacteria 8122
83 Ga0466728_368264 3300042620 Bacteria 9341
84 Ga0466703_329215 3300042636 Bacteria 2809
85 Ga0466704_211114 3300042643 Bacteria 5331
86 Ga0466704_231113 3300042643 Bacteria 17132
87 Ga0466727_193932 3300042655 Bacteria 3837
88 Ga0466690_078176 3300042590 Bacteria 6264
89 Ga0466691_028435 3300042593 Bacteria 5089
90 Ga0466694_136825 3300042594 Bacteria 22203
91 Ga0466699_070155 3300042597 Bacteria 13589
92 AustNasuHG_c1000242 3300000089 Bacteria 18428
93 JGI24695J34938_10000383 3300002450 Bacteria 43842
94 Ga0072940_1012366 3300005200 Bacteria 8133
95 Ga0072940_1033516 3300005200 Bacteria 1977
96 Ga0072941_1000579 3300005201 Bacteria 109731
97 Ga0466720_068780 3300042607 Bacteria 1978
98 Ga0466720_115436 3300042607 Bacteria 52557
99 Ga0466722_160542 3300042609 Bacteria 4586
100 Ga0466722_220375 3300042609 Bacteria 6018
101 Ga0466732_095546 3300042656 Bacteria 7691
102 Ga0466732_364090 3300042656 Bacteria 10738
103 Ga0466733_166717 3300042659 Bacteria 87248
104 Ga0466712_045972 3300042614 Bacteria 9356
105 Ga0466712_281667 3300042614 Bacteria 12480
106 Ga0466723_012189 3300042618 Bacteria 1890
107 Ga0466729_250653 3300042621 Bacteria 2486
108 Ga0466703_040188 3300042636 Bacteria 4838
109 Ga0466727_177217 3300042655 Bacteria 2782
110 Ga0466693_032207 3300042592 Bacteria 13948
111 Ga0466691_219991 3300042593 Bacteria 33482
112 Ga0466696_124653 3300042596 Bacteria 2961
113 Ga0466699_116808 3300042597 Bacteria 1420
114 Ga0466699_210403 3300042597 Bacteria 9117
115 JGI24698J34947_10029901 3300002449 Bacteria 2875
116 JGI24695J34938_10001871 3300002450 Bacteria 17095
117 JGI24695J34938_10006888 3300002450 Bacteria 6747
118 JGI24695J34938_10053167 3300002450 Bacteria 1763
119 JGI24699J35502_11133970 3300002509 Bacteria 21986
120 Ga0072941_1001475 3300005201 Bacteria 8505
121 Ga0072941_1105249 3300005201 Bacteria 5897
122 Ga0466720_068846 3300042607 Bacteria 13130
123 Ga0466721_318314 3300042608 Bacteria 1436
124 Ga0466705_260067 3300042612 Bacteria 32862
125 Ga0123353_10022188 3300010167 Bacteria 9560
126 Ga0466712_100129 3300042614 Bacteria 8525
127 Ga0466715_096475 3300042616 Bacteria 3586
128 Ga0466723_240794 3300042618 Bacteria 12618
129 Ga0466726_104416 3300042619 Bacteria 15969
130 Ga0466703_097237 3300042636 Bacteria 9615
131 Ga0466704_617044 3300042643 Bacteria 5088
132 Ga0466709_318034 3300042648 Bacteria 4651
133 Ga0466708_078211 3300042652 Bacteria 46711
134 Ga0264413_113668 3300024493 Bacteria 13305
135 Ga0466690_191541 3300042590 Bacteria 2266
136 Ga0466692_148132 3300042591 Bacteria 2038
137 Ga0466694_323807 3300042594 Bacteria 1060
138 Ga0466699_002165 3300042597 Bacteria 10790
139 Ga0466699_022748 3300042597 Bacteria 1672
140 Ga0466699_238074 3300042597 Bacteria 1454
141 Ga0466699_420987 3300042597 Bacteria 4811
142 Ga0466699_431883 3300042597 Bacteria 26603
143 JGI24698J34947_10000261 3300002449 Bacteria 22457
144 JGI24698J34947_10002531 3300002449 Bacteria 9862
145 JGI24698J34947_10004071 3300002449 Bacteria 7936
146 JGI24698J34947_10012323 3300002449 Bacteria 4686
147 JGI24695J34938_10001419 3300002450 Bacteria 20419
148 JGI24695J34938_10007749 3300002450 Bacteria 6225
149 Ga0072941_1048517 3300005201 Bacteria 4007
