Protein Family IF01234

Metagenome Isolate
269 Members
156 Samples
171 Scaffolds
557.49 Avg Length

🧬 Representative Sequence

ID
3300005200|Ga0072940_1021602|Ga0072940_10216028
Length
615 aa
Sequence
VAEFIYQMYKARKAHGDKVILDDVSLNFLPGAKIGVVGPNGAGKSTILKIMAGLDKPSNGEARLAPGYSVGILQQEPPLNEDKTVLGNIEEAVADIKAKLNRYNEISELMADPDADFDALLAEMGELQEEIDAADAWELDSQLEQAMDALRCPPSDMPVSVLSGGERRRVALCKLLLEKPDLLLLDEPTNHLDAESVQWLEQHLANYPGAILAVTHDRYFLDHVAEWICEVDRGRLYPYEGNYTTYLEKKQERLQVQGKKDAKLAKRLKDELEWVRSNAKGRQAKSKARLQRYEEMANEAERTRKLDFEEIQIPNGPRLGNVVLEAKNLEKGFDDRTLIDGLSFTLPKNGIVGVIGPNGVGKTTLFKSIVGLEELDGGELKIGDTVKISYVDQGRGGIDPKKTLWEVVSDGLDFIKVGNQEIPSRAYVASFGFKGPDQQKPAGVLSGGERNRLNLALTLKQGGNLLLLDEPTNDLDVETLGSLENALLEFPGCAVVVSHDRWFLDRVATHILAYEGNDDDPANWYWFEGNFAAYEENXXRPLVPGPGGHAHPCLRGQRRRSGQLVLVRGQLRRLRGKQPSHIPQADQGLGPSVECGEAVYRDHGHRKWPDPALR*

📊 Sample Types

Isolate 36.4%
Metagenome 63.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 37.2%
Termitidae 18.2%
Kalotermitidae 8.8%
Formicidae 6.1%
Apidae 5.4%
Culicidae 3.4%
Elmidae 2.7%
Scarabaeidae 2.7%
Tenebrionidae 2.7%
Dytiscidae 2.0%
Hydrophilidae 1.4%
Cambaridae 1.4%
Rhinotermitidae 1.4%
Termopsidae 1.4%
Thomisidae 0.7%
Hodotermitidae 0.7%
Pentatomidae 0.7%
Pyralidae 0.7%
Siricidae 0.7%
Cerambycidae 0.7%
Chironomidae 0.7%
Curculionidae 0.7%

🌳 Taxonomy

Archaea 0
Bacteria 250
Eukaryota 0
Viruses 0
Unclassified 19

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2505679068 Isoptericola variabilis 225 Isolate Unclassified
2 2671180625 Pseudonocardia sp. EC080619-01 Isolate Formicidae
3 2820171952 Unclassified Planctomycetes Th196P3bin88 Isolate Unclassified
4 2820807258 Unclassified Actinobacteria Nt197P3bin90 Isolate Unclassified
5 2820818506 Unclassified Actinobacteria Nt197P3bin3 Isolate Unclassified
6 2820849606 Unclassified Actinobacteria Lab288P3bin39 Isolate Unclassified
7 2820889385 Unclassified Actinobacteria Lab288P1bin133 Isolate Unclassified
8 2820922474 Unclassified Actinobacteria Emb289P3bin154 Isolate Unclassified
9 2820926697 Unclassified Actinobacteria Emb289P3bin125 Isolate Unclassified
10 2865982043 Bifidobacterium aemilianum XV10 Isolate Apidae
11 2873586004 Sanguibacter sp. HDW7 Isolate Hydrophilidae
12 2915166107 Leucobacter sp. cx-87 Isolate Cambaridae
13 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
14 8077775691 Tsukamurella sp. PLM1 Isolate Formicidae
15 8077783556 Streptomyces sp. PLM4 Isolate Formicidae
16 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
17 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
18 3300012818 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG Metagenome
19 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
20 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
21 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
22 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
23 2515154106 Streptomyces sp. FxanaD5 Isolate Unclassified
24 2808606957 Bifidobacterium sp. ESL0447 Isolate Unclassified
25 2820166269 Unclassified Proteobacteria Co191P4bin16 Isolate Unclassified
26 2820185449 Unclassified Planctomycetes Lab288P3bin146 Isolate Unclassified
27 2820217359 Unclassified Kiritimatiellaeota Nt197P3bin101 Isolate Unclassified
28 2820803007 Unclassified Actinobacteria Th196P3bin61 Isolate Unclassified
29 2820838073 Unclassified Actinobacteria Lab288P4bin27 Isolate Unclassified
30 2820842553 Unclassified Actinobacteria Lab288P4bin104 Isolate Unclassified
31 2821314491 Unclassified Actinobacteria Lab288P4bin49 Isolate Unclassified
32 2862784999 Streptomyces sp. M41 Isolate Unclassified
33 2864773010 Tsukamurella ocularis S00022 Isolate Elmidae
34 2931425734 Nocardioides sp. J2M5 Isolate
35 2931430189 Tessaracoccus palaemonis J1M15 Isolate
36 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
37 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
38 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
39 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
40 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
41 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
42 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
43 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
44 2504756063 Isoptericola variabilis J5 Isolate Unclassified
45 2630969010 Friedmanniella luteola DSM 21741 Isolate Thomisidae
46 2648501322 Streptomyces sp. SA3_actF Isolate Unclassified
