Protein Family IF01276
Metagenome
Isolate
137
Members
52
Samples
125
Scaffolds
187.42
Avg Length
Representative Sequence
- ID
- 3300005201|Ga0072941_1005806|Ga0072941_100580622
- Length
- 215 aa
- Sequence
- LVRASAKRRVPSKKDFKGFKQELIVSDLGYLEIILIAIGLSMDAFAVSITLGLSVKKPRLKEFVIPGIYFGAFQALMPLIGYFAGTIFASKIKTLDHWIAFVLLGLIGGKMIKESFSKDEEKSGRNSFQFLNMLLLAVATSIDALAVGVTFAFFEINIFIAIIIIGFTTCVISIGGVKIGNIFGAKFKSKAELLGGVVLVGLGVKILIEHLLGA*
Sample Types
Isolate
8.8%
Metagenome
91.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
50.0%
Unclassified
20.0%
Kalotermitidae
8.0%
Blattidae
8.0%
Rhinotermitidae
4.0%
Termopsidae
4.0%
Passalidae
4.0%
Hodotermitidae
2.0%
Taxonomy
Archaea
3
Bacteria
127
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125638 | Treponema sp. Co191P1bin8 | Isolate | Unclassified |
| 2 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 3 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 6 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 7 | 2940264388 | Lachnospiraceae bacterium PFB1-17 | Isolate | Blattidae |
| 8 | 2940267548 | Lachnospiraceae bacterium PFB1-22 | Isolate | Blattidae |
| 9 | 2772190889 | Unclassified Elusimicrobia Cu122P5_bin43 | Isolate | Unclassified |
| 10 | 2778260937 | Unclassified Fibrobacteres Co191P3bin40 | Isolate | Unclassified |
| 11 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 12 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 13 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 14 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 15 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 16 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 17 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 18 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 19 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 20 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 21 | 2940273867 | Lachnoclostridium sp. PH1-16 | Isolate | Blattidae |
| 22 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 23 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 24 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 25 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 26 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 27 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 28 | 2940270707 | Lachnoclostridium sp. PF1-13 | Isolate | Blattidae |
| 29 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 30 | 2778260940 | Unclassified Fibrobacteres Mp193P3bin36 | Isolate | Unclassified |
| 31 | 2781125642 | Treponema sp. Co191P1bin35 | Isolate | Unclassified |
| 32 | 2773857779 | Unclassified Fibrobacteres Co191P1bin69 | Isolate | Unclassified |