150 Ga0072941_1083123 3300005201 Unclassified 2962
151 Ga0072941_1108741 3300005201 Bacteria 7311
152 Ga0466706_032766 3300042599 Bacteria 2414
153 Ga0466716_030075 3300042605 Bacteria 11493
154 Ga0466716_105877 3300042605 Bacteria 2475
155 Ga0466720_005056 3300042607 Bacteria 1491
156 Ga0466720_084207 3300042607 Bacteria 2974
157 Ga0466720_198047 3300042607 Bacteria 7116
158 Ga0466720_216265 3300042607 Bacteria 17840
159 Ga0466698_181172 3300042610 Bacteria 1776
160 Ga0466705_184053 3300042612 Bacteria 5505
161 Ga0466705_319125 3300042612 Bacteria 7939
162 Ga0123356_10000067 3300010049 Bacteria 109410
163 Ga0466712_049384 3300042614 Bacteria 5141
164 Ga0466712_081403 3300042614 Bacteria 5468
165 Ga0466718_062769 3300042617 Bacteria 1631
166 Ga0466723_017440 3300042618 Bacteria 24222
167 Ga0466723_160902 3300042618 Bacteria 23441
168 Ga0466728_300370 3300042620 Bacteria 4884
169 Ga0466731_089596 3300042622 Bacteria 24532
170 Ga0466704_333824 3300042643 Bacteria 21099
171 Ga0466708_061097 3300042652 Bacteria 11960
172 Ga0466692_002401 3300042591 Unclassified 15501
173 Ga0466699_005595 3300042597 Bacteria 2369
174 JGI24698J34947_10008212 3300002449 Bacteria 5727
175 JGI24698J34947_10030718 3300002449 Bacteria 2832
176 Ga0072941_1000021 3300005201 Bacteria 7451
177 Ga0072941_1019852 3300005201 Unclassified 7795
178 Ga0072941_1063571 3300005201 Bacteria 1836
179 Ga0466705_369622 3300042612 Bacteria 26304
180 Ga0466733_151161 3300042659 Bacteria 29907
181 Ga0466712_086549 3300042614 Bacteria 18204
182 Ga0466711_295708 3300042615 Bacteria 6099
183 Ga0466718_095604 3300042617 Bacteria 3092
184 Ga0466723_138127 3300042618 Bacteria 8692
185 Ga0466728_077068 3300042620 Bacteria 3878
186 Ga0466735_188884 3300042624 Bacteria 1915
187 Ga0466703_229115 3300042636 Bacteria 17432
188 Ga0466704_034420 3300042643 Bacteria 35079
189 Ga0466704_286043 3300042643 Bacteria 20073
190 Ga0466704_318287 3300042643 Bacteria 3267
191 Ga0466690_273117 3300042590 Bacteria 14878
192 Ga0466696_481146 3300042596 Bacteria 1413
193 Ga0466699_048393 3300042597 Bacteria 18418
194 Ga0466699_440887 3300042597 Bacteria 6318
195 JGI24698J34947_10003440 3300002449 Bacteria 8585
196 JGI24698J34947_10028438 3300002449 Bacteria 2959
197 Ga0072941_1014457 3300005201 Bacteria 5515
198 Ga0072941_1089550 3300005201 Bacteria 5021
199 Ga0466700_138502 3300042600 Bacteria 1044
200 Ga0466700_222536 3300042600 Bacteria 2493
201 Ga0466719_162511 3300042606 Bacteria 6458
202 Ga0466720_048852 3300042607 Bacteria 2876
203 Ga0466720_165671 3300042607 Bacteria 1086

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 iso_pr_bacteria 2781125639 2781286308 262
2 3300042596 Ga0466696_481146 Ga0466696_481146_289_1137 282
3 3300042612 Ga0466705_369622 Ga0466705_369622_2003_2860 285
4 3300042614 Ga0466712_113995 Ga0466712_113995_1127_2026 287
5 3300042607 Ga0466720_048852 Ga0466720_048852_751_1749 288
6 3300042615 Ga0466711_295708 Ga0466711_295708_4107_5096 293
7 3300042614 Ga0466712_049384 Ga0466712_049384_2204_3091 295
8 3300002449 JGI24698J34947_10002531 JGI24698J34947_100025313 296
9 3300042607 Ga0466720_084207 Ga0466720_084207_698_1687 296
10 3300042624 Ga0466735_188884 Ga0466735_188884_359_1342 301