47 2820170025 Unclassified Proteobacteria Co191P1bin43 Isolate Unclassified
48 2820205024 Unclassified Planctomycetes Cu122P4bin3 Isolate Unclassified
49 2820814774 Unclassified Actinobacteria Nt197P3bin39 Isolate Unclassified
50 2820816657 Unclassified Actinobacteria Nt197P3bin38 Isolate Unclassified
51 2820901319 Unclassified Actinobacteria Emb289P4bin58 Isolate Unclassified
52 2864964650 Tsukamurella ocularis S00236 Isolate Elmidae
53 2873558832 Propioniciclava coleopterorum HDW11 Isolate Hydrophilidae
54 2884613238 Agromyces intestinalis KACC 19306 Isolate Scarabaeidae
55 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
56 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
57 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
58 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
59 8046957834 Streptomyces coacervatus JCM 17138 Isolate Unclassified
60 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
61 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
62 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
63 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
64 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
65 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
66 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
67 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
68 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
69 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
70 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
71 2818991478 Micromonospora palomenae DSM 102131 Isolate Pentatomidae
72 2820178484 Unclassified Planctomycetes Th196P3bin110 Isolate Unclassified
73 2820809073 Unclassified Actinobacteria Nt197P3bin55 Isolate Unclassified
74 2820903739 Unclassified Actinobacteria Emb289P4bin49 Isolate Unclassified
75 2820931684 Unclassified Actinobacteria Emb289P1bin89 Isolate Unclassified
76 2841168549 Agromyces protaetiae FW100M-8 Isolate Scarabaeidae
77 2864918810 Tsukamurella ocularis S00175 Isolate Elmidae
78 2873614151 Leucobacter viscericola HDW9C Isolate Dytiscidae
79 2879643867 Bifidobacterium sp. wkB344 Isolate Apidae
80 2884351759 Cellulosimicrobium sp. BI34T Isolate Pyralidae
81 2912749649 Streptomyces sp. GS7 Isolate Termitidae
82 3006461590 Streptomyces sp. RB5 Isolate Termitidae
83 3006667155 Streptomyces sp. SID9727 Isolate
84 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
85 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
86 2523533511 Streptomyces sp. Sv. ACTE SirexAA-E Isolate Siricidae
87 2568526170 Bifidobacterium sp. A11 Isolate Apidae
88 2731957681 Xylanimicrobium pachnodae JCM 13526, NBRC 107786 Isolate Scarabaeidae
89 2818991320 Klugiella xanthotipulae DSM 18031 Isolate Unclassified
90 2820134530 Unclassified Proteobacteria Emb289P3bin65 Isolate Unclassified
91 2820834831 Unclassified Actinobacteria Lab288P4bin79 Isolate Unclassified
92 2820840446 Unclassified Actinobacteria Lab288P4bin17 Isolate Unclassified
93 2820863028 Unclassified Actinobacteria Lab288P3bin164 Isolate Unclassified
94 2873617540 Leucobacter insecticola HDW9B Isolate Dytiscidae
95 2915168811 Leucobacter sp. cx-169 Isolate Cambaridae
96 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
97 8024986378 Bifidobacterium asteroides ESL0198 Isolate Apidae
98 8032009961 Bifidobacterium indicum ESL0197 Isolate Apidae
99 3002678670 Agromyces sp. G127AT Isolate Unclassified
100 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
101 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
102 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
103 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
104 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
105 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
106 2684622918 Bifidobacterium asteroides Bi_198 Isolate Unclassified
107 2820168331 Unclassified Proteobacteria Co191P3bin57 Isolate Unclassified
108 2820201435 Unclassified Planctomycetes Cu122P5bin25 Isolate Unclassified
109 2820820509 Unclassified Actinobacteria Nt197P3bin23 Isolate Unclassified
110 2864899338 Mycobacteroides chelonae S00154 Isolate Elmidae
111 2873196663 Streptomyces capitiformicae 1H-SSA4 Isolate Formicidae
112 2908241010 Streptomyces sp. HF10 Isolate Termitidae
113 2912817845 Streptomyces griseus SID164 Isolate
114 8024981139 Bifidobacterium asteroides ESL0170 Isolate Apidae
