Protein Family IF01246

Metagenome Isolate
149 Members
99 Samples
93 Scaffolds
209 Avg Length

🧬 Representative Sequence

ID
3300005200|Ga0072940_1084673|Ga0072940_10846731
Length
247 aa
Sequence
MPAAGITIATPTLAVASLGHSAGQSDRALHGPSAPQAADLKSEGQGFGLTDSIYNRLLKERIIWLGSEVRDDNANAICAQMMLLAAEDPDKDIWLYINSPGGSITAGMAIYDTMQYIQPDVATVAMGMAASMGQFLLSSGAKGKRYATPHTRVLMHQPSGGFGGTATDVRINAQLIMHMKQTLAQLTAEQTGQPLERILKDNDRDHWFTAPEALEYGFIDHVVEKAALAGGGGMSAGTPDAEAADK*

📊 Sample Types

Isolate 37.6%
Metagenome 62.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 27.1%
Termitidae 15.6%
Formicidae 14.6%
Kalotermitidae 11.5%
Tenebrionidae 6.2%
Cambaridae 5.2%
Scarabaeidae 3.1%
Culicidae 3.1%
Armadillidiidae 3.1%
Hydrophilidae 2.1%
Rhinotermitidae 1.0%
Thomisidae 1.0%
Hodotermitidae 1.0%
Pentatomidae 1.0%
Pyralidae 1.0%
Reduviidae 1.0%
Cerambycidae 1.0%
Curculionidae 1.0%