11 3300042656 Ga0466732_298068 Ga0466732_298068_2499_3404 301
12 3300042610 Ga0466698_181172 Ga0466698_181172_704_1615 303
13 3300042591 Ga0466692_142303 Ga0466692_142303_8491_9477 304
14 3300042614 Ga0466712_060583 Ga0466712_060583_8641_9555 304
15 3300042614 Ga0466712_281667 Ga0466712_281667_9547_10461 304
16 3300042616 Ga0466715_104842 Ga0466715_104842_117_1031 304
17 3300042643 Ga0466704_286043 Ga0466704_286043_4594_5532 304
18 3300002450 JGI24695J34938_10005041 JGI24695J34938_100050415 305
19 3300042600 Ga0466700_138502 Ga0466700_138502_10_993 305
20 3300042605 Ga0466716_088168 Ga0466716_088168_3830_4771 308
21 3300042622 Ga0466731_089596 Ga0466731_089596_7442_8368 308
22 3300042607 Ga0466720_141100 Ga0466720_141100_767_1696 309
23 3300042607 Ga0466720_206455 Ga0466720_206455_1171_2139 309
24 3300042655 Ga0466727_093702 Ga0466727_093702_7089_8102 309
25 3300002507 JGI24697J35500_11204314 JGI24697J35500_112043141 310
26 3300042607 Ga0466720_103351 Ga0466720_103351_60_992 310
27 3300002450 JGI24695J34938_10001871 JGI24695J34938_1000187110 311
28 3300042607 Ga0466720_086184 Ga0466720_086184_76_1062 311
29 3300042624 Ga0466735_158757 Ga0466735_158757_162_1097 311
30 3300042605 Ga0466716_030075 Ga0466716_030075_2914_3855 313
31 3300042607 Ga0466720_023379 Ga0466720_023379_2545_3555 313
32 3300042607 Ga0466720_198047 Ga0466720_198047_2147_3088 313
33 3300042620 Ga0466728_107249 Ga0466728_107249_558_1523 313
34 3300042620 Ga0466728_368264 Ga0466728_368264_6097_7038 313
35 3300042636 Ga0466703_229115 Ga0466703_229115_3309_4250 313
36 3300002449 JGI24698J34947_10028438 JGI24698J34947_100284383 314
37 3300010049 Ga0123356_10034163 Ga0123356_100341635 314
38 3300010049 Ga0123356_10621285 Ga0123356_106212851 314
39 3300042594 Ga0466694_136825 Ga0466694_136825_9150_10094 314
40 3300042597 Ga0466699_094667 Ga0466699_094667_871_1815 314
41 3300042601 Ga0466707_018467 Ga0466707_018467_1268_2251 314
42 3300042607 Ga0466720_128924 Ga0466720_128924_108_1052 314
43 3300042612 Ga0466705_418742 Ga0466705_418742_30622_31566 314
44 3300042643 Ga0466704_567552 Ga0466704_567552_7973_8917 314
45 iso_pr_bacteria 2781125638 2781284392 314
46 3300002450 JGI24695J34938_10000383 JGI24695J34938_1000038318 315
47 3300042608 Ga0466721_318314 Ga0466721_318314_141_1088 315
48 3300042612 Ga0466705_197675 Ga0466705_197675_893_1882 315
49 3300042612 Ga0466705_260067 Ga0466705_260067_27921_28868 315
50 3300042614 Ga0466712_256060 Ga0466712_256060_45_992 315
51 3300042618 Ga0466723_141806 Ga0466723_141806_311_1282 315
52 3300042643 Ga0466704_333824 Ga0466704_333824_1553_2542 315
53 iso_pr_bacteria 2781125637 2781281679 315
54 iso_pr_bacteria 2781125649 2781306415 315
55 3300002450 JGI24695J34938_10001419 JGI24695J34938_100014198 316
56 3300002450 JGI24695J34938_10006888 JGI24695J34938_100068884 316
57 3300010049 Ga0123356_10050509 Ga0123356_100505093 316
58 3300042597 Ga0466699_020661 Ga0466699_020661_4376_5326 316
59 3300042614 Ga0466712_045972 Ga0466712_045972_7666_8616 316
60 iso_pr_bacteria 2781125660 2781330508 316
61 3300002449 JGI24698J34947_10028573 JGI24698J34947_100285733 317
62 3300002449 JGI24698J34947_10030718 JGI24698J34947_100307183 317