115 8030347546 Propionimicrobium sp. PCR01-08-3 Isolate Tenebrionidae
116 3006468911 Streptomyces sp. RB17 Isolate Termitidae
117 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
118 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
119 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
120 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
121 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
122 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
123 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
124 2684622916 Bifidobacterium asteroides Bi_170 Isolate Unclassified
125 2684622917 Bifidobacterium coryneforme Bi_197 Isolate Unclassified
126 2820825283 Unclassified Actinobacteria Nt197P3bin111 Isolate Unclassified
127 2820829137 Unclassified Actinobacteria Nc150P5bin2 Isolate Unclassified
128 2820911766 Unclassified Actinobacteria Emb289P3bin96 Isolate Unclassified
129 2873620646 Leucobacter coleopterorum HDW9A Isolate Dytiscidae
130 2883361506 Luteimicrobium xylanilyticum HY-24 Isolate Cerambycidae
131 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
132 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
133 3300007733 Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean Metagenome
134 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
135 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
136 8110340172 Bifidobacterium choladohabitans B14384H11 Isolate Apidae
137 2515154100 Streptomyces sp. MspMP-M5 Isolate Unclassified
138 2515154104 Streptomyces sp. KhCrAH-244 Isolate Unclassified
139 2524023214 Leucobacter chironomi DSM 19883 Isolate Chironomidae
140 2597490239 Bifidobacterium bohemicum DSM 22767 Isolate Unclassified
141 2675903497 Pseudonocardia sp. EC080610-09 Isolate Formicidae
142 2681812870 Oerskovia enterophila DFA-19 Isolate Unclassified
143 2820909719 Unclassified Actinobacteria Emb289P4bin20 Isolate Unclassified
144 2820914081 Unclassified Actinobacteria Emb289P3bin87 Isolate Unclassified
145 2848356102 Xylanimonas allomyrinae 2JSPR-7 Isolate Scarabaeidae
146 2896955351 Streptomyces sp. GF20 Isolate Termitidae
147 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
148 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
149 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
150 647000328 Streptomyces sp. ACT-1 XylebKG-1 Isolate Curculionidae
151 8053361298 Streptomyces formicae 1H-GS9 Isolate Unclassified
152 8067987626 Agromyces larvae CFWR-12 Isolate Unclassified
153 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
154 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
155 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
156 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_189122 3300042659 Bacteria 1898
2 Ga0466705_414663 3300042612 Bacteria 7732
3 Ga0466726_232342 3300042619 Bacteria 3322
4 Ga0160447_103517 3300012849 Bacteria 4985
5 Ga0160436_1001137 3300012861 Unclassified 7673
6 Ga0466691_121716 3300042593 Bacteria 10232
7 Ga0466706_093255 3300042599 Bacteria 7264
8 Ga0466713_033429 3300042602 Bacteria 27281
9 Ga0123357_10028724 3300009784 Unclassified 7535
10 Ga0123356_10000188 3300010049 Bacteria 71322
11 Ga0123354_10040056 3300010882 Bacteria 7255
12 Ga0123354_10048603 3300010882 Unclassified 6448
13 JGI24699J35502_11133053 3300002509 Unclassified 8467
14 Ga0123357_10001080 3300009784 Bacteria 28141
15 Ga0466711_439053 3300042615 Bacteria 2614
16 Ga0466718_136609 3300042617 Bacteria 3217
17 Ga0466728_480695 3300042620 Bacteria 2397
18 Ga0466729_178702 3300042621 Bacteria 10154
19 Ga0466734_052706 3300042623 Bacteria 3087
20 Ga0466703_248905 3300042636 Bacteria 17853
21 Ga0466703_423520 3300042636 Bacteria 28320
22 Ga0160453_101807 3300012814 Unclassified 6371
23 Ga0466693_092506 3300042592 Bacteria 47251
24 Ga0466696_143954 3300042596 Bacteria 5263
25 Ga0466706_122685 3300042599 Bacteria 2761
26 Ga0466706_255861 3300042599 Bacteria 8801
27 Ga0466707_363247 3300042601 Bacteria 7909
28 Ga0466717_149943 3300042604 Bacteria 1835
29 Ga0466716_173207 3300042605 Bacteria 4546
30 Ga0123353_10001402 3300010167 Bacteria 29472
31 Ga0123353_10017885 3300010167 Bacteria 10451
32 Ga0123354_10003479 3300010882 Bacteria 21762
33 AustNasuHG_c1000578 3300000089 Unclassified 12918
34 JGI24699J35502_11132795 3300002509 Unclassified 7626