| 33 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 34 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 35 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 36 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 37 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 38 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 39 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 40 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 41 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 42 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 43 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 44 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 45 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 46 | 2772190894 | Unclassified Elusimicrobia Th196P4_bin33 | Isolate | Unclassified |
| 47 | 2820590132 | Unclassified Firmicutes Emb289P1bin84 | Isolate | Unclassified |
| 48 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 49 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 50 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 51 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 52 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_055841 | 3300042612 | Bacteria | 3711 |
| 2 | Ga0466733_004874 | 3300042659 | Bacteria | 4615 |
| 3 | Ga0466735_168918 | 3300042624 | Bacteria | 23518 |
| 4 | Ga0466702_080526 | 3300042635 | Bacteria | 1636 |
| 5 | Ga0466704_022623 | 3300042643 | Bacteria | 3025 |
| 6 | Ga0466704_295770 | 3300042643 | Bacteria | 15382 |
| 7 | Ga0466727_193470 | 3300042655 | Bacteria | 2352 |
| 8 | JGI24696J40584_12841760 | 3300002834 | Archaea | 956 |
| 9 | Ga0072941_1036905 | 3300005201 | Bacteria | 2334 |
| 10 | Ga0466713_073833 | 3300042602 | Bacteria | 1308 |
| 11 | Ga0466721_187392 | 3300042608 | Bacteria | 20917 |
| 12 | Ga0123355_10186380 | 3300009826 | Bacteria | 3067 |
| 13 | Ga0123355_10586226 | 3300009826 | Bacteria | 1330 |
| 14 | Ga0123356_10062228 | 3300010049 | Bacteria | 3486 |
| 15 | Ga0123356_11021271 | 3300010049 | Archaea | 997 |
| 16 | Ga0466731_124913 | 3300042622 | Bacteria | 2186 |
| 17 | Ga0466735_056014 | 3300042624 | Bacteria | 1086 |
| 18 | Ga0466704_015223 | 3300042643 | Bacteria | 2730 |
| 19 | IMNBL1DRAFT_c0004943 | 3300000062 | Bacteria | 7796 |
| 20 | JGI24702J35022_10000366 | 3300002462 | Bacteria | 26831 |
| 21 | JGI24696J40584_12771010 | 3300002834 | Bacteria | 821 |
| 22 | Ga0466707_074831 | 3300042601 | Bacteria | 74990 |
| 23 | Ga0466719_045509 | 3300042606 | Bacteria | 1494 |
| 24 | Ga0466732_093997 | 3300042656 | Archaea | 8509 |
| 25 | Ga0466702_390691 | 3300042635 | Bacteria | 1240 |
| 26 | JGI24695J34938_10000383 | 3300002450 | Bacteria | 43842 |
| 27 | JGI24695J34938_10001843 | 3300002450 | Bacteria | 17250 |
| 28 | JGI24696J40584_12947824 | 3300002834 | Bacteria | 1969 |
| 29 | Ga0466712_312444 | 3300042614 | Bacteria | 3358 |
| 30 | Ga0466706_082975 | 3300042599 | Bacteria | 89571 |
| 31 | Ga0466692_089285 | 3300042591 | Bacteria | 1622 |
| 32 | Ga0123356_11759065 | 3300010049 | Bacteria | 770 |
| 33 | Ga0123353_10326899 | 3300010167 | Bacteria | 2324 |
| 34 | Ga0466733_068599 | 3300042659 | Bacteria | 1976 |
| 35 | Ga0466702_392271 | 3300042635 | Bacteria | 1534 |
| 36 | Ga0466704_361285 | 3300042643 | Bacteria | 3082 |
| 37 | 2227324121 | 2225789004 | Unclassified | 1183 |
| 38 | IMNBL1DRAFT_c0032684 | 3300000062 | Bacteria | 1872 |
