Protein Family IF01258
Metagenome
Isolate
149
Members
58
Samples
139
Scaffolds
201.1
Avg Length
Representative Sequence
- ID
- 3300005200|Ga0072940_1445291|Ga0072940_14452913
- Length
- 197 aa
- Sequence
- MKENCLRSYLHDNLIEAGCDEAGRGCLAGPVCAAAVILPPKFYHPLLNDSKQMTKKHREELRKIIEKVAMLSPKEIDKLNILWASVAAMHRALDGLTTTPEFILVDGNKFRPYKNIPHQCVIKGDATFTAIAAASVLAKTHRDEYMSKLSLKYPDYEWDKNMGYPTERHRAAIVLYGITPHHRKSFRLIDEELKLF*
Sample Types
Isolate
6.7%
Metagenome
93.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
31.6%
Kalotermitidae
24.6%
Unclassified
8.8%
Blattidae
7.0%
Termopsidae
7.0%
Rhinotermitidae
5.3%
Passalidae
5.3%
Hydrophilidae
3.5%
Apidae
1.8%
Hodotermitidae
1.8%
Elmidae
1.8%
Drosophilidae
1.8%
Taxonomy
Archaea
0
Bacteria
145
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 2 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 3 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 4 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 5 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 6 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 7 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 8 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 9 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 10 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 11 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 12 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 13 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 14 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 15 | 8065497608 | Tellurirhabdus bombi IE-0392 | Isolate | Apidae |
| 16 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 17 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 18 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 19 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 20 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 21 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 22 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 23 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 24 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 25 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 26 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 27 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 28 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 29 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 30 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 31 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 32 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 33 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 34 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 35 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 36 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 37 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 38 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 39 | 2820748953 | Unclassified Bacteroidetes Nt197P4bin17 | Isolate | Unclassified |