🌳 Taxonomy

Archaea 0
Bacteria 138
Eukaryota 0
Viruses 0
Unclassified 11

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2675903497 Pseudonocardia sp. EC080610-09 Isolate Formicidae
2 2681812870 Oerskovia enterophila DFA-19 Isolate Unclassified
3 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
4 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
5 2820909719 Unclassified Actinobacteria Emb289P4bin20 Isolate Unclassified
6 2848356102 Xylanimonas allomyrinae 2JSPR-7 Isolate Scarabaeidae
7 2856966858 Pseudonocardia sp. Ae263_Ps1 Isolate Formicidae
8 2910090113 Kocuria sp. cx-116 Isolate Cambaridae
9 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
10 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
11 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
12 2504756063 Isoptericola variabilis J5 Isolate Unclassified
13 2630969010 Friedmanniella luteola DSM 21741 Isolate Thomisidae
14 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
15 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
16 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
17 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
18 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
19 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
20 8109397740 Rhodococcus triatomae DSM 44892 Isolate Unclassified
21 2734481968 Xylanimicrobium pachnodae JCM 13526, NBRC 107786 Isolate Scarabaeidae
22 2820935937 Unclassified Actinobacteria Emb289P1bin40 Isolate Unclassified
23 2820944107 Unclassified Actinobacteria Cu122P5bin14 Isolate Unclassified
24 2856882415 Pseudonocardia sp. Ae406_Ps2 Isolate Formicidae
25 2859977607 Pseudonocardia sp. Ae707_Ps1 Isolate Formicidae
26 2873589062 Phycicoccus sp. HDW14 Isolate Hydrophilidae
27 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
28 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
29 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
30 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
31 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
32 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
33 2818991478 Micromonospora palomenae DSM 102131 Isolate Pentatomidae
34 8062747827 Yimella sp. cx-51 Isolate Cambaridae
35 2820867525 Unclassified Actinobacteria Lab288P3bin128 Isolate Unclassified
36 2856954254 Pseudonocardia sp. Ae505_Ps2 Isolate Formicidae
37 2884351759 Cellulosimicrobium sp. BI34T Isolate Pyralidae
38 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
39 3300012806 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG Metagenome
40 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
41 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
42 2547132042 Pseudonocardia sp. P2 Isolate Formicidae
43 2718217924 Pseudonocardia sp. HH130630-07 Isolate Formicidae
44 2772190761 Rhodococcus rhodnii NRRL B-16535 Isolate Unclassified
45 2820803007 Unclassified Actinobacteria Th196P3bin61 Isolate Unclassified
46 2820838073 Unclassified Actinobacteria Lab288P4bin27 Isolate Unclassified
47 2820842553 Unclassified Actinobacteria Lab288P4bin104 Isolate Unclassified
48 2820929059 Unclassified Actinobacteria Emb289P3bin110 Isolate Unclassified
49 2821314491 Unclassified Actinobacteria Lab288P4bin49 Isolate Unclassified
50 2856960404 Pseudonocardia sp. Ae706_Ps2 Isolate Formicidae
51 2856973192 Pseudonocardia sp. Ae331_Ps2 Isolate Formicidae
52 2859970369 Pseudonocardia sp. Ae717_Ps2 Isolate Formicidae
53 2863397684 Micromonospora polyrhachis DSM 45886 (Annotation) (version 2) Isolate Unclassified
54 2909412500 Yimella sp. cx-573 Isolate Cambaridae
55 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
56 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
57 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
58 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
59 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
60 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
61 2545824723 Rhodococcus rhodnii LMG 5362 Isolate Reduviidae
62 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
63 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
64 8012935351 Brevibacterium epidermidis UD i117 Isolate Unclassified
65 8067071256 Microbispora camponoti 2C-HV3 Isolate Formicidae
66 2820825283 Unclassified Actinobacteria Nt197P3bin111 Isolate Unclassified
67 2820911766 Unclassified Actinobacteria Emb289P3bin96 Isolate Unclassified
68 2883361506 Luteimicrobium xylanilyticum HY-24 Isolate Cerambycidae
69 2909881144 Kocuria sp. cx-455 Isolate Cambaridae
70 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
71 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
72 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
73 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
74 8069511479 Arthrobacter ipsi IA7 Isolate Curculionidae
75 2820897376 Unclassified Actinobacteria Lab288P1bin101 Isolate Unclassified
76 2856671350 Pseudonocardia sp. Ae356_Ps1 Isolate Formicidae
77 2856947901 Pseudonocardia sp. Ae168_Ps1 Isolate Formicidae
78 2918390780 Glutamicibacter protophormiae DSM 20168 Isolate Unclassified
79 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
80 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
81 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
82 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
83 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
84 2505679068 Isoptericola variabilis 225 Isolate Unclassified
85 2671180625 Pseudonocardia sp. EC080619-01 Isolate Formicidae
86 2675903013 Rhodococcus triatomae DSM 44892 Isolate Unclassified
87 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
88 8062637095 Yimella sp. cx-51 Isolate Cambaridae
89 2820849606 Unclassified Actinobacteria Lab288P3bin39 Isolate Unclassified
90 2820926697 Unclassified Actinobacteria Emb289P3bin125 Isolate Unclassified
91 2873586004 Sanguibacter sp. HDW7 Isolate Hydrophilidae
92 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
93 3300012818 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG Metagenome
94 2731957681 Xylanimicrobium pachnodae JCM 13526, NBRC 107786 Isolate Scarabaeidae
95 2852016966 Micromonospora polyrhachis DSM 45886 Isolate Unclassified
96 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
97 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
98 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
99 3300012815 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG Metagenome