63 3300002450 JGI24695J34938_10007749 JGI24695J34938_100077496 317
64 3300005201 Ga0072941_1000021 Ga0072941_10000218 317
65 3300042590 Ga0466690_324624 Ga0466690_324624_2030_2983 317
66 3300042596 Ga0466696_093358 Ga0466696_093358_572_1525 317
67 3300042602 Ga0466713_067680 Ga0466713_067680_4187_5140 317
68 3300042614 Ga0466712_081403 Ga0466712_081403_3326_4279 317
69 3300042618 Ga0466723_017440 Ga0466723_017440_13521_14516 317
70 3300042619 Ga0466726_104416 Ga0466726_104416_13466_14419 317
71 3300042655 Ga0466727_193932 Ga0466727_193932_2044_2997 317
72 iso_pr_bacteria 2781125695 2781438200 317
73 3300002449 JGI24698J34947_10021900 JGI24698J34947_100219004 318
74 3300002462 JGI24702J35022_10004971 JGI24702J35022_1000497110 318
75 3300005201 Ga0072941_1000579 Ga0072941_100057966 318
76 3300005201 Ga0072941_1001475 Ga0072941_10014753 318
77 3300005201 Ga0072941_1108741 Ga0072941_11087413 318
78 3300042609 Ga0466722_220375 Ga0466722_220375_1933_2889 318
79 3300042609 Ga0466722_237965 Ga0466722_237965_33039_34100 318
80 3300042643 Ga0466704_034420 Ga0466704_034420_29319_30275 318
81 3300005201 Ga0072941_1079422 Ga0072941_10794228 319
82 3300024493 Ga0264413_109565 Ga0264413_1095655 319
83 3300042593 Ga0466691_219991 Ga0466691_219991_1734_2693 319
84 3300042597 Ga0466699_022748 Ga0466699_022748_508_1467 319
85 3300042597 Ga0466699_140170 Ga0466699_140170_3550_4509 319
86 3300042597 Ga0466699_209802 Ga0466699_209802_872_1831 319
87 3300042599 Ga0466706_032766 Ga0466706_032766_665_1624 319
88 3300042614 Ga0466712_128666 Ga0466712_128666_2915_3874 319
89 3300042614 Ga0466712_225880 Ga0466712_225880_2628_3587 319
90 3300042618 Ga0466723_240794 Ga0466723_240794_8708_9667 319
91 3300002449 JGI24698J34947_10012323 JGI24698J34947_100123233 320
92 3300005201 Ga0072941_1083713 Ga0072941_10837132 320
93 3300010167 Ga0123353_10022188 Ga0123353_100221882 320
94 3300042593 Ga0466691_028435 Ga0466691_028435_2652_3614 320
95 3300042597 Ga0466699_147966 Ga0466699_147966_407_1369 320
96 3300042597 Ga0466699_229331 Ga0466699_229331_34375_35337 320
97 3300042607 Ga0466720_068846 Ga0466720_068846_1890_2852 320
98 3300042609 Ga0466722_138823 Ga0466722_138823_1268_2230 320
99 3300042609 Ga0466722_175562 Ga0466722_175562_4018_4980 320
100 3300042614 Ga0466712_086549 Ga0466712_086549_11725_12687 320
101 3300042617 Ga0466718_062769 Ga0466718_062769_155_1117 320
102 3300000089 AustNasuHG_c1000614 AustNasuHG_10006145 321
103 3300000089 AustNasuHG_c1002956 AustNasuHG_10029565 321
104 3300005200 Ga0072940_1068683 Ga0072940_10686833 321
105 3300042591 Ga0466692_148132 Ga0466692_148132_1033_1998 321
106 3300042592 Ga0466693_358736 Ga0466693_358736_1367_2332 321
107 3300042597 Ga0466699_440887 Ga0466699_440887_3717_4682 321
108 3300042614 Ga0466712_012767 Ga0466712_012767_9624_10589 321
109 3300042618 Ga0466723_138127 Ga0466723_138127_2889_3854 321
110 3300002449 JGI24698J34947_10000261 JGI24698J34947_1000026114 322
111 3300005201 Ga0072941_1048517 Ga0072941_10485174 322
112 3300009826 Ga0123355_10371531 Ga0123355_103715312 322
113 3300010049 Ga0123356_10004273 Ga0123356_100042735 322
114 3300042590 Ga0466690_191541 Ga0466690_191541_374_1342 322