| 40 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 41 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 42 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 43 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 44 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 45 | 2864836148 | Arcicella rosea S00070 | Isolate | Elmidae |
| 46 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 47 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 48 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 49 | 3300005316 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 2 gut | Metagenome | Drosophilidae |
| 50 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 51 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 52 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 53 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 54 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 55 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 56 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 57 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 58 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_137450 | 3300042659 | Bacteria | 18606 |
| 2 | Ga0466733_220667 | 3300042659 | Bacteria | 1295 |
| 3 | Ga0466734_046392 | 3300042623 | Bacteria | 5277 |
| 4 | Ga0466703_309294 | 3300042636 | Bacteria | 9872 |
| 5 | Ga0466704_072890 | 3300042643 | Bacteria | 2708 |
| 6 | Ga0466704_102240 | 3300042643 | Bacteria | 1824 |
| 7 | Ga0466704_316152 | 3300042643 | Bacteria | 27672 |
| 8 | Ga0466709_005092 | 3300042648 | Bacteria | 6399 |
| 9 | Ga0466715_558565 | 3300042616 | Bacteria | 6167 |
| 10 | Ga0123353_10111688 | 3300010167 | Bacteria | 4402 |
| 11 | Ga0466707_387842 | 3300042601 | Bacteria | 4314 |
| 12 | Ga0466657_088487 | 3300042582 | Bacteria | 5476 |
| 13 | Ga0466657_251419 | 3300042582 | Bacteria | 14267 |
| 14 | Ga0466690_015157 | 3300042590 | Bacteria | 12387 |
| 15 | Ga0466691_028851 | 3300042593 | Bacteria | 25063 |
| 16 | Ga0466696_483865 | 3300042596 | Bacteria | 4945 |
| 17 | IMNBL1DRAFT_c0000136 | 3300000062 | Bacteria | 65757 |
| 18 | JGI24696J40584_12870380 | 3300002834 | Bacteria | 1043 |
| 19 | Ga0466729_249393 | 3300042621 | Bacteria | 3217 |
| 20 | Ga0466708_160114 | 3300042652 | Bacteria | 24888 |
| 21 | Ga0466725_451916 | 3300042654 | Bacteria | 1521 |
| 22 | Ga0466727_027558 | 3300042655 | Bacteria | 4233 |
| 23 | Ga0466710_039747 | 3300042613 | Bacteria | 3123 |
| 24 | Ga0466706_077487 | 3300042599 | Bacteria | 1850 |
| 25 | Ga0466706_145412 | 3300042599 | Bacteria | 15301 |
| 26 | Ga0466707_057632 | 3300042601 | Bacteria | 2959 |
| 27 | Ga0466691_038170 | 3300042593 | Bacteria | 24327 |
| 28 | Ga0466691_071717 | 3300042593 | Bacteria | 7692 |
| 29 | Ga0466691_076597 | 3300042593 | Bacteria | 34769 |
| 30 | Ga0466696_036786 | 3300042596 | Bacteria | 23414 |