| 39 | Ga0072941_1000948 | 3300005201 | Bacteria | 58191 |
| 40 | Ga0466705_480205 | 3300042612 | Bacteria | 1923 |
| 41 | Ga0466693_050918 | 3300042592 | Bacteria | 24778 |
| 42 | Ga0123356_10286201 | 3300010049 | Bacteria | 1746 |
| 43 | Ga0123353_11755799 | 3300010167 | Bacteria | 774 |
| 44 | Ga0466705_077523 | 3300042612 | Bacteria | 7299 |
| 45 | Ga0466705_085629 | 3300042612 | Bacteria | 9722 |
| 46 | Ga0466704_199621 | 3300042643 | Unclassified | 5670 |
| 47 | Ga0466704_346774 | 3300042643 | Bacteria | 2179 |
| 48 | IMNBL1DRAFT_c0096169 | 3300000062 | Unclassified | 803 |
| 49 | AustNasuHG_c1000770 | 3300000089 | Bacteria | 11416 |
| 50 | JGI24698J34947_10007125 | 3300002449 | Bacteria | 6142 |
| 51 | Ga0466712_095058 | 3300042614 | Bacteria | 4854 |
| 52 | Ga0466718_092209 | 3300042617 | Bacteria | 73198 |
| 53 | Ga0466706_253555 | 3300042599 | Bacteria | 1255 |
| 54 | Ga0466719_186154 | 3300042606 | Bacteria | 2536 |
| 55 | Ga0466721_273193 | 3300042608 | Bacteria | 9674 |
| 56 | Ga0123355_10000053 | 3300009826 | Bacteria | 119276 |
| 57 | Ga0123355_10081520 | 3300009826 | Bacteria | 5163 |
| 58 | Ga0123356_10004243 | 3300010049 | Bacteria | 14834 |
| 59 | Ga0123356_10023389 | 3300010049 | Bacteria | 5816 |
| 60 | Ga0123356_10793980 | 3300010049 | Unclassified | 1118 |
| 61 | Ga0123356_10840640 | 3300010049 | Bacteria | 1089 |
| 62 | Ga0123353_10593908 | 3300010167 | Bacteria | 1585 |
| 63 | Ga0466705_092404 | 3300042612 | Bacteria | 8046 |
| 64 | Ga0466702_248800 | 3300042635 | Bacteria | 1500 |
| 65 | Ga0466704_040953 | 3300042643 | Bacteria | 3065 |
| 66 | Ga0466704_058805 | 3300042643 | Bacteria | 5252 |
| 67 | Ga0466704_195645 | 3300042643 | Bacteria | 14131 |
| 68 | Ga0466704_315107 | 3300042643 | Bacteria | 2344 |
| 69 | IMNBL1DRAFT_c0000422 | 3300000062 | Bacteria | 35538 |
| 70 | IMNBL1DRAFT_c0002399 | 3300000062 | Bacteria | 13046 |
| 71 | IMNBL1DRAFT_c0018897 | 3300000062 | Bacteria | 2846 |
| 72 | JGI24695J34938_10002136 | 3300002450 | Bacteria | 15441 |
| 73 | Ga0072941_1004345 | 3300005201 | Bacteria | 20059 |
| 74 | Ga0466728_307371 | 3300042620 | Bacteria | 1441 |
| 75 | Ga0466722_089112 | 3300042609 | Bacteria | 14630 |
| 76 | Ga0264413_116970 | 3300024493 | Bacteria | 5614 |
| 77 | Ga0123355_10103631 | 3300009826 | Bacteria | 4471 |
| 78 | Ga0123355_10212685 | 3300009826 | Bacteria | 2799 |
| 79 | Ga0123355_10317850 | 3300009826 | Bacteria | 2102 |
| 80 | Ga0123355_10587744 | 3300009826 | Bacteria | 1328 |
| 81 | Ga0123355_11330344 | 3300009826 | Bacteria | 718 |
| 82 | Ga0123356_10120734 | 3300010049 | Bacteria | 2548 |
| 83 | Ga0123356_11309138 | 3300010049 | Bacteria | 888 |
| 84 | Ga0123353_10179179 | 3300010167 | Bacteria | 3357 |
| 85 | Ga0466702_089869 | 3300042635 | Bacteria | 3702 |
| 86 | Ga0466702_110929 | 3300042635 | Bacteria | 2903 |
| 87 | Ga0466702_426890 | 3300042635 | Bacteria | 1463 |
| 88 | Ga0466704_357422 | 3300042643 | Bacteria | 8136 |
| 89 | JGI24698J34947_10006755 | 3300002449 | Unclassified | 6303 |