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_385115 3300042612 Bacteria 7034
2 Ga0562376_1511 3300056857 Bacteria 32176
3 Ga0466708_047907 3300042652 Bacteria 31421
4 Ga0466706_131529 3300042599 Bacteria 7890
5 Ga0466718_163680 3300042617 Bacteria 7561
6 Ga0466723_339538 3300042618 Bacteria 5646
7 Ga0466728_183862 3300042620 Bacteria 1195
8 Ga0466691_064500 3300042593 Bacteria 4494
9 Ga0123356_10001422 3300010049 Bacteria 26473
10 Ga0160442_100013 3300012806 Bacteria 424413
11 JGI24703J35330_11716197 3300002501 Bacteria 2279
12 Ga0562379_0375 3300056790 Bacteria 102463
13 Ga0562378_0214 3300056814 Unclassified 138321
14 Ga0562377_0297 3300056842 Bacteria 104094
15 Ga0562375_0028 3300056856 Bacteria 708255
16 Ga0562376_3438 3300056857 Bacteria 15883
17 Ga0466703_238548 3300042636 Bacteria 10421
18 Ga0466704_122764 3300042643 Bacteria 12234
19 Ga0466723_060842 3300042618 Bacteria 35094
20 Ga0466723_280997 3300042618 Bacteria 1612
21 Ga0466696_147952 3300042596 Bacteria 3170
22 Ga0123357_10027130 3300009784 Unclassified 7738
23 Ga0123354_10034665 3300010882 Unclassified 7890
24 Ga0072940_1084672 3300005200 Unclassified 1910
25 Ga0466705_352135 3300042612 Bacteria 6315
26 Ga0562376_0113 3300056857 Bacteria 183281
27 Ga0466708_174391 3300042652 Bacteria 8893
28 Ga0466725_419199 3300042654 Bacteria 2059
29 Ga0160472_100012 3300012839 Bacteria 433895
30 Ga0466693_204487 3300042592 Bacteria 8581
31 Ga0123357_10072688 3300009784 Bacteria 4557
32 Ga0123356_10028990 3300010049 Unclassified 5186
33 Ga0123356_10031881 3300010049 Bacteria 4932
34 Ga0123353_10000728 3300010167 Bacteria 40136
35 JGI24699J35502_11134059 3300002509 Bacteria 27570
36 Ga0562375_0307 3300056856 Bacteria 120979
37 Ga0466719_382230 3300042606 Bacteria 59148
38 Ga0466715_343342 3300042616 Bacteria 53918
39 Ga0160432_100186 3300012818 Bacteria 54846
40 Ga0466657_132024 3300042582 Bacteria 1047
41 Ga0466691_143852 3300042593 Bacteria 13971
42 Ga0123356_10006222 3300010049 Bacteria 12065
43 Ga0562379_0008 3300056790 Bacteria 1928858
44 Ga0562375_0051 3300056856 Bacteria 467539
45 Ga0562375_0295 3300056856 Bacteria 125606
46 Ga0562375_2072 3300056856 Bacteria 23773
47 Ga0562376_0027 3300056857 Bacteria 397453
48 Ga0466707_151207 3300042601 Bacteria 1466
49 Ga0466713_058497 3300042602 Bacteria 3432
50 Ga0160432_101830 3300012818 Bacteria 5723
51 Ga0466696_479568 3300042596 Bacteria 2899
52 Ga0123355_10863173 3300009826 Bacteria 993
53 Ga0123356_10039931 3300010049 Unclassified 4372
54 Ga0123356_10252583 3300010049 Bacteria 1842
55 Ga0072940_1077265 3300005200 Bacteria 7399
56 Ga0466705_031846 3300042612 Bacteria 3564
57 Ga0562375_0373 3300056856 Unclassified 100787
58 Ga0562376_0789 3300056857 Bacteria 51414
59 Ga0466703_072346 3300042636 Bacteria 156211
60 Ga0466707_309978 3300042601 Bacteria 16368
61 Ga0466713_033429 3300042602 Bacteria 27281
62 Ga0466723_288161 3300042618 Bacteria 7198
63 Ga0466723_305617 3300042618 Bacteria 3267
64 Ga0466728_167944 3300042620 Bacteria 1171
65 Ga0160468_111974 3300012819 Bacteria 819
66 Ga0160443_100252 3300012848 Bacteria 56331
67 Ga0160447_102912 3300012849 Bacteria 5743
68 Ga0123353_10176856 3300010167 Bacteria 3383
69 Ga0123354_10118876 3300010882 Bacteria 3428
70 Ga0072940_1084673 3300005200 Bacteria 878
71 Ga0562375_0006 3300056856 Bacteria 2261894
72 Ga0562376_3773 3300056857 Unclassified 14441
73 Ga0466734_123697 3300042623 Bacteria 1119
74 Ga0466730_073912 3300042625 Bacteria 1002
75 Ga0466719_008939 3300042606 Bacteria 3150
76 Ga0466715_505065 3300042616 Bacteria 2541
77 Ga0466723_242381 3300042618 Bacteria 71488
78 Ga0466729_020127 3300042621 Bacteria 2131
79 Ga0160457_1000017 3300012858 Bacteria 384973
80 Ga0123357_10008561 3300009784 Unclassified 12798
81 AustNasuHG_c1000081 3300000089 Bacteria 27217
82 Ga0530661_037199 3300056564 Unclassified 1412
83 Ga0562377_3061 3300056842 Unclassified 9897
84 Ga0562375_1461 3300056856 Bacteria 31736
85 Ga0466716_082489 3300042605 Bacteria 33521
86 Ga0466715_597961 3300042616 Bacteria 2437
87 Ga0466723_133512 3300042618 Bacteria 8021
88 Ga0160440_103196 3300012815 Bacteria 1611
89 Ga0160434_100040 3300012850 Bacteria 105246
90 Ga0466696_079004 3300042596 Bacteria 4186
91 Ga0123356_10000416 3300010049 Bacteria 48609
92 Ga0123354_10220302 3300010882 Bacteria 2019
93 JGI24699J35502_11126284 3300002509 Bacteria 3936