35 Ga0072940_1036642 3300005200 Unclassified 25494
36 Ga0123357_10000076 3300009784 Bacteria 78275
37 Ga0123357_10000114 3300009784 Bacteria 68176
38 Ga0562374_0002 3300057007 Bacteria 3515001
39 Ga0466715_246198 3300042616 Bacteria 81329
40 Ga0466723_228478 3300042618 Bacteria 2248
41 Ga0466726_201919 3300042619 Bacteria 13193
42 Ga0466703_024420 3300042636 Bacteria 26777
43 Ga0466703_203351 3300042636 Bacteria 31013
44 Ga0466703_258346 3300042636 Bacteria 13463
45 Ga0466704_174793 3300042643 Bacteria 3044
46 Ga0466657_340973 3300042582 Bacteria 12036
47 Ga0466696_191517 3300042596 Bacteria 3321
48 Ga0466707_269543 3300042601 Bacteria 52716
49 Ga0466714_100360 3300042603 Bacteria 4038
50 Ga0466719_107074 3300042606 Bacteria 8469
51 Ga0466719_240432 3300042606 Bacteria 56451
52 Ga0123355_10001198 3300009826 Bacteria 36081
53 Ga0123353_10002042 3300010167 Bacteria 24925
54 Ga0123353_10104054 3300010167 Bacteria 4575
55 Ga0123354_10003541 3300010882 Unclassified 21620
56 Ga0123354_10064681 3300010882 Unclassified 5361
57 HBC_ctgsDRAFT_1010445 3300000333 Bacteria 2211
58 Ga0072940_1021602 3300005200 Bacteria 9253
59 Ga0466733_208395 3300042659 Bacteria 8279
60 Ga0466715_353650 3300042616 Bacteria 17297
61 Ga0466723_014823 3300042618 Bacteria 5899
62 Ga0466723_081350 3300042618 Bacteria 6309
63 Ga0466723_085612 3300042618 Bacteria 17825
64 Ga0466723_196276 3300042618 Bacteria 9132
65 Ga0466728_116900 3300042620 Bacteria 5416
66 Ga0466708_010663 3300042652 Bacteria 26594
67 Ga0466727_131520 3300042655 Bacteria 26381
68 Ga0160436_1001706 3300012861 Bacteria 5877
69 Ga0466690_086514 3300042590 Unclassified 17975
70 Ga0466693_056620 3300042592 Bacteria 145249
71 Ga0466707_377241 3300042601 Bacteria 85191
72 Ga0466713_113029 3300042602 Bacteria 128375
73 Ga0466716_017139 3300042605 Bacteria 14533
74 Ga0466721_023958 3300042608 Bacteria 1910
75 Ga0123357_10012376 3300009784 Unclassified 11003
76 Ga0123356_10026884 3300010049 Bacteria 5396
77 Ga0123353_10000229 3300010167 Bacteria 70834
78 Ga0123353_10097843 3300010167 Bacteria 4729
79 Ga0123354_10052599 3300010882 Bacteria 6134
80 Ga0123354_10086000 3300010882 Unclassified 4399
81 JGI24699J35502_11130196 3300002509 Bacteria 4999
82 JGI24699J35502_11134065 3300002509 Bacteria 27982
83 JGI24699J35502_11134109 3300002509 Bacteria 31659
84 Ga0102735_1000005 3300007080 Bacteria 94864
85 Ga0105524_100943 3300007733 Bacteria 27578
86 Ga0123357_10000502 3300009784 Bacteria 38014
87 Ga0466705_090425 3300042612 Bacteria 6962
88 Ga0466711_315451 3300042615 Bacteria 16168
89 Ga0466715_523497 3300042616 Bacteria 15673
90 Ga0466718_022770 3300042617 Bacteria 9254
91 Ga0466729_251501 3300042621 Bacteria 2167
92 Ga0466730_027068 3300042625 Bacteria 2012
93 Ga0466703_281545 3300042636 Bacteria 3682
94 Ga0466704_133798 3300042643 Bacteria 12935
95 Ga0466696_439932 3300042596 Bacteria 16870
96 Ga0466706_231257 3300042599 Bacteria 218825
97 Ga0466700_285033 3300042600 Bacteria 2054
98 Ga0466707_043206 3300042601 Bacteria 70893
99 Ga0466707_258806 3300042601 Unclassified 4336
100 Ga0466713_011559 3300042602 Bacteria 56950
101 Ga0466713_033508 3300042602 Bacteria 20267
102 Ga0466713_075576 3300042602 Unclassified 7752
103 Ga0123357_10011546 3300009784 Unclassified 11337
104 Ga0123356_10214453 3300010049 Bacteria 1977
105 Ga0123353_10008165 3300010167 Bacteria 14261
106 JGI24705J35276_12227073 3300002504 Bacteria 2943
107 Ga0072941_1056215 3300005201 Bacteria 21887
108 Ga0103264_1000026 3300007188 Bacteria 92644
109 Ga0123357_10000690 3300009784 Bacteria 33822
110 Ga0466705_122858 3300042612 Unclassified 3410
111 Ga0466705_480185 3300042612 Bacteria 3388
112 Ga0466710_112767 3300042613 Bacteria 5962
113 Ga0466715_110461 3300042616 Bacteria 13418
114 Ga0466715_160448 3300042616 Bacteria 2214
115 Ga0466723_007010 3300042618 Bacteria 12985
116 Ga0466723_138051 3300042618 Bacteria 18367
117 Ga0466729_260758 3300042621 Bacteria 2754
118 Ga0466729_313346 3300042621 Bacteria 10696
119 Ga0466703_103691 3300042636 Bacteria 71973
120 Ga0466704_034783 3300042643 Bacteria 163660
121 Ga0466704_318234 3300042643 Bacteria 18704
122 Ga0466707_219605 3300042601 Bacteria 4679
123 Ga0466713_054427 3300042602 Bacteria 2706
124 Ga0123355_10227490 3300009826 Unclassified 2670
125 Ga0123353_10000096 3300010167 Bacteria 101248
126 Ga0123353_10001161 3300010167 Bacteria 32120