| 31 | IMNBGM34_c002980 | 3300000036 | Bacteria | 2389 |
| 32 | IMNBL1DRAFT_c0002847 | 3300000062 | Bacteria | 11629 |
| 33 | Ga0074302_1135866 | 3300005316 | Bacteria | 2409 |
| 34 | Ga0466705_112626 | 3300042612 | Bacteria | 34485 |
| 35 | Ga0466703_410974 | 3300042636 | Bacteria | 1995 |
| 36 | Ga0466704_473902 | 3300042643 | Bacteria | 3805 |
| 37 | Ga0466704_599255 | 3300042643 | Bacteria | 1219 |
| 38 | Ga0466709_002316 | 3300042648 | Bacteria | 13109 |
| 39 | Ga0466709_180250 | 3300042648 | Bacteria | 3210 |
| 40 | Ga0466709_366543 | 3300042648 | Bacteria | 31013 |
| 41 | Ga0466723_123513 | 3300042618 | Bacteria | 16564 |
| 42 | Ga0466728_046608 | 3300042620 | Bacteria | 5441 |
| 43 | Ga0466713_107296 | 3300042602 | Bacteria | 16524 |
| 44 | Ga0466719_323065 | 3300042606 | Bacteria | 3866 |
| 45 | Ga0466690_101169 | 3300042590 | Bacteria | 9511 |
| 46 | Ga0466690_194910 | 3300042590 | Bacteria | 15260 |
| 47 | Ga0466691_010178 | 3300042593 | Bacteria | 4295 |
| 48 | Ga0466691_036281 | 3300042593 | Bacteria | 29304 |
| 49 | Ga0466691_081401 | 3300042593 | Bacteria | 70057 |
| 50 | Ga0466696_005755 | 3300042596 | Bacteria | 9628 |
| 51 | Ga0072940_1445291 | 3300005200 | Bacteria | 2157 |
| 52 | Ga0072941_1190724 | 3300005201 | Bacteria | 2841 |
| 53 | Ga0466703_045888 | 3300042636 | Bacteria | 7226 |
| 54 | Ga0466724_39109 | 3300042649 | Bacteria | 8826 |
| 55 | Ga0466708_253997 | 3300042652 | Bacteria | 12551 |
| 56 | Ga0466708_279340 | 3300042652 | Bacteria | 55893 |
| 57 | Ga0466708_390336 | 3300042652 | Bacteria | 2658 |
| 58 | Ga0466715_101610 | 3300042616 | Bacteria | 54990 |
| 59 | Ga0466723_153474 | 3300042618 | Bacteria | 18242 |
| 60 | Ga0466726_000950 | 3300042619 | Bacteria | 1741 |
| 61 | Ga0123354_10113823 | 3300010882 | Bacteria | 3550 |
| 62 | Ga0466716_415490 | 3300042605 | Bacteria | 12920 |
| 63 | Ga0466698_040718 | 3300042610 | Bacteria | 1264 |
| 64 | Ga0466696_011340 | 3300042596 | Bacteria | 16888 |
| 65 | Ga0466705_297650 | 3300042612 | Bacteria | 3695 |
| 66 | Ga0466704_190607 | 3300042643 | Bacteria | 5554 |
| 67 | Ga0466704_358409 | 3300042643 | Bacteria | 1907 |
| 68 | Ga0466727_136386 | 3300042655 | Bacteria | 3861 |
| 69 | Ga0466710_117427 | 3300042613 | Bacteria | 1724 |
| 70 | Ga0466711_467682 | 3300042615 | Bacteria | 24337 |
| 71 | Ga0466729_082349 | 3300042621 | Bacteria | 2351 |
| 72 | Ga0123353_10535857 | 3300010167 | Bacteria | 1693 |
| 73 | Ga0466713_038022 | 3300042602 | Bacteria | 17743 |
| 74 | Ga0466713_109091 | 3300042602 | Bacteria | 6268 |
| 75 | Ga0466713_138601 | 3300042602 | Bacteria | 13485 |
| 76 | Ga0466716_319535 | 3300042605 | Bacteria | 12544 |
| 77 | Ga0466719_571090 | 3300042606 | Bacteria | 1148 |
| 78 | Ga0466691_039602 | 3300042593 | Bacteria | 17586 |
| 79 | Ga0466691_120142 | 3300042593 | Bacteria | 8129 |
| 80 | Ga0466696_091827 | 3300042596 | Bacteria | 6364 |