115 3300042593 Ga0466691_003008 Ga0466691_003008_1171_2139 322
116 3300042597 Ga0466699_070155 Ga0466699_070155_6708_7676 322
117 3300042597 Ga0466699_155356 Ga0466699_155356_2571_3539 322
118 3300042597 Ga0466699_210403 Ga0466699_210403_4278_5246 322
119 3300042617 Ga0466718_156520 Ga0466718_156520_235_1203 322
120 3300042620 Ga0466728_077068 Ga0466728_077068_1468_2436 322
121 3300042656 Ga0466732_364090 Ga0466732_364090_8835_9803 322
122 3300000089 AustNasuHG_c1000242 AustNasuHG_100024210 323
123 3300005201 Ga0072941_1048487 Ga0072941_10484875 323
124 3300005201 Ga0072941_1048488 Ga0072941_10484882 323
125 3300042597 Ga0466699_431883 Ga0466699_431883_16986_17957 323
126 3300042607 Ga0466720_005056 Ga0466720_005056_454_1461 323
127 3300042607 Ga0466720_165671 Ga0466720_165671_29_1024 323
128 3300042609 Ga0466722_160542 Ga0466722_160542_3158_4129 323
129 3300042614 Ga0466712_042651 Ga0466712_042651_7205_8176 323
130 3300042614 Ga0466712_100129 Ga0466712_100129_245_1216 323
131 3300042618 Ga0466723_012189 Ga0466723_012189_793_1764 323
132 3300042636 Ga0466703_097237 Ga0466703_097237_3946_4917 323
133 3300042656 Ga0466732_095546 Ga0466732_095546_733_1704 323
134 3300002449 JGI24698J34947_10003440 JGI24698J34947_100034405 324
135 3300002449 JGI24698J34947_10004071 JGI24698J34947_100040713 324
136 3300042590 Ga0466690_078176 Ga0466690_078176_1135_2109 324
137 3300042597 Ga0466699_005595 Ga0466699_005595_216_1190 324
138 3300042597 Ga0466699_181525 Ga0466699_181525_100_1074 324
139 3300042597 Ga0466699_238074 Ga0466699_238074_385_1359 324
140 3300042614 Ga0466712_180234 Ga0466712_180234_1799_2773 324
141 3300042643 Ga0466704_318287 Ga0466704_318287_1997_2971 324
142 3300005201 Ga0072941_1083123 Ga0072941_10831234 325
143 3300042592 Ga0466693_032207 Ga0466693_032207_5748_6725 325
144 3300042607 Ga0466720_108612 Ga0466720_108612_64722_65699 325
145 3300042607 Ga0466720_115436 Ga0466720_115436_32560_33537 325
146 3300042620 Ga0466728_239247 Ga0466728_239247_2659_3636 325
147 3300042655 Ga0466727_212472 Ga0466727_212472_1483_2460 325
148 3300002449 JGI24698J34947_10008212 JGI24698J34947_100082124 326
149 3300024493 Ga0264413_113668 Ga0264413_1136689 326
150 3300042606 Ga0466719_162511 Ga0466719_162511_3162_4142 326
151 3300042617 Ga0466718_095604 Ga0466718_095604_424_1404 326
152 3300042655 Ga0466727_177217 Ga0466727_177217_574_1554 326
153 3300002449 JGI24698J34947_10029901 JGI24698J34947_100299014 327
154 3300002450 JGI24695J34938_10020578 JGI24695J34938_100205784 327
155 3300002450 JGI24695J34938_10053167 JGI24695J34938_100531673 327
156 3300042591 Ga0466692_002401 Ga0466692_002401_1217_2200 327
157 3300042597 Ga0466699_002165 Ga0466699_002165_9035_10018 327
158 3300042597 Ga0466699_048393 Ga0466699_048393_8805_9788 327
159 3300042614 Ga0466712_070916 Ga0466712_070916_9513_10496 327
160 3300002449 JGI24698J34947_10002718 JGI24698J34947_100027184 328
161 3300002449 JGI24698J34947_10016623 JGI24698J34947_100166232 328
162 3300005201 Ga0072941_1014457 Ga0072941_10144573 328
163 3300010049 Ga0123356_10000067 Ga0123356_1000006793 328
164 3300042591 Ga0466692_012116 Ga0466692_012116_451_1437 328
165 3300042596 Ga0466696_124653 Ga0466696_124653_270_1256 328