127 Ga0123353_10001324 3300010167 Bacteria 30368
128 Ga0123354_10008288 3300010882 Bacteria 15785
129 Ga0123354_10024943 3300010882 Bacteria 9428
130 Ga0160471_100012 3300012812 Bacteria 433895
131 Ga0072940_1033211 3300005200 Bacteria 14113
132 Ga0466733_187582 3300042659 Bacteria 87354
133 Ga0466715_173128 3300042616 Bacteria 4830
134 Ga0466723_068624 3300042618 Bacteria 10490
135 Ga0466728_044204 3300042620 Bacteria 6341
136 Ga0466729_248889 3300042621 Bacteria 4347
137 Ga0466730_036564 3300042625 Bacteria 22759
138 Ga0466703_389427 3300042636 Bacteria 3486
139 Ga0466703_429007 3300042636 Bacteria 26393
140 Ga0466727_004073 3300042655 Bacteria 8979
141 Ga0160434_100040 3300012850 Bacteria 105246
142 Ga0466692_103469 3300042591 Bacteria 7232
143 Ga0466696_201266 3300042596 Bacteria 11294
144 Ga0466700_027594 3300042600 Bacteria 3554
145 Ga0466713_031712 3300042602 Bacteria 12102
146 Ga0466716_089387 3300042605 Bacteria 13522
147 Ga0123357_10051893 3300009784 Bacteria 5541
148 Ga0123356_10041989 3300010049 Bacteria 4262
149 Ga0123353_10000822 3300010167 Bacteria 37789
150 Ga0103267_1000229 3300007190 Bacteria 22087
151 Ga0562377_2801 3300056842 Bacteria 11477
152 Ga0562376_0027 3300056857 Bacteria 397453
153 Ga0466711_314880 3300042615 Bacteria 8104
154 Ga0466715_308682 3300042616 Bacteria 3387
155 Ga0466718_035250 3300042617 Bacteria 5178
156 Ga0466704_011860 3300042643 Bacteria 5047
157 Ga0466704_415887 3300042643 Bacteria 115022
158 Ga0466708_195163 3300042652 Bacteria 7424
159 Ga0466727_318492 3300042655 Bacteria 10842
160 Ga0160432_100880 3300012818 Bacteria 13082
161 Ga0160448_103406 3300012854 Bacteria 4663
162 Ga0466690_030886 3300042590 Bacteria 6299
163 Ga0466691_027331 3300042593 Bacteria 9493
164 Ga0466706_276933 3300042599 Bacteria 9773
165 Ga0123357_10004619 3300009784 Unclassified 16244
166 Ga0123357_10007961 3300009784 Bacteria 13184
167 Ga0123356_10001701 3300010049 Bacteria 24084
168 Ga0123353_10000223 3300010167 Bacteria 72131
169 JGI24698J34947_10032448 3300002449 Bacteria 2742
170 JGI24702J35022_10025177 3300002462 Bacteria 3213
171 Ga0103268_1000164 3300007192 Bacteria 21882

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042590 Ga0466690_030886 Ga0466690_030886_4835_6274 463
2 3300042600 Ga0466700_285033 Ga0466700_285033_23_1462 479
3 3300042623 Ga0466734_052706 Ga0466734_052706_1018_2676 516
4 3300042596 Ga0466696_191517 Ga0466696_191517_1113_2786 517
5 3300042615 Ga0466711_439053 Ga0466711_439053_243_1922 523
6 3300007190 Ga0103267_1000229 Ga0103267_10002295 524
7 3300007192 Ga0103268_1000164 Ga0103268_10001645 524
8 3300042605 Ga0466716_089387 Ga0466716_089387_6449_8107 524
9 3300010049 Ga0123356_10214453 Ga0123356_102144531 534
10 3300042602 Ga0466713_011559 Ga0466713_011559_3704_5362 535
11 3300042612 Ga0466705_122858 Ga0466705_122858_433_2109 535
12 3300042621 Ga0466729_313346 Ga0466729_313346_6581_8236 535
13 3300042636 Ga0466703_389427 Ga0466703_389427_1354_3033 536
14 3300009784 Ga0123357_10028724 Ga0123357_100287243 537
15 3300042605 Ga0466716_017139 Ga0466716_017139_7753_9471 540
16 3300042618 Ga0466723_138051 Ga0466723_138051_9965_11650 540
17 3300042616 Ga0466715_110461 Ga0466715_110461_2152_3831 541
18 3300042620 Ga0466728_116900 Ga0466728_116900_17_1699 541
19 3300042636 Ga0466703_024420 Ga0466703_024420_14133_15812 541
20 3300042636 Ga0466703_203351 Ga0466703_203351_5611_7278 541
21 3300042652 Ga0466708_010663 Ga0466708_010663_4581_6260 543
22 3300042590 Ga0466690_086514 Ga0466690_086514_9661_11340 544
23 3300042618 Ga0466723_085612 Ga0466723_085612_11124_12785 544
24 3300042601 Ga0466707_258806 Ga0466707_258806_1881_3569 545
25 3300042603 Ga0466714_100360 Ga0466714_100360_2131_3804 546
26 3300010049 Ga0123356_10041989 Ga0123356_100419893 547
27 iso_pr_bacteria 2862784999 2862785778 547
28 3300009826 Ga0123355_10001198 Ga0123355_1000119811 548
29 3300042655 Ga0466727_131520 Ga0466727_131520_19467_21119 550
30 iso_pr_bacteria 2820931684 2820934325 550
31 3300009826 Ga0123355_10227490 Ga0123355_102274901 551
32 3300010167 Ga0123353_10017885 Ga0123353_100178853 551
33 3300042616 Ga0466715_523497 Ga0466715_523497_1932_3605 551
34 3300042617 Ga0466718_035250 Ga0466718_035250_2883_4538 551
35 3300042617 Ga0466718_136609 Ga0466718_136609_83_1762 551
36 3300042618 Ga0466723_081350 Ga0466723_081350_43_1722 552