| 81 | Ga0466696_207465 | 3300042596 | Bacteria | 6925 |
| 82 | IMNBL1DRAFT_c0000936 | 3300000062 | Bacteria | 22561 |
| 83 | Ga0466697_239015 | 3300042611 | Bacteria | 10520 |
| 84 | Ga0466735_016934 | 3300042624 | Bacteria | 6056 |
| 85 | Ga0466703_012871 | 3300042636 | Bacteria | 30811 |
| 86 | Ga0466704_444501 | 3300042643 | Bacteria | 1646 |
| 87 | Ga0466708_073968 | 3300042652 | Bacteria | 4794 |
| 88 | Ga0466727_038315 | 3300042655 | Bacteria | 13112 |
| 89 | Ga0466727_085698 | 3300042655 | Bacteria | 12624 |
| 90 | Ga0466711_204836 | 3300042615 | Bacteria | 21772 |
| 91 | Ga0466723_103733 | 3300042618 | Bacteria | 16560 |
| 92 | Ga0466726_478650 | 3300042619 | Bacteria | 1193 |
| 93 | Ga0466728_222006 | 3300042620 | Bacteria | 10138 |
| 94 | Ga0466729_074291 | 3300042621 | Bacteria | 3551 |
| 95 | Ga0466700_436068 | 3300042600 | Bacteria | 2050 |
| 96 | Ga0466714_169215 | 3300042603 | Bacteria | 5749 |
| 97 | Ga0466719_399795 | 3300042606 | Unclassified | 2395 |
| 98 | Ga0466722_146504 | 3300042609 | Bacteria | 6882 |
| 99 | Ga0068302_10077333 | 3300005071 | Unclassified | 2602 |
| 100 | Ga0068305_10150120 | 3300005083 | Bacteria | 8544 |
| 101 | Ga0466697_186132 | 3300042611 | Bacteria | 64133 |
| 102 | Ga0466705_075371 | 3300042612 | Bacteria | 3896 |
| 103 | Ga0466705_083452 | 3300042612 | Bacteria | 12606 |
| 104 | Ga0466735_232398 | 3300042624 | Bacteria | 7105 |
| 105 | Ga0466709_345297 | 3300042648 | Bacteria | 6177 |
| 106 | Ga0466705_480721 | 3300042612 | Bacteria | 3083 |
| 107 | Ga0123356_11819417 | 3300010049 | Bacteria | 757 |
| 108 | Ga0466701_032718 | 3300042598 | Bacteria | 1675 |
| 109 | Ga0466706_073173 | 3300042599 | Bacteria | 1670 |
| 110 | Ga0466706_075928 | 3300042599 | Bacteria | 44954 |
| 111 | Ga0466706_080465 | 3300042599 | Bacteria | 1785 |
| 112 | Ga0466716_045391 | 3300042605 | Bacteria | 10720 |
| 113 | Ga0466690_147463 | 3300042590 | Unclassified | 7097 |
| 114 | Ga0466690_230407 | 3300042590 | Bacteria | 2313 |
| 115 | Ga0466692_147553 | 3300042591 | Bacteria | 2240 |
| 116 | Ga0466691_083877 | 3300042593 | Bacteria | 17933 |
| 117 | Ga0466696_081695 | 3300042596 | Bacteria | 3268 |
| 118 | JGI24696J40584_12806988 | 3300002834 | Bacteria | 880 |
| 119 | Ga0466705_192486 | 3300042612 | Bacteria | 6268 |
| 120 | Ga0466703_069217 | 3300042636 | Bacteria | 18405 |
| 121 | Ga0466704_326381 | 3300042643 | Bacteria | 4008 |
| 122 | Ga0466711_057542 | 3300042615 | Bacteria | 70908 |
| 123 | Ga0466711_197998 | 3300042615 | Bacteria | 9132 |
| 124 | Ga0466711_300752 | 3300042615 | Bacteria | 3263 |
| 125 | Ga0466715_057824 | 3300042616 | Bacteria | 5031 |
| 126 | Ga0466713_091029 | 3300042602 | Unclassified | 5319 |
| 127 | Ga0466657_184190 | 3300042582 | Bacteria | 2873 |
| 128 | Ga0466690_058661 | 3300042590 | Bacteria | 1854 |
| 129 | Ga0466693_311485 | 3300042592 | Bacteria | 1146 |
| 130 | Ga0466696_132627 | 3300042596 | Bacteria | 7794 |