| 90 | Ga0072940_1010726 | 3300005200 | Bacteria | 2783 |
| 91 | Ga0072940_1109580 | 3300005200 | Bacteria | 5769 |
| 92 | Ga0466705_517110 | 3300042612 | Bacteria | 2185 |
| 93 | Ga0466728_382973 | 3300042620 | Bacteria | 2329 |
| 94 | Ga0466722_005177 | 3300042609 | Bacteria | 19765 |
| 95 | Ga0466698_167347 | 3300042610 | Bacteria | 8204 |
| 96 | Ga0466657_390072 | 3300042582 | Bacteria | 1072 |
| 97 | Ga0466695_258997 | 3300042595 | Bacteria | 3807 |
| 98 | Ga0466699_205337 | 3300042597 | Bacteria | 2910 |
| 99 | Ga0123355_10336219 | 3300009826 | Bacteria | 2017 |
| 100 | Ga0123356_10102912 | 3300010049 | Bacteria | 2742 |
| 101 | Ga0123356_10579759 | 3300010049 | Bacteria | 1285 |
| 102 | Ga0123356_10631719 | 3300010049 | Bacteria | 1237 |
| 103 | Ga0123356_11340117 | 3300010049 | Bacteria | 878 |
| 104 | Ga0123353_10969515 | 3300010167 | Bacteria | 1147 |
| 105 | Ga0466697_226254 | 3300042611 | Bacteria | 10741 |
| 106 | Ga0466705_084921 | 3300042612 | Bacteria | 13846 |
| 107 | Ga0466732_287850 | 3300042656 | Bacteria | 21763 |
| 108 | Ga0466704_056605 | 3300042643 | Unclassified | 2285 |
| 109 | IMNBL1DRAFT_c0007498 | 3300000062 | Bacteria | 5728 |
| 110 | JGI24698J34947_10175204 | 3300002449 | Bacteria | 863 |
| 111 | JGI24695J34938_10000333 | 3300002450 | Bacteria | 46505 |
| 112 | JGI24702J35022_10025176 | 3300002462 | Bacteria | 3213 |
| 113 | Ga0072941_1005806 | 3300005201 | Bacteria | 29345 |
| 114 | Ga0466712_048578 | 3300042614 | Bacteria | 5374 |
| 115 | Ga0466714_077853 | 3300042603 | Bacteria | 1163 |
| 116 | Ga0466722_018164 | 3300042609 | Bacteria | 5235 |
| 117 | Ga0466693_230236 | 3300042592 | Bacteria | 1245 |
| 118 | Ga0466693_418251 | 3300042592 | Bacteria | 1568 |
| 119 | Ga0466694_193757 | 3300042594 | Bacteria | 7695 |
| 120 | Ga0123356_10542329 | 3300010049 | Unclassified | 1323 |
| 121 | Ga0123356_10637057 | 3300010049 | Bacteria | 1232 |
| 122 | Ga0123356_10945120 | 3300010049 | Bacteria | 1033 |
| 123 | Ga0123356_10992137 | 3300010049 | Bacteria | 1010 |
| 124 | Ga0123353_12012867 | 3300010167 | Bacteria | 707 |
| 125 | Ga0123354_10112805 | 3300010882 | Bacteria | 3576 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042612 | Ga0466705_085629 | Ga0466705_085629_8765_9337 | 171 |
| 2 | 3300009826 | Ga0123355_10586226 | Ga0123355_105862261 | 172 |
| 3 | 3300042643 | Ga0466704_346774 | Ga0466704_346774_137_712 | 172 |
| 4 | 3300010049 | Ga0123356_10102912 | Ga0123356_101029122 | 173 |
| 5 | 3300042617 | Ga0466718_092209 | Ga0466718_092209_69362_69883 | 173 |
| 6 | 3300002450 | JGI24695J34938_10000333 | JGI24695J34938_1000033337 | 174 |
| 7 | 3300010049 | Ga0123356_10579759 | Ga0123356_105797592 | 174 |
| 8 | 3300042611 | Ga0466697_226254 | Ga0466697_226254_2798_3424 | 175 |
| 9 | 3300010049 | Ga0123356_10286201 | Ga0123356_102862012 | 176 |
| 10 | 3300010049 | Ga0123356_10945120 | Ga0123356_109451202 | 177 |
| 11 | 3300042624 | Ga0466735_168918 | Ga0466735_168918_19756_20319 | 177 |
| 12 | 3300000062 | IMNBL1DRAFT_c0018897 | IMNBL1DRAFT_00188974 | 178 |