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300010049 Ga0123356_10006222 Ga0123356_100062225 198
2 3300042596 Ga0466696_479568 Ga0466696_479568_826_1422 198
3 3300042636 Ga0466703_238548 Ga0466703_238548_1410_2006 198
4 3300042652 Ga0466708_047907 Ga0466708_047907_3233_3829 198
5 3300056564 Ga0530661_037199 Ga0530661_037199_173_769 198
6 3300056842 Ga0562377_3061 Ga0562377_3061_5104_5700 198
7 3300056857 Ga0562376_3438 Ga0562376_3438_795_1391 198
8 3300010049 Ga0123356_10039931 Ga0123356_100399311 199
9 3300012848 Ga0160443_100252 Ga0160443_10025227 199
10 3300042605 Ga0466716_082489 Ga0466716_082489_21887_22486 199
11 3300042623 Ga0466734_123697 Ga0466734_123697_320_919 199
12 3300012819 Ga0160468_111974 Ga0160468_1119742 200
13 iso_pr_bacteria 2772190761 2772887512 200
14 iso_pr_bacteria 2820897376 2820898391 200
15 iso_pr_bacteria 8067071256 8067078050 200
16 3300042620 Ga0466728_183862 Ga0466728_183862_531_1136 201
17 3300009784 Ga0123357_10072688 Ga0123357_100726884 202
18 3300042582 Ga0466657_132024 Ga0466657_132024_364_1017 202
19 3300042596 Ga0466696_079004 Ga0466696_079004_1870_2577 202
20 3300042599 Ga0466706_131529 Ga0466706_131529_4170_4778 202
21 3300010167 Ga0123353_10176856 Ga0123353_101768562 203
22 3300042593 Ga0466691_143852 Ga0466691_143852_2643_3254 203
23 3300042621 Ga0466729_020127 Ga0466729_020127_1217_1828 203
24 3300042654 Ga0466725_419199 Ga0466725_419199_944_1555 203
25 3300056814 Ga0562378_0214 Ga0562378_0214_29880_30491 203
26 3300056856 Ga0562375_0028 Ga0562375_0028_416764_417375 203
27 3300056856 Ga0562375_0051 Ga0562375_0051_116552_117163 203
28 3300056857 Ga0562376_0027 Ga0562376_0027_38614_39225 203
29 3300056857 Ga0562376_1511 Ga0562376_1511_794_1405 203
30 3300056857 Ga0562376_3773 Ga0562376_3773_4363_4974 203
31 iso_pr_bacteria 2852016966 2852017578 203
32 iso_pr_bacteria 2863397684 2863398296 203
33 iso_pr_bacteria 8012935351 8012937484 203
34 3300010049 Ga0123356_10001422 Ga0123356_100014228 204
35 3300012858 Ga0160457_1000017 Ga0160457_1000017187 204
36 3300042602 Ga0466713_058497 Ga0466713_058497_1666_2280 204
37 3300042618 Ga0466723_060842 Ga0466723_060842_27639_28253 204
38 3300056790 Ga0562379_0008 Ga0562379_0008_572233_572847 204
39 3300056790 Ga0562379_0375 Ga0562379_0375_29690_30304 204
40 3300056856 Ga0562375_0307 Ga0562375_0307_76089_76703 204
41 3300056856 Ga0562375_0373 Ga0562375_0373_37653_38267 204
42 3300056856 Ga0562375_1461 Ga0562375_1461_25138_25752 204
43 3300009826 Ga0123355_10863173 Ga0123355_108631731 205
44 3300012839 Ga0160472_100012 Ga0160472_100012161 205
45 3300042593 Ga0466691_064500 Ga0466691_064500_2328_2945 205
46 3300042602 Ga0466713_033429 Ga0466713_033429_19837_20454 205
47 3300042618 Ga0466723_242381 Ga0466723_242381_5767_6384 205
48 3300042618 Ga0466723_339538 Ga0466723_339538_4386_5003 205