| 131 | Ga0466696_158100 | 3300042596 | Bacteria | 1515 |
| 132 | Ga0466696_240357 | 3300042596 | Bacteria | 5265 |
| 133 | 2227219677 | 2225789004 | Bacteria | 33581 |
| 134 | 2227316903 | 2225789004 | Bacteria | 6452 |
| 135 | IMNBL1DRAFT_c0003351 | 3300000062 | Bacteria | 10390 |
| 136 | IMNBL1DRAFT_c0008044 | 3300000062 | Bacteria | 5429 |
| 137 | JGI24702J35022_10000110 | 3300002462 | Bacteria | 38580 |
| 138 | Ga0068305_10073456 | 3300005083 | Bacteria | 3390 |
| 139 | Ga0072941_1166143 | 3300005201 | Bacteria | 5258 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042636 | Ga0466703_309294 | Ga0466703_309294_2818_3375 | 185 |
| 2 | 3300042648 | Ga0466709_345297 | Ga0466709_345297_2063_2623 | 186 |
| 3 | 3300042590 | Ga0466690_015157 | Ga0466690_015157_6693_7301 | 190 |
| 4 | iso_pr_bacteria | 2864836148 | 2864837037 | 190 |
| 5 | 3300042593 | Ga0466691_071717 | Ga0466691_071717_259_834 | 191 |
| 6 | 3300042596 | Ga0466696_081695 | Ga0466696_081695_2456_3031 | 191 |
| 7 | 3300042648 | Ga0466709_180250 | Ga0466709_180250_553_1128 | 191 |
| 8 | 3300042652 | Ga0466708_253997 | Ga0466708_253997_1951_2526 | 191 |
| 9 | iso_pr_bacteria | 8065497608 | 8065499133 | 191 |
| 10 | 3300042623 | Ga0466734_046392 | Ga0466734_046392_3770_4348 | 192 |
| 11 | 3300042643 | Ga0466704_358409 | Ga0466704_358409_14_592 | 192 |
| 12 | 3300042643 | Ga0466704_444501 | Ga0466704_444501_863_1441 | 192 |
| 13 | 3300042643 | Ga0466704_473902 | Ga0466704_473902_2803_3381 | 192 |
| 14 | 3300042643 | Ga0466704_599255 | Ga0466704_599255_436_1014 | 192 |
| 15 | 3300042602 | Ga0466713_138601 | Ga0466713_138601_8135_8719 | 194 |
| 16 | 3300042612 | Ga0466705_297650 | Ga0466705_297650_2135_2719 | 194 |
| 17 | 3300042596 | Ga0466696_483865 | Ga0466696_483865_943_1548 | 195 |
| 18 | 3300042612 | Ga0466705_083452 | Ga0466705_083452_951_1538 | 195 |
| 19 | 3300042615 | Ga0466711_467682 | Ga0466711_467682_15780_16367 | 195 |
| 20 | 3300042599 | Ga0466706_075928 | Ga0466706_075928_7846_8436 | 196 |
| 21 | 3300005200 | Ga0072940_1445291 | Ga0072940_14452913 | 197 |
| 22 | 3300042593 | Ga0466691_076597 | Ga0466691_076597_18792_19409 | 197 |
| 23 | 3300042615 | Ga0466711_204836 | Ga0466711_204836_2412_3005 | 197 |
| 24 | 3300042621 | Ga0466729_074291 | Ga0466729_074291_379_972 | 197 |
| 25 | 3300005071 | Ga0068302_10077333 | Ga0068302_100773332 | 198 |
| 26 | 3300042582 | Ga0466657_088487 | Ga0466657_088487_4580_5176 | 198 |
| 27 | 3300042582 | Ga0466657_184190 | Ga0466657_184190_1971_2567 | 198 |
| 28 | 3300042596 | Ga0466696_005755 | Ga0466696_005755_1621_2217 | 198 |
| 29 | 3300042599 | Ga0466706_073173 | Ga0466706_073173_687_1283 | 198 |
| 30 | 3300042613 | Ga0466710_039747 | Ga0466710_039747_1410_2006 | 198 |
| 31 | 3300042613 | Ga0466710_117427 | Ga0466710_117427_254_850 | 198 |
| 32 | 3300042643 | Ga0466704_072890 | Ga0466704_072890_667_1263 | 198 |
| 33 | 3300042592 | Ga0466693_311485 | Ga0466693_311485_133_792 | 199 |