37 3300002504 JGI24705J35276_12227073 JGI24705J35276_122270734 553
38 3300042593 Ga0466691_121716 Ga0466691_121716_6146_7807 553
39 3300042596 Ga0466696_439932 Ga0466696_439932_13097_14758 553
40 3300042601 Ga0466707_219605 Ga0466707_219605_1247_2908 553
41 3300042602 Ga0466713_033429 Ga0466713_033429_5869_7530 553
42 3300042602 Ga0466713_113029 Ga0466713_113029_110586_112247 553
43 3300042606 Ga0466719_240432 Ga0466719_240432_39664_41325 553
44 3300042612 Ga0466705_414663 Ga0466705_414663_1884_3545 553
45 3300042612 Ga0466705_480185 Ga0466705_480185_356_2017 553
46 3300042616 Ga0466715_246198 Ga0466715_246198_18480_20141 553
47 3300042618 Ga0466723_007010 Ga0466723_007010_2530_4191 553
48 3300042621 Ga0466729_248889 Ga0466729_248889_161_1822 553
49 3300042636 Ga0466703_248905 Ga0466703_248905_4557_6218 553
50 3300042636 Ga0466703_281545 Ga0466703_281545_823_2484 553
51 3300042636 Ga0466703_429007 Ga0466703_429007_12536_14197 553
52 3300042643 Ga0466704_318234 Ga0466704_318234_484_2145 553
53 3300009784 Ga0123357_10000690 Ga0123357_1000069024 554
54 3300010049 Ga0123356_10026884 Ga0123356_100268843 554
55 3300012814 Ga0160453_101807 Ga0160453_1018072 554
56 3300012850 Ga0160434_100040 Ga0160434_10004036 554
57 3300012854 Ga0160448_103406 Ga0160448_1034062 554
58 3300012861 Ga0160436_1001137 Ga0160436_10011372 554
59 3300042602 Ga0466713_033508 Ga0466713_033508_10035_11717 554
60 3300042625 Ga0466730_027068 Ga0466730_027068_286_1950 554
61 3300042625 Ga0466730_036564 Ga0466730_036564_21003_22667 554
62 3300056857 Ga0562376_0027 Ga0562376_0027_23941_25605 554
63 iso_pr_bacteria 2515154100 2515559836 554
64 iso_pr_bacteria 2515154104 2515584523 554
65 iso_pr_bacteria 2515154106 2515602236 554
66 iso_pr_bacteria 2523533511 2523589913 554
67 iso_pr_bacteria 2873196663 2873198490 554
68 iso_pr_bacteria 2896955351 2896957184 554
69 iso_pr_bacteria 2908241010 2908243606 554
70 iso_pr_bacteria 2912749649 2912750867 554
71 iso_pr_bacteria 2912817845 2912825121 554
72 iso_pr_bacteria 3006461590 3006465043 554
73 iso_pr_bacteria 3006468911 3006469301 554
74 iso_pr_bacteria 3006667155 3006672480 554
75 iso_pr_bacteria 647000328 647327522 554
76 iso_pr_bacteria 8053361298 8053367628 554
77 3300042599 Ga0466706_276933 Ga0466706_276933_4754_6421 555
78 iso_pr_bacteria 2908241010 2908247639 555
79 3300000333 HBC_ctgsDRAFT_1010445 HBC_ctgsDRAFT_10104451 556
80 3300007080 Ga0102735_1000005 Ga0102735_100000559 556
81 3300007188 Ga0103264_1000026 Ga0103264_100002653 556
82 3300010167 Ga0123353_10104054 Ga0123353_101040543 556
83 3300056842 Ga0562377_2801 Ga0562377_2801_7008_8678 556
84 3300057007 Ga0562374_0002 Ga0562374_0002_999731_1001401 556
85 3300010167 Ga0123353_10000822 Ga0123353_1000082227 557
86 3300010167 Ga0123353_10001161 Ga0123353_1000116111 557
87 3300042616 Ga0466715_160448 Ga0466715_160448_15_1730 557
88 3300042616 Ga0466715_173128 Ga0466715_173128_1735_3408 557
89 3300042620 Ga0466728_044204 Ga0466728_044204_290_1978 557
90 iso_pr_bacteria 2820217359 2820218807 557
91 iso_pr_bacteria 2864773010 2864773135 557
92 iso_pr_bacteria 2864899338 2864902689 557
93 iso_pr_bacteria 2864918810 2864920970 557
94 iso_pr_bacteria 2864964650 2864964775 557
95 iso_pr_bacteria 8077775691 8077777313 557
96 3300042599 Ga0466706_255861 Ga0466706_255861_6989_8665 558
97 3300042616 Ga0466715_308682 Ga0466715_308682_1347_3023 558
98 iso_pr_bacteria 2568526170 2569119251 558
99 iso_pr_bacteria 2684622916 2686083029 558
100 iso_pr_bacteria 2684622917 2686084611 558
101 iso_pr_bacteria 2684622918 2686086289 558
102 iso_pr_bacteria 2808606957 2811756560 558
103 iso_pr_bacteria 2818991478 2819788215 558
104 iso_pr_bacteria 2820134530 2820136529 558
105 iso_pr_bacteria 2820166269 2820167793 558
106 iso_pr_bacteria 2820168331 2820168755 558
107 iso_pr_bacteria 2820170025 2820170194 558
108 iso_pr_bacteria 2865982043 2865983687 558
109 iso_pr_bacteria 2873586004 2873587113 558
110 iso_pr_bacteria 2879643867 2879644338 558
111 iso_pr_bacteria 8024981139 8024982383 558
112 iso_pr_bacteria 8024986378 8024987698 558
113 iso_pr_bacteria 8032009961 8032011006 558
114 iso_pr_bacteria 8110340172 8110340439 558
115 3300042605 Ga0466716_173207 Ga0466716_173207_1797_3476 559
116 3300042615 Ga0466711_314880 Ga0466711_314880_2831_4510 559
117 iso_pr_bacteria 2820178484 2820178689 559
118 iso_pr_bacteria 2820201435 2820202249 559