49 3300042620 Ga0466728_167944 Ga0466728_167944_256_873 205
50 3300056856 Ga0562375_0295 Ga0562375_0295_121240_121857 205
51 iso_pr_bacteria 2734481968 2734843519 205
52 iso_pr_bacteria 2820838073 2820839533 205
53 iso_pr_bacteria 2820909719 2820911077 205
54 iso_pr_bacteria 2821314491 2821315694 205
55 iso_pr_bacteria 2909412500 2909413250 205
56 iso_pr_bacteria 8062637095 8062639123 205
57 iso_pr_bacteria 8062747827 8062749701 205
58 3300009784 Ga0123357_10008561 Ga0123357_100085619 206
59 3300009784 Ga0123357_10027130 Ga0123357_100271305 206
60 3300010049 Ga0123356_10000416 Ga0123356_1000041637 206
61 3300010882 Ga0123354_10034665 Ga0123354_100346656 206
62 3300010882 Ga0123354_10118876 Ga0123354_101188763 206
63 3300010882 Ga0123354_10220302 Ga0123354_102203023 206
64 3300012806 Ga0160442_100013 Ga0160442_100013123 206
65 3300012818 Ga0160432_101830 Ga0160432_1018304 206
66 3300012849 Ga0160447_102912 Ga0160447_1029125 206
67 3300042601 Ga0466707_309978 Ga0466707_309978_4733_5353 206
68 3300042612 Ga0466705_352135 Ga0466705_352135_1998_2618 206
69 3300042618 Ga0466723_133512 Ga0466723_133512_3650_4270 206
70 3300042618 Ga0466723_288161 Ga0466723_288161_4150_4770 206
71 3300056856 Ga0562375_2072 Ga0562375_2072_21658_22278 206
72 3300056857 Ga0562376_0113 Ga0562376_0113_176278_176898 206
73 iso_pr_bacteria 2681812870 2682012299 206
74 iso_pr_bacteria 2820935937 2820936010 206
75 iso_pr_bacteria 2873586004 2873587167 206
76 iso_pr_bacteria 2918390780 2918393828 206
77 3300042617 Ga0466718_163680 Ga0466718_163680_4415_5038 207
78 3300042612 Ga0466705_385115 Ga0466705_385115_4753_5379 208
79 3300042625 Ga0466730_073912 Ga0466730_073912_337_963 208
80 iso_pr_bacteria 2873589062 2873591087 208
81 3300005200 Ga0072940_1077265 Ga0072940_10772652 209
82 3300042616 Ga0466715_505065 Ga0466715_505065_144_773 209
83 3300042618 Ga0466723_305617 Ga0466723_305617_2081_2710 209
84 3300010049 Ga0123356_10031881 Ga0123356_100318812 210
85 3300042618 Ga0466723_280997 Ga0466723_280997_794_1426 210
86 3300042636 Ga0466703_072346 Ga0466703_072346_118100_118732 210
87 iso_pr_bacteria 2820911766 2820912143 210
88 iso_pr_bacteria 2820926697 2820928414 210
89 iso_pr_bacteria 2820944107 2820944150 210
90 3300002509 JGI24699J35502_11134059 JGI24699J35502_111340596 211
91 3300042606 Ga0466719_008939 Ga0466719_008939_924_1559 211
92 3300000089 AustNasuHG_c1000081 AustNasuHG_100008116 212
93 3300042601 Ga0466707_151207 Ga0466707_151207_459_1097 212
94 3300042606 Ga0466719_382230 Ga0466719_382230_11584_12222 212
95 3300042616 Ga0466715_597961 Ga0466715_597961_164_802 212
96 3300042643 Ga0466704_122764 Ga0466704_122764_10098_10736 212
97 3300042652 Ga0466708_174391 Ga0466708_174391_6398_7036 212
98 iso_pr_bacteria 2504756063 2504977946 212