| 34 | iso_pr_bacteria | 2873600114 | 2873602072 | 199 |
| 35 | iso_pr_bacteria | 2873610414 | 2873612433 | 199 |
| 36 | iso_pr_bacteria | 2940199050 | 2940201872 | 199 |
| 37 | iso_pr_bacteria | 2940202316 | 2940204381 | 199 |
| 38 | iso_pr_bacteria | 2940346213 | 2940348495 | 199 |
| 39 | 3300010167 | Ga0123353_10535857 | Ga0123353_105358572 | 200 |
| 40 | 3300042590 | Ga0466690_194910 | Ga0466690_194910_6555_7157 | 200 |
| 41 | 3300042593 | Ga0466691_010178 | Ga0466691_010178_1626_2228 | 200 |
| 42 | 3300042593 | Ga0466691_028851 | Ga0466691_028851_4460_5062 | 200 |
| 43 | 3300042593 | Ga0466691_081401 | Ga0466691_081401_213_815 | 200 |
| 44 | 3300042593 | Ga0466691_083877 | Ga0466691_083877_789_1391 | 200 |
| 45 | 3300042596 | Ga0466696_011340 | Ga0466696_011340_587_1189 | 200 |
| 46 | 3300042596 | Ga0466696_091827 | Ga0466696_091827_4591_5193 | 200 |
| 47 | 3300042602 | Ga0466713_091029 | Ga0466713_091029_2050_2652 | 200 |
| 48 | 3300042606 | Ga0466719_399795 | Ga0466719_399795_1357_1959 | 200 |
| 49 | 3300042612 | Ga0466705_192486 | Ga0466705_192486_5384_5986 | 200 |
| 50 | 3300042612 | Ga0466705_480721 | Ga0466705_480721_766_1368 | 200 |
| 51 | 3300042616 | Ga0466715_057824 | Ga0466715_057824_179_781 | 200 |
| 52 | 3300042616 | Ga0466715_558565 | Ga0466715_558565_4317_4919 | 200 |
| 53 | 3300042620 | Ga0466728_046608 | Ga0466728_046608_1951_2553 | 200 |
| 54 | 3300042624 | Ga0466735_232398 | Ga0466735_232398_1808_2410 | 200 |
| 55 | 3300042636 | Ga0466703_069217 | Ga0466703_069217_2233_2835 | 200 |
| 56 | 3300042643 | Ga0466704_102240 | Ga0466704_102240_193_795 | 200 |
| 57 | 3300042643 | Ga0466704_190607 | Ga0466704_190607_21_623 | 200 |
| 58 | 3300042652 | Ga0466708_279340 | Ga0466708_279340_37152_37754 | 200 |
| 59 | 3300042655 | Ga0466727_038315 | Ga0466727_038315_1588_2190 | 200 |
| 60 | 3300042655 | Ga0466727_136386 | Ga0466727_136386_2274_2876 | 200 |
| 61 | 3300042659 | Ga0466733_137450 | Ga0466733_137450_16283_16885 | 200 |
| 62 | iso_pr_bacteria | 2695420931 | 2698110939 | 200 |
| 63 | 2225789004 | 2227316903 | 2227765792 | 201 |
| 64 | 3300000062 | IMNBL1DRAFT_c0000136 | IMNBL1DRAFT_000013633 | 201 |
| 65 | 3300000062 | IMNBL1DRAFT_c0003351 | IMNBL1DRAFT_000335110 | 201 |
| 66 | 3300002834 | JGI24696J40584_12870380 | JGI24696J40584_128703802 | 201 |
| 67 | 3300005083 | Ga0068305_10073456 | Ga0068305_100734564 | 201 |
| 68 | 3300042590 | Ga0466690_058661 | Ga0466690_058661_272_877 | 201 |
| 69 | 3300042590 | Ga0466690_147463 | Ga0466690_147463_5337_5942 | 201 |
| 70 | 3300042596 | Ga0466696_036786 | Ga0466696_036786_16035_16640 | 201 |
| 71 | 3300042596 | Ga0466696_132627 | Ga0466696_132627_428_1033 | 201 |
| 72 | 3300042602 | Ga0466713_038022 | Ga0466713_038022_12052_12657 | 201 |
| 73 | 3300042602 | Ga0466713_107296 | Ga0466713_107296_10279_10884 | 201 |
| 74 | 3300042603 | Ga0466714_169215 | Ga0466714_169215_1357_1962 | 201 |