| 13 | 3300000062 | IMNBL1DRAFT_c0096169 | IMNBL1DRAFT_00961691 | 178 |
| 14 | 3300002450 | JGI24695J34938_10002136 | JGI24695J34938_100021364 | 178 |
| 15 | 3300010049 | Ga0123356_10542329 | Ga0123356_105423291 | 178 |
| 16 | 3300042612 | Ga0466705_077523 | Ga0466705_077523_5154_5735 | 178 |
| 17 | 3300042599 | Ga0466706_253555 | Ga0466706_253555_692_1231 | 179 |
| 18 | 3300042612 | Ga0466705_517110 | Ga0466705_517110_938_1501 | 179 |
| 19 | 3300002449 | JGI24698J34947_10006755 | JGI24698J34947_100067552 | 180 |
| 20 | 3300002462 | JGI24702J35022_10025176 | JGI24702J35022_100251767 | 180 |
| 21 | 3300005200 | Ga0072940_1010726 | Ga0072940_10107262 | 181 |
| 22 | 3300009826 | Ga0123355_10103631 | Ga0123355_101036313 | 182 |
| 23 | 3300009826 | Ga0123355_10212685 | Ga0123355_102126854 | 182 |
| 24 | 3300005200 | Ga0072940_1109580 | Ga0072940_11095803 | 183 |
| 25 | 3300010167 | Ga0123353_10593908 | Ga0123353_105939083 | 184 |
| 26 | 3300042599 | Ga0466706_082975 | Ga0466706_082975_76604_77158 | 184 |
| 27 | 3300042606 | Ga0466719_045509 | Ga0466719_045509_707_1261 | 184 |
| 28 | 3300042606 | Ga0466719_186154 | Ga0466719_186154_234_788 | 184 |
| 29 | 3300042622 | Ga0466731_124913 | Ga0466731_124913_1204_1758 | 184 |
| 30 | 3300042659 | Ga0466733_068599 | Ga0466733_068599_117_671 | 184 |
| 31 | iso_pr_bacteria | 2772190889 | 2773431738 | 184 |
| 32 | 3300009826 | Ga0123355_10000053 | Ga0123355_1000005346 | 185 |
| 33 | 3300009826 | Ga0123355_10587744 | Ga0123355_105877442 | 185 |
| 34 | 3300010882 | Ga0123354_10112805 | Ga0123354_101128054 | 185 |
| 35 | 3300042602 | Ga0466713_073833 | Ga0466713_073833_501_1058 | 185 |
| 36 | 3300042610 | Ga0466698_167347 | Ga0466698_167347_4579_5136 | 185 |
| 37 | 3300042614 | Ga0466712_048578 | Ga0466712_048578_1154_1711 | 185 |
| 38 | 3300042614 | Ga0466712_095058 | Ga0466712_095058_4003_4560 | 185 |
| 39 | 3300042643 | Ga0466704_295770 | Ga0466704_295770_3041_3598 | 185 |
| 40 | 3300002449 | JGI24698J34947_10007125 | JGI24698J34947_100071254 | 186 |
| 41 | 3300002449 | JGI24698J34947_10175204 | JGI24698J34947_101752041 | 186 |
| 42 | 3300010049 | Ga0123356_10793980 | Ga0123356_107939802 | 186 |
| 43 | 3300010049 | Ga0123356_11340117 | Ga0123356_113401172 | 186 |
| 44 | 3300010167 | Ga0123353_11755799 | Ga0123353_117557992 | 186 |
| 45 | 3300010167 | Ga0123353_12012867 | Ga0123353_120128671 | 186 |
| 46 | 3300024493 | Ga0264413_116970 | Ga0264413_1169704 | 186 |
| 47 | 3300042592 | Ga0466693_230236 | Ga0466693_230236_637_1197 | 186 |
| 48 | 3300042592 | Ga0466693_418251 | Ga0466693_418251_437_997 | 186 |
| 49 | 3300042609 | Ga0466722_018164 | Ga0466722_018164_4451_5035 | 186 |
| 50 | 3300042612 | Ga0466705_084921 | Ga0466705_084921_8061_8621 | 186 |
| 51 | 3300042612 | Ga0466705_092404 | Ga0466705_092404_3542_4102 | 186 |
| 52 | 3300042635 | Ga0466702_110929 | Ga0466702_110929_1754_2314 | 186 |
| 53 | 3300042635 | Ga0466702_248800 | Ga0466702_248800_587_1147 | 186 |
| 54 | 3300042635 | Ga0466702_426890 | Ga0466702_426890_45_605 | 186 |