166 3300042659 Ga0466733_151161 Ga0466733_151161_15181_16167 328
167 3300005201 Ga0072941_1063571 Ga0072941_10635712 329
168 3300005201 Ga0072941_1105249 Ga0072941_11052493 329
169 3300042607 Ga0466720_216265 Ga0466720_216265_9416_10450 329
170 3300042610 Ga0466698_311902 Ga0466698_311902_1084_2073 329
171 iso_pr_bacteria 2781125693 2781434408 329
172 3300005201 Ga0072941_1089550 Ga0072941_10895502 330
173 3300010049 Ga0123356_10155161 Ga0123356_101551612 330
174 3300042612 Ga0466705_319125 Ga0466705_319125_5338_6330 330
175 3300042636 Ga0466703_040188 Ga0466703_040188_3078_4070 330
176 iso_pr_bacteria 2781125689 2781426886 330
177 3300002509 JGI24699J35502_11133970 JGI24699J35502_111339707 331
178 3300042597 Ga0466699_284827 Ga0466699_284827_6300_7295 331
179 3300042614 Ga0466712_217249 Ga0466712_217249_10941_11936 331
180 3300042616 Ga0466715_096475 Ga0466715_096475_1585_2580 331
181 3300005200 Ga0072940_1012366 Ga0072940_101236612 332
182 3300042618 Ga0466723_160902 Ga0466723_160902_1180_2178 332
183 3300002449 JGI24698J34947_10016205 JGI24698J34947_100162053 333
184 3300042590 Ga0466690_273117 Ga0466690_273117_12980_13981 333
185 3300042621 Ga0466729_250653 Ga0466729_250653_895_1965 333
186 3300042652 Ga0466708_078211 Ga0466708_078211_13736_14737 333
187 3300042594 Ga0466694_323807 Ga0466694_323807_16_1023 335
188 3300042614 Ga0466712_234863 Ga0466712_234863_108_1118 336
189 3300042643 Ga0466704_211114 Ga0466704_211114_3661_4671 336
190 3300042659 Ga0466733_166717 Ga0466733_166717_19894_20904 336
191 3300042596 Ga0466696_089145 Ga0466696_089145_2579_3592 337
192 3300042597 Ga0466699_420987 Ga0466699_420987_2570_3583 337
193 3300042600 Ga0466700_222536 Ga0466700_222536_944_1957 337
194 3300042610 Ga0466698_358157 Ga0466698_358157_3412_4425 337
195 3300042652 Ga0466708_081175 Ga0466708_081175_1424_2440 338
196 3300042659 Ga0466733_063690 Ga0466733_063690_401_1417 338
197 3300005200 Ga0072940_1033516 Ga0072940_10335162 339
198 3300042620 Ga0466728_300370 Ga0466728_300370_999_2051 339
199 3300042643 Ga0466704_231113 Ga0466704_231113_8087_9172 339
200 3300042617 Ga0466718_085804 Ga0466718_085804_4995_6020 341
201 3300042652 Ga0466708_061097 Ga0466708_061097_10053_11081 342
202 3300042597 Ga0466699_116808 Ga0466699_116808_96_1127 343
203 3300042607 Ga0466720_068780 Ga0466720_068780_449_1480 343
204 3300042648 Ga0466709_318034 Ga0466709_318034_702_1736 344
205 3300042606 Ga0466719_297251 Ga0466719_297251_6142_7182 346
206 3300042636 Ga0466703_329215 Ga0466703_329215_1511_2554 347
207 3300005201 Ga0072941_1030573 Ga0072941_10305734 349
208 3300042605 Ga0466716_105877 Ga0466716_105877_300_1352 350
209 3300042643 Ga0466704_617044 Ga0466704_617044_227_1285 352
210 3300042612 Ga0466705_184053 Ga0466705_184053_1551_2693 358
211 3300005201 Ga0072941_1019852 Ga0072941_10198527 363

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02911 Formyl_trans_C Formyl transferase, C-terminal domain 207 262 0.9
PF00551 Formyl_trans_N Formyl transferase 21 183 0.85

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02911 GO:0009058 biosynthetic process BP

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.85 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.