| 75 | 3300042612 | Ga0466705_112626 | Ga0466705_112626_13926_14531 | 201 |
| 76 | 3300042618 | Ga0466723_103733 | Ga0466723_103733_170_775 | 201 |
| 77 | 3300042620 | Ga0466728_222006 | Ga0466728_222006_8957_9562 | 201 |
| 78 | 3300042636 | Ga0466703_012871 | Ga0466703_012871_16650_17255 | 201 |
| 79 | 3300042643 | Ga0466704_326381 | Ga0466704_326381_438_1043 | 201 |
| 80 | 3300042648 | Ga0466709_366543 | Ga0466709_366543_25851_26456 | 201 |
| 81 | 3300042655 | Ga0466727_027558 | Ga0466727_027558_821_1426 | 201 |
| 82 | 3300042659 | Ga0466733_220667 | Ga0466733_220667_165_770 | 201 |
| 83 | 3300000062 | IMNBL1DRAFT_c0000936 | IMNBL1DRAFT_000093618 | 202 |
| 84 | 3300000062 | IMNBL1DRAFT_c0002847 | IMNBL1DRAFT_00028477 | 202 |
| 85 | 3300005083 | Ga0068305_10150120 | Ga0068305_101501202 | 202 |
| 86 | 3300005201 | Ga0072941_1166143 | Ga0072941_11661436 | 202 |
| 87 | 3300005316 | Ga0074302_1135866 | Ga0074302_11358662 | 202 |
| 88 | 3300010049 | Ga0123356_11819417 | Ga0123356_118194171 | 202 |
| 89 | 3300042582 | Ga0466657_251419 | Ga0466657_251419_6992_7600 | 202 |
| 90 | 3300042591 | Ga0466692_147553 | Ga0466692_147553_1513_2121 | 202 |
| 91 | 3300042593 | Ga0466691_036281 | Ga0466691_036281_19339_19947 | 202 |
| 92 | 3300042593 | Ga0466691_038170 | Ga0466691_038170_23595_24203 | 202 |
| 93 | 3300042593 | Ga0466691_120142 | Ga0466691_120142_5744_6352 | 202 |
| 94 | 3300042598 | Ga0466701_032718 | Ga0466701_032718_114_722 | 202 |
| 95 | 3300042599 | Ga0466706_077487 | Ga0466706_077487_133_741 | 202 |
| 96 | 3300042600 | Ga0466700_436068 | Ga0466700_436068_543_1151 | 202 |
| 97 | 3300042601 | Ga0466707_387842 | Ga0466707_387842_2856_3464 | 202 |
| 98 | 3300042602 | Ga0466713_109091 | Ga0466713_109091_2042_2650 | 202 |
| 99 | 3300042605 | Ga0466716_415490 | Ga0466716_415490_4303_4911 | 202 |
| 100 | 3300042606 | Ga0466719_323065 | Ga0466719_323065_1016_1624 | 202 |
| 101 | 3300042611 | Ga0466697_186132 | Ga0466697_186132_42705_43313 | 202 |
| 102 | 3300042615 | Ga0466711_197998 | Ga0466711_197998_797_1405 | 202 |
| 103 | 3300042616 | Ga0466715_101610 | Ga0466715_101610_37154_37762 | 202 |
| 104 | 3300042619 | Ga0466726_478650 | Ga0466726_478650_65_673 | 202 |
| 105 | 3300042648 | Ga0466709_005092 | Ga0466709_005092_3742_4350 | 202 |
| 106 | 3300042655 | Ga0466727_085698 | Ga0466727_085698_380_988 | 202 |
| 107 | iso_pr_bacteria | 2940209341 | 2940211778 | 202 |
| 108 | 3300000062 | IMNBL1DRAFT_c0008044 | IMNBL1DRAFT_00080445 | 203 |
| 109 | 3300002462 | JGI24702J35022_10000110 | JGI24702J35022_1000011018 | 203 |
| 110 | 3300002834 | JGI24696J40584_12806988 | JGI24696J40584_128069882 | 203 |
| 111 | 3300005201 | Ga0072941_1190724 | Ga0072941_11907241 | 203 |
| 112 | 3300010167 | Ga0123353_10111688 | Ga0123353_101116882 | 203 |
| 113 | 3300042590 | Ga0466690_230407 | Ga0466690_230407_534_1145 | 203 |
| 114 | 3300042601 | Ga0466707_057632 | Ga0466707_057632_183_794 | 203 |