| 55 | 3300042643 | Ga0466704_195645 | Ga0466704_195645_12328_12915 | 186 |
| 56 | 3300042643 | Ga0466704_199621 | Ga0466704_199621_2767_3327 | 186 |
| 57 | 3300000062 | IMNBL1DRAFT_c0032684 | IMNBL1DRAFT_00326842 | 187 |
| 58 | 3300002834 | JGI24696J40584_12841760 | JGI24696J40584_128417602 | 187 |
| 59 | 3300002834 | JGI24696J40584_12947824 | JGI24696J40584_129478242 | 187 |
| 60 | 3300042582 | Ga0466657_390072 | Ga0466657_390072_287_850 | 187 |
| 61 | 3300042592 | Ga0466693_050918 | Ga0466693_050918_5074_5637 | 187 |
| 62 | 3300042594 | Ga0466694_193757 | Ga0466694_193757_1877_2440 | 187 |
| 63 | 3300042595 | Ga0466695_258997 | Ga0466695_258997_229_792 | 187 |
| 64 | 3300042597 | Ga0466699_205337 | Ga0466699_205337_672_1235 | 187 |
| 65 | 3300042601 | Ga0466707_074831 | Ga0466707_074831_241_804 | 187 |
| 66 | 3300042635 | Ga0466702_392271 | Ga0466702_392271_524_1087 | 187 |
| 67 | 3300042643 | Ga0466704_022623 | Ga0466704_022623_2412_2975 | 187 |
| 68 | 3300042656 | Ga0466732_287850 | Ga0466732_287850_9519_10082 | 187 |
| 69 | iso_pr_bacteria | 2773857779 | 2774479910 | 187 |
| 70 | iso_pr_bacteria | 2778260937 | 2778349339 | 187 |
| 71 | iso_pr_bacteria | 2781125638 | 2781284721 | 187 |
| 72 | iso_pr_bacteria | 2781125642 | 2781292569 | 187 |
| 73 | 2225789004 | 2227324121 | 2227772174 | 188 |
| 74 | 3300000062 | IMNBL1DRAFT_c0004943 | IMNBL1DRAFT_00049431 | 188 |
| 75 | 3300000089 | AustNasuHG_c1000770 | AustNasuHG_10007705 | 188 |
| 76 | 3300002450 | JGI24695J34938_10000383 | JGI24695J34938_1000038335 | 188 |
| 77 | 3300002450 | JGI24695J34938_10001843 | JGI24695J34938_1000184310 | 188 |
| 78 | 3300002834 | JGI24696J40584_12771010 | JGI24696J40584_127710101 | 188 |
| 79 | 3300005201 | Ga0072941_1036905 | Ga0072941_10369053 | 188 |
| 80 | 3300042591 | Ga0466692_089285 | Ga0466692_089285_574_1140 | 188 |
| 81 | 3300042603 | Ga0466714_077853 | Ga0466714_077853_347_913 | 188 |
| 82 | 3300042608 | Ga0466721_187392 | Ga0466721_187392_958_1524 | 188 |
| 83 | 3300042608 | Ga0466721_273193 | Ga0466721_273193_1580_2146 | 188 |
| 84 | 3300042635 | Ga0466702_089869 | Ga0466702_089869_2867_3433 | 188 |
| 85 | 3300042635 | Ga0466702_390691 | Ga0466702_390691_412_978 | 188 |
| 86 | 3300010049 | Ga0123356_10120734 | Ga0123356_101207343 | 189 |
| 87 | 3300010049 | Ga0123356_11759065 | Ga0123356_117590651 | 189 |
| 88 | 3300042609 | Ga0466722_089112 | Ga0466722_089112_2754_3323 | 189 |
| 89 | 3300042614 | Ga0466712_312444 | Ga0466712_312444_2220_2789 | 189 |
| 90 | iso_pr_bacteria | 2778260940 | 2778357495 | 189 |
| 91 | 3300009826 | Ga0123355_10336219 | Ga0123355_103362192 | 190 |
| 92 | 3300009826 | Ga0123355_11330344 | Ga0123355_113303441 | 190 |
| 93 | 3300010049 | Ga0123356_10062228 | Ga0123356_100622282 | 190 |
| 94 | 3300010049 | Ga0123356_10631719 | Ga0123356_106317191 | 190 |
| 95 | 3300010049 | Ga0123356_10637057 | Ga0123356_106370571 | 190 |
| 96 | 3300010049 | Ga0123356_10840640 | Ga0123356_108406402 | 190 |
| 97 | 3300010049 | Ga0123356_11021271 | Ga0123356_110212711 | 190 |
