Protein Family IF01226

Metagenome Isolate
120 Members
43 Samples
110 Scaffolds
338.45 Avg Length

🧬 Representative Sequence

ID
3300005200|Ga0072940_1007484|Ga0072940_10074843
Length
315 aa
Sequence
LEKFADEAIIEVSSGSGGNGCAAFRREKYVPRGGPSDVVFTVRRNLRTLAHLRYKFSFRAENGRADVVIPLPPGSLIRDSGNQKNFIFLKGGNGGWGNIHFKSSVNQSPRKALPGKPGQTVRLKVELQIMADIGLVGFPNAGKSSLLDRLTNARPKIAAYPFTTKIPNLGVLTSGERDVIIADIPGLIEGASHGAGLGFYFLKHISRTAALAFLIDLSDDNYLEAFDILLNELKSFSEELAGKNRLIIGTKTDLAETTGRLSELAQKYPAEEVMGISVFSGEGIKELSYAFLRLTENHEESANLNDILNEGDDL*

📊 Sample Types

Isolate 8.3%
Metagenome 91.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 48.8%
Unclassified 24.4%
Kalotermitidae 22.0%
Termopsidae 4.9%

🌳 Taxonomy

Archaea 0
Bacteria 116
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2228664004 P3 Gut Segment Termite Single Cell Genome_Treponema sp. T3b, from Florida USA Metagenome Termitidae
2 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
3 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
4 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
5 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
6 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
7 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
8 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
9 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
10 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
11 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
12 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
13 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
14 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
15 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
16 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
17 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
18 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
19 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
20 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
21 2781125636 Treponema sp. Co191P1bin67 Isolate Unclassified
22 2781125662 Treponema sp. Emb289P3bin141 Isolate Unclassified
23 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
24 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
25 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
26 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
27 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
28 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
29 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
30 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
31 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
32 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
33 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
34 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
35 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
36 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
37 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
38 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
39 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
40 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
41 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
42 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
43 2781125647 Treponema sp. Co191P3bin16 Isolate Unclassified