| 115 | 3300042605 | Ga0466716_045391 | Ga0466716_045391_5729_6340 | 203 |
| 116 | 3300042606 | Ga0466719_571090 | Ga0466719_571090_63_674 | 203 |
| 117 | 3300042609 | Ga0466722_146504 | Ga0466722_146504_1074_1685 | 203 |
| 118 | 3300042612 | Ga0466705_075371 | Ga0466705_075371_2563_3174 | 203 |
| 119 | 3300042618 | Ga0466723_153474 | Ga0466723_153474_11919_12530 | 203 |
| 120 | 3300042624 | Ga0466735_016934 | Ga0466735_016934_4395_5006 | 203 |
| 121 | 3300042636 | Ga0466703_410974 | Ga0466703_410974_215_826 | 203 |
| 122 | 3300042652 | Ga0466708_073968 | Ga0466708_073968_877_1488 | 203 |
| 123 | 3300042652 | Ga0466708_390336 | Ga0466708_390336_1170_1781 | 203 |
| 124 | 3300042596 | Ga0466696_207465 | Ga0466696_207465_4210_4824 | 204 |
| 125 | 3300042605 | Ga0466716_319535 | Ga0466716_319535_8757_9371 | 204 |
| 126 | 3300042615 | Ga0466711_057542 | Ga0466711_057542_34743_35357 | 204 |
| 127 | 3300042621 | Ga0466729_082349 | Ga0466729_082349_610_1224 | 204 |
| 128 | 3300042621 | Ga0466729_249393 | Ga0466729_249393_970_1608 | 204 |
| 129 | 3300042652 | Ga0466708_160114 | Ga0466708_160114_16583_17197 | 204 |
| 130 | 3300042654 | Ga0466725_451916 | Ga0466725_451916_332_946 | 204 |
| 131 | iso_pr_bacteria | 2820748953 | 2820749845 | 204 |
| 132 | 3300000036 | IMNBGM34_c002980 | IMNBGM34_0029804 | 205 |
| 133 | 3300042599 | Ga0466706_145412 | Ga0466706_145412_1246_1863 | 205 |
| 134 | 3300042596 | Ga0466696_158100 | Ga0466696_158100_689_1309 | 206 |
| 135 | 3300042596 | Ga0466696_240357 | Ga0466696_240357_874_1494 | 206 |
| 136 | 3300042599 | Ga0466706_080465 | Ga0466706_080465_70_690 | 206 |
| 137 | 3300042636 | Ga0466703_045888 | Ga0466703_045888_1857_2477 | 206 |
| 138 | 3300042610 | Ga0466698_040718 | Ga0466698_040718_513_1136 | 207 |
| 139 | 3300042619 | Ga0466726_000950 | Ga0466726_000950_782_1408 | 208 |
| 140 | 3300042590 | Ga0466690_101169 | Ga0466690_101169_4438_5067 | 209 |
| 141 | 3300042648 | Ga0466709_002316 | Ga0466709_002316_801_1430 | 209 |
| 142 | 3300042611 | Ga0466697_239015 | Ga0466697_239015_7490_8122 | 210 |
| 143 | 3300042615 | Ga0466711_300752 | Ga0466711_300752_262_894 | 210 |
| 144 | 3300042618 | Ga0466723_123513 | Ga0466723_123513_11201_11833 | 210 |
| 145 | 3300042593 | Ga0466691_039602 | Ga0466691_039602_1787_2425 | 212 |
| 146 | 3300042649 | Ga0466724_39109 | Ga0466724_39109_7000_7641 | 213 |
| 147 | 3300010882 | Ga0123354_10113823 | Ga0123354_101138233 | 224 |
| 148 | 3300042643 | Ga0466704_316152 | Ga0466704_316152_8908_9600 | 230 |
| 149 | 2225789004 | 2227219677 | 2227651699 | 237 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01351 | RNase_HII | Ribonuclease HII | 17 | 187 | 0.89 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01351 | GO:0004523 | RNA-DNA hybrid ribonuclease activity | MF |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.85 | 0.88 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.