| 98 | 3300042612 | Ga0466705_055841 | Ga0466705_055841_1572_2144 | 190 |
| 99 | 3300042612 | Ga0466705_480205 | Ga0466705_480205_1002_1574 | 190 |
| 100 | 3300042620 | Ga0466728_382973 | Ga0466728_382973_1523_2095 | 190 |
| 101 | 3300042643 | Ga0466704_015223 | Ga0466704_015223_277_849 | 190 |
| 102 | 3300042643 | Ga0466704_040953 | Ga0466704_040953_297_869 | 190 |
| 103 | 3300042643 | Ga0466704_056605 | Ga0466704_056605_1414_1986 | 190 |
| 104 | 3300042643 | Ga0466704_058805 | Ga0466704_058805_2400_2972 | 190 |
| 105 | 3300042643 | Ga0466704_315107 | Ga0466704_315107_539_1111 | 190 |
| 106 | 3300042643 | Ga0466704_357422 | Ga0466704_357422_2618_3190 | 190 |
| 107 | 3300042655 | Ga0466727_193470 | Ga0466727_193470_1537_2109 | 190 |
| 108 | 3300042656 | Ga0466732_093997 | Ga0466732_093997_718_1290 | 190 |
| 109 | iso_pr_bacteria | 2772190894 | 2773439255 | 190 |
| 110 | 3300000062 | IMNBL1DRAFT_c0002399 | IMNBL1DRAFT_00023999 | 191 |
| 111 | 3300002462 | JGI24702J35022_10000366 | JGI24702J35022_100003663 | 191 |
| 112 | 3300010049 | Ga0123356_10023389 | Ga0123356_100233896 | 191 |
| 113 | 3300010049 | Ga0123356_10992137 | Ga0123356_109921372 | 191 |
| 114 | 3300010167 | Ga0123353_10326899 | Ga0123353_103268992 | 191 |
| 115 | 3300042609 | Ga0466722_005177 | Ga0466722_005177_937_1512 | 191 |
| 116 | iso_pr_bacteria | 2940264388 | 2940265766 | 191 |
| 117 | iso_pr_bacteria | 2940267548 | 2940268926 | 191 |
| 118 | iso_pr_bacteria | 2940270707 | 2940272021 | 191 |
| 119 | iso_pr_bacteria | 2940273867 | 2940275188 | 191 |
| 120 | 3300009826 | Ga0123355_10081520 | Ga0123355_100815202 | 192 |
| 121 | 3300010049 | Ga0123356_11309138 | Ga0123356_113091382 | 192 |
| 122 | 3300042635 | Ga0466702_080526 | Ga0466702_080526_924_1505 | 193 |
| 123 | 3300010167 | Ga0123353_10969515 | Ga0123353_109695151 | 194 |
| 124 | 3300042624 | Ga0466735_056014 | Ga0466735_056014_261_845 | 194 |
| 125 | 3300009826 | Ga0123355_10317850 | Ga0123355_103178504 | 196 |
| 126 | 3300010049 | Ga0123356_10004243 | Ga0123356_1000424310 | 196 |
| 127 | 3300000062 | IMNBL1DRAFT_c0000422 | IMNBL1DRAFT_000042211 | 197 |
| 128 | 3300000062 | IMNBL1DRAFT_c0007498 | IMNBL1DRAFT_00074982 | 197 |
| 129 | 3300010167 | Ga0123353_10179179 | Ga0123353_101791793 | 198 |
| 130 | 3300005201 | Ga0072941_1004345 | Ga0072941_10043453 | 202 |
| 131 | iso_pr_bacteria | 2820590132 | 2820592200 | 202 |
| 132 | 3300009826 | Ga0123355_10186380 | Ga0123355_101863803 | 203 |
| 133 | 3300042659 | Ga0466733_004874 | Ga0466733_004874_2396_3028 | 203 |
| 134 | 3300042620 | Ga0466728_307371 | Ga0466728_307371_230_844 | 204 |
| 135 | 3300005201 | Ga0072941_1000948 | Ga0072941_100094828 | 205 |
| 136 | 3300042643 | Ga0466704_361285 | Ga0466704_361285_2094_2735 | 213 |
| 137 | 3300005201 | Ga0072941_1005806 | Ga0072941_100580622 | 215 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02659 | Mntp | Putative manganese efflux pump | 58 | 207 | 0.98 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.63 | 0.81 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.