99 iso_pr_bacteria 2505679068 2505952207 212
100 iso_pr_bacteria 2731957681 2732701651 212
101 iso_pr_bacteria 2675903013 2676272840 213
102 iso_pr_bacteria 2818991478 2819788256 213
103 iso_pr_bacteria 2852016966 2852021329 213
104 iso_pr_bacteria 2863397684 2863402047 213
105 iso_pr_bacteria 2884351759 2884354627 213
106 iso_pr_bacteria 8069511479 8069511903 213
107 iso_pr_bacteria 8109397740 8109398131 213
108 3300056857 Ga0562376_0789 Ga0562376_0789_9861_10505 214
109 iso_pr_bacteria 2820825283 2820826816 214
110 iso_pr_bacteria 2848356102 2848356494 214
111 3300002501 JGI24703J35330_11716197 JGI24703J35330_117161973 215
112 3300056856 Ga0562375_0006 Ga0562375_0006_1072672_1073319 215
113 iso_pr_bacteria 2547132042 2547181105 215
114 iso_pr_bacteria 2671180625 2673535707 215
115 iso_pr_bacteria 2675903497 2678198265 215
116 iso_pr_bacteria 2718217924 2719369488 215
117 iso_pr_bacteria 2820842553 2820842853 215
118 iso_pr_bacteria 2820849606 2820850450 215
119 iso_pr_bacteria 2820867525 2820869702 215
120 iso_pr_bacteria 2820929059 2820930563 215
121 iso_pr_bacteria 2856671350 2856674614 215
122 iso_pr_bacteria 2856882415 2856887962 215
123 iso_pr_bacteria 2856947901 2856949594 215
124 iso_pr_bacteria 2856954254 2856959393 215
125 iso_pr_bacteria 2856960404 2856965954 215
126 iso_pr_bacteria 2856966858 2856970458 215
127 iso_pr_bacteria 2856973192 2856973441 215
128 iso_pr_bacteria 2859970369 2859971754 215
129 iso_pr_bacteria 2859977607 2859981791 215
130 3300002509 JGI24699J35502_11126284 JGI24699J35502_111262843 216
131 3300010167 Ga0123353_10000728 Ga0123353_100007286 216
132 3300012850 Ga0160434_100040 Ga0160434_1000403 216
133 iso_pr_bacteria 2820803007 2820803527 216
134 iso_pr_bacteria 2883361506 2883362834 216
135 3300042596 Ga0466696_147952 Ga0466696_147952_2400_3053 217
136 iso_pr_bacteria 2909881144 2909882488 217
137 iso_pr_bacteria 2910090113 2910090455 217
138 3300012815 Ga0160440_103196 Ga0160440_1031962 219
139 3300012818 Ga0160432_100186 Ga0160432_1001868 219
140 iso_pr_bacteria 2545824723 2546570088 219
141 3300010049 Ga0123356_10028990 Ga0123356_100289903 221
142 3300010049 Ga0123356_10252583 Ga0123356_102525832 221
143 3300042592 Ga0466693_204487 Ga0466693_204487_294_959 221
144 3300042616 Ga0466715_343342 Ga0466715_343342_25604_26353 221
145 3300056842 Ga0562377_0297 Ga0562377_0297_37023_37688 221
146 iso_pr_bacteria 2630969010 2634125567 222
147 3300042612 Ga0466705_031846 Ga0466705_031846_172_843 223
148 3300005200 Ga0072940_1084672 Ga0072940_10846722 235
149 3300005200 Ga0072940_1084673 Ga0072940_10846731 247

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00574 CLP_protease Clp protease 51 225 0.99

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.73 0.87 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.