119 iso_pr_bacteria 3002678670 3002681738 559
120 3300002462 JGI24702J35022_10025177 JGI24702J35022_100251773 560
121 3300009784 Ga0123357_10000114 Ga0123357_1000011412 560
122 3300010167 Ga0123353_10000223 Ga0123353_1000022326 560
123 3300010167 Ga0123353_10002042 Ga0123353_1000204215 560
124 3300042582 Ga0466657_340973 Ga0466657_340973_9292_10974 560
125 3300042592 Ga0466693_056620 Ga0466693_056620_5175_6857 560
126 3300042592 Ga0466693_092506 Ga0466693_092506_13984_15666 560
127 3300042599 Ga0466706_122685 Ga0466706_122685_873_2555 560
128 3300042599 Ga0466706_231257 Ga0466706_231257_161132_162814 560
129 3300042600 Ga0466700_027594 Ga0466700_027594_1198_2880 560
130 3300042601 Ga0466707_269543 Ga0466707_269543_47940_49622 560
131 3300042601 Ga0466707_377241 Ga0466707_377241_48450_50132 560
132 3300042602 Ga0466713_031712 Ga0466713_031712_7324_9006 560
133 3300042602 Ga0466713_054427 Ga0466713_054427_352_2034 560
134 3300042602 Ga0466713_075576 Ga0466713_075576_4951_6633 560
135 3300042612 Ga0466705_090425 Ga0466705_090425_2259_3941 560
136 3300042613 Ga0466710_112767 Ga0466710_112767_3124_4806 560
137 3300042615 Ga0466711_315451 Ga0466711_315451_7184_8866 560
138 3300042617 Ga0466718_022770 Ga0466718_022770_4415_6097 560
139 3300042618 Ga0466723_068624 Ga0466723_068624_6111_7793 560
140 3300042618 Ga0466723_196276 Ga0466723_196276_5584_7266 560
141 3300042619 Ga0466726_232342 Ga0466726_232342_1547_3229 560
142 3300042620 Ga0466728_480695 Ga0466728_480695_705_2387 560
143 3300042621 Ga0466729_251501 Ga0466729_251501_229_1911 560
144 3300042621 Ga0466729_260758 Ga0466729_260758_212_1894 560
145 3300042636 Ga0466703_103691 Ga0466703_103691_32262_33944 560
146 3300042636 Ga0466703_258346 Ga0466703_258346_5580_7262 560
147 3300042636 Ga0466703_423520 Ga0466703_423520_5261_6943 560
148 3300042643 Ga0466704_011860 Ga0466704_011860_2811_4493 560
149 3300042643 Ga0466704_034783 Ga0466704_034783_41739_43421 560
150 3300042643 Ga0466704_174793 Ga0466704_174793_723_2405 560
151 3300042643 Ga0466704_415887 Ga0466704_415887_65592_67274 560
152 3300042652 Ga0466708_195163 Ga0466708_195163_1396_3078 560
153 3300042655 Ga0466727_004073 Ga0466727_004073_1716_3398 560
154 3300042655 Ga0466727_318492 Ga0466727_318492_7261_8943 560
155 3300042659 Ga0466733_187582 Ga0466733_187582_76716_78398 560
156 3300042659 Ga0466733_208395 Ga0466733_208395_2164_3846 560
157 iso_pr_bacteria 2504756063 2504977903 560
158 iso_pr_bacteria 2505679068 2505952168 560
159 iso_pr_bacteria 2524023214 2524487804 560
160 iso_pr_bacteria 2630969010 2634125650 560
161 iso_pr_bacteria 2681812870 2682012332 560
162 iso_pr_bacteria 2731957681 2732699118 560
163 iso_pr_bacteria 2818991320 2819438764 560
164 iso_pr_bacteria 2820803007 2820804622 560
165 iso_pr_bacteria 2820807258 2820808001 560
166 iso_pr_bacteria 2820809073 2820809492 560
167 iso_pr_bacteria 2820814774 2820816467 560
168 iso_pr_bacteria 2820816657 2820817186 560
169 iso_pr_bacteria 2820818506 2820819769 560
170 iso_pr_bacteria 2820820509 2820821281 560
171 iso_pr_bacteria 2820825283 2820826859 560
172 iso_pr_bacteria 2820834831 2820835308 560
173 iso_pr_bacteria 2820838073 2820838606 560
174 iso_pr_bacteria 2820840446 2820840861 560
175 iso_pr_bacteria 2820842553 2820845281 560
176 iso_pr_bacteria 2820849606 2820850901 560
177 iso_pr_bacteria 2820863028 2820863304 560
178 iso_pr_bacteria 2820889385 2820891199 560
179 iso_pr_bacteria 2820901319 2820902742 560
180 iso_pr_bacteria 2820903739 2820903947 560
181 iso_pr_bacteria 2820909719 2820911100 560
182 iso_pr_bacteria 2820911766 2820912519 560
183 iso_pr_bacteria 2820914081 2820914184 560
184 iso_pr_bacteria 2820922474 2820922752 560
185 iso_pr_bacteria 2820926697 2820928470 560
186 iso_pr_bacteria 2821314491 2821316330 560
187 iso_pr_bacteria 2841168549 2841170902 560
188 iso_pr_bacteria 2848356102 2848356447 560
189 iso_pr_bacteria 2873558832 2873559132 560
190 iso_pr_bacteria 2873614151 2873617365 560
191 iso_pr_bacteria 2873617540 2873619371 560
192 iso_pr_bacteria 2873620646 2873622143 560
193 iso_pr_bacteria 2883361506 2883362798 560
194 iso_pr_bacteria 2884351759 2884354657 560
195 iso_pr_bacteria 2884613238 2884616517 560
196 iso_pr_bacteria 2915166107 2915166163 560
197 iso_pr_bacteria 2915168811 2915170642 560
198 iso_pr_bacteria 2931425734 2931426848 560
199 iso_pr_bacteria 8067987626 8067988829 560
200 3300000089 AustNasuHG_c1000578 AustNasuHG_100057814 561
201 3300002509 JGI24699J35502_11130196 JGI24699J35502_111301964 561
202 3300002509 JGI24699J35502_11132795 JGI24699J35502_111327951 561
203 3300002509 JGI24699J35502_11133053 JGI24699J35502_111330533 561
204 3300002509 JGI24699J35502_11134065 JGI24699J35502_1113406518 561
205 3300002509 JGI24699J35502_11134109 JGI24699J35502_1113410922 561
206 3300005200 Ga0072940_1033211 Ga0072940_10332116 561
207 3300005200 Ga0072940_1036642 Ga0072940_10366421 561
208 3300005201 Ga0072941_1056215 Ga0072941_10562156 561
209 3300009784 Ga0123357_10000076 Ga0123357_1000007661 561
210 3300009784 Ga0123357_10000502 Ga0123357_1000050223 561
211 3300009784 Ga0123357_10001080 Ga0123357_1000108011 561
212 3300009784 Ga0123357_10004619 Ga0123357_100046196 561
213 3300009784 Ga0123357_10011546 Ga0123357_100115462 561
214 3300009784 Ga0123357_10012376 Ga0123357_100123763 561
215 3300009784 Ga0123357_10051893 Ga0123357_100518933 561
216 3300010049 Ga0123356_10000188 Ga0123356_1000018814 561
217 3300010049 Ga0123356_10001701 Ga0123356_1000170114 561
218 3300010167 Ga0123353_10000096 Ga0123353_1000009644 561
219 3300010167 Ga0123353_10000229 Ga0123353_1000022926 561
220 3300010167 Ga0123353_10001402 Ga0123353_1000140210 561
221 3300010882 Ga0123354_10003479 Ga0123354_1000347912 561
222 3300010882 Ga0123354_10003541 Ga0123354_1000354113 561
223 3300010882 Ga0123354_10008288 Ga0123354_100082888 561
224 3300010882 Ga0123354_10024943 Ga0123354_100249434 561
225 3300010882 Ga0123354_10040056 Ga0123354_100400566 561
226 3300010882 Ga0123354_10048603 Ga0123354_100486035 561
227 3300010882 Ga0123354_10052599 Ga0123354_100525993 561
228 3300010882 Ga0123354_10064681 Ga0123354_100646815 561
229 3300010882 Ga0123354_10086000 Ga0123354_100860004 561
230 3300012812 Ga0160471_100012 Ga0160471_100012117 561
231 3300012818 Ga0160432_100880 Ga0160432_1008805 561
232 3300012849 Ga0160447_103517 Ga0160447_1035172 561
233 3300012861 Ga0160436_1001706 Ga0160436_10017062 561
234 3300042601 Ga0466707_363247 Ga0466707_363247_2562_4247 561
235 3300042618 Ga0466723_014823 Ga0466723_014823_2812_4497 561
236 3300042618 Ga0466723_228478 Ga0466723_228478_531_2216 561
237 3300042619 Ga0466726_201919 Ga0466726_201919_8470_10155 561
238 iso_pr_bacteria 2820171952 2820172890 561
239 iso_pr_bacteria 8030347546 8030348288 561
240 3300007733 Ga0105524_100943 Ga0105524_10094312 562
241 3300042596 Ga0466696_201266 Ga0466696_201266_980_2668 562
242 3300042599 Ga0466706_093255 Ga0466706_093255_4834_6522 562
243 3300042601 Ga0466707_043206 Ga0466707_043206_37680_39419 562
244 3300042606 Ga0466719_107074 Ga0466719_107074_5360_7048 562
245 iso_pr_bacteria 2820185449 2820185610 562
246 iso_pr_bacteria 2820829137 2820829502 562
247 3300002449 JGI24698J34947_10032448 JGI24698J34947_100324482 565
248 3300042604 Ga0466717_149943 Ga0466717_149943_42_1745 567
249 3300042659 Ga0466733_189122 Ga0466733_189122_58_1764 568
250 iso_pr_bacteria 2597490239 2598797706 570
251 3300010167 Ga0123353_10001324 Ga0123353_1000132416 571
252 3300010167 Ga0123353_10008165 Ga0123353_100081659 572
253 3300010167 Ga0123353_10097843 Ga0123353_100978432 573
254 3300042591 Ga0466692_103469 Ga0466692_103469_3610_5340 576
255 3300042621 Ga0466729_178702 Ga0466729_178702_4977_6707 576
256 iso_pr_bacteria 2671180625 2673532958 578
257 iso_pr_bacteria 2675903497 2678195513 578
258 iso_pr_bacteria 2931430189 2931431123 579
259 3300042616 Ga0466715_353650 Ga0466715_353650_6760_8508 582
260 iso_pr_bacteria 8046957834 8046966344 582
261 3300042608 Ga0466721_023958 Ga0466721_023958_129_1883 584
262 3300042596 Ga0466696_143954 Ga0466696_143954_2111_3886 586
263 3300042643 Ga0466704_133798 Ga0466704_133798_4858_6690 587
264 3300009784 Ga0123357_10007961 Ga0123357_100079615 588
265 iso_pr_bacteria 2820205024 2820205236 590
266 iso_pr_bacteria 2648501322 2649450570 591
267 iso_pr_bacteria 8077783556 8077785296 598
268 3300042593 Ga0466691_027331 Ga0466691_027331_1679_3616 605
269 3300005200 Ga0072940_1021602 Ga0072940_10216028 615

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00005 ABC_tran ABC transporter 21 190 0.96
PF12848 ABC_tran_Xtn ABC transporter 229 305 0.8

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.79 0.85 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.