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466694_200290 3300042594 Bacteria 10044
2 Ga0466699_140940 3300042597 Bacteria 18606
3 Ga0466703_213711 3300042636 Bacteria 33262
4 Ga0466703_255570 3300042636 Bacteria 3368
5 Ga0466704_151352 3300042643 Bacteria 18052
6 Ga0466719_396391 3300042606 Bacteria 20129
7 Ga0466720_031024 3300042607 Bacteria 6147
8 2230969641 2228664004 Bacteria 7204
9 AustNasuHG_c1000005 3300000089 Bacteria 56942
10 JGI24695J34938_10009583 3300002450 Bacteria 5374
11 Ga0466732_029143 3300042656 Bacteria 8918
12 Ga0466712_084186 3300042614 Bacteria 8655
13 Ga0466718_078288 3300042617 Bacteria 22152
14 Ga0466728_160467 3300042620 Bacteria 8247
15 Ga0123355_10423051 3300009826 Bacteria 1701
16 Ga0264413_105677 3300024493 Bacteria 11783
17 Ga0415639_034121 3300038395 Bacteria 6028
18 Ga0466699_303629 3300042597 Bacteria 10226
19 JGI24698J34947_10000264 3300002449 Bacteria 22404
20 JGI24698J34947_10037754 3300002449 Bacteria 2508
21 JGI24695J34938_10001095 3300002450 Bacteria 24483
22 JGI24695J34938_10002277 3300002450 Bacteria 14816
23 JGI24695J34938_10065867 3300002450 Bacteria 1528
24 Ga0466726_086990 3300042619 Bacteria 22113
25 Ga0264413_101471 3300024493 Bacteria 49537
26 Ga0466693_004183 3300042592 Bacteria 23210
27 Ga0466699_276206 3300042597 Bacteria 9001
28 Ga0466699_380842 3300042597 Bacteria 2215
29 Ga0466717_038350 3300042604 Bacteria 1836
30 JGI24695J34938_10005072 3300002450 Bacteria 8372
31 JGI24695J34938_10005648 3300002450 Bacteria 7730
32 Ga0466712_040231 3300042614 Bacteria 12213
33 Ga0466712_248012 3300042614 Bacteria 7175
34 Ga0466718_033452 3300042617 Bacteria 16993
35 Ga0466723_011294 3300042618 Bacteria 53611
36 Ga0123356_10084251 3300010049 Bacteria 3012
37 Ga0466690_316764 3300042590 Bacteria 7665
38 Ga0466699_255149 3300042597 Bacteria 3057
39 Ga0466702_273378 3300042635 Bacteria 8664
40 Ga0466702_320955 3300042635 Bacteria 1515
41 JGI24695J34938_10001205 3300002450 Bacteria 22922
42 JGI24695J34938_10003864 3300002450 Bacteria 10144
43 JGI24695J34938_10007527 3300002450 Bacteria 6359
44 JGI24695J34938_10021463 3300002450 Bacteria 3157
45 JGI24699J35502_11106304 3300002509 Unclassified 2521
46 Ga0072940_1007484 3300005200 Bacteria 6182
47 Ga0466705_446328 3300042612 Bacteria 6638
48 Ga0123356_10000240 3300010049 Bacteria 63107
49 Ga0123356_10004193 3300010049 Bacteria 14942
50 Ga0123356_10007299 3300010049 Bacteria 11032
51 Ga0123356_10167891 3300010049 Bacteria 2201
52 Ga0466699_274412 3300042597 Bacteria 7094
53 Ga0466699_314935 3300042597 Bacteria 35477
54 Ga0466702_271442 3300042635 Bacteria 2295
55 Ga0466720_175813 3300042607 Bacteria 6467
56 Ga0466720_201987 3300042607 Bacteria 5915
57 Ga0466721_292592 3300042608 Bacteria 4555
58 AustNasuHG_c1002635 3300000089 Bacteria 6478
59 JGI24698J34947_10000080 3300002449 Bacteria 31361
60 JGI24695J34938_10003707 3300002450 Bacteria 10442
61 JGI24695J34938_10005061 3300002450 Bacteria 8375
62 JGI24695J34938_10005687 3300002450 Bacteria 7694
63 Ga0072941_1009212 3300005201 Bacteria 12195
64 Ga0466718_127793 3300042617 Bacteria 1107
65 Ga0123356_10018827 3300010049 Bacteria 6553
66 Ga0123356_10048132 3300010049 Bacteria 3968
67 Ga0466702_078035 3300042635 Bacteria 18489
68 Ga0466702_329253 3300042635 Bacteria 4973
69 Ga0466704_002963 3300042643 Bacteria 15827
70 Ga0466727_039521 3300042655 Bacteria 1569
71 Ga0466721_220378 3300042608 Bacteria 49670
72 AustNasuHG_c1039234 3300000089 Bacteria 1179
73 JGI24698J34947_10003487 3300002449 Bacteria 8537
74 JGI24698J34947_10033365 3300002449 Bacteria 2702
75 JGI24695J34938_10000045 3300002450 Bacteria 92650
76 JGI24695J34938_10000766 3300002450 Bacteria 30215
77 JGI24695J34938_10002280 3300002450 Bacteria 14811
78 Ga0072941_1003306 3300005201 Bacteria 11827
79 Ga0466712_000470 3300042614 Bacteria 25247
80 Ga0466712_099818 3300042614 Bacteria 14525
81 Ga0466712_155179 3300042614 Bacteria 14401
82 Ga0466712_227966 3300042614 Bacteria 8768
83 Ga0466718_034581 3300042617 Bacteria 1253
84 Ga0123356_10000125 3300010049 Bacteria 84722
85 Ga0123356_10012336 3300010049 Bacteria 8298
86 Ga0123356_10020848 3300010049 Bacteria 6199
87 Ga0415639_041956 3300038395 Bacteria 14603
88 Ga0415639_042755 3300038395 Bacteria 3672
89 Ga0415639_145998 3300038395 Bacteria 3385
90 Ga0466693_039798 3300042592 Unclassified 4058
91 Ga0466691_056468 3300042593 Bacteria 19607
92 Ga0466694_066477 3300042594 Bacteria 2650
93 Ga0466699_055698 3300042597 Bacteria 7941
94 Ga0466699_123446 3300042597 Bacteria 8666
95 Ga0466702_145974 3300042635 Bacteria 2061
96 Ga0466702_174439 3300042635 Bacteria 3179
97 Ga0466720_171874 3300042607 Unclassified 1961
98 JGI24698J34947_10000117 3300002449 Bacteria 28041
99 JGI24698J34947_10005898 3300002449 Bacteria 6714
100 Ga0466712_028735 3300042614 Bacteria 38990
101 Ga0466715_006525 3300042616 Bacteria 2396
102 Ga0466718_065755 3300042617 Unclassified 14643
103 Ga0123356_10000561 3300010049 Bacteria 41259
104 Ga0123356_10468140 3300010049 Bacteria 1411
105 Ga0123353_10566964 3300010167 Bacteria 1633
106 Ga0466699_257329 3300042597 Bacteria 15190
107 Ga0466699_420360 3300042597 Bacteria 1927
108 JGI24695J34938_10000133 3300002450 Bacteria 67517
109 JGI24695J34938_10005353 3300002450 Bacteria 8026
110 Ga0072941_1032280 3300005201 Bacteria 4236

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300024493 Ga0264413_105677 Ga0264413_10567711 305
2 2228664004 2230969641 2230683294 306
3 3300042597 Ga0466699_257329 Ga0466699_257329_1603_2529 308
4 3300042617 Ga0466718_127793 Ga0466718_127793_13_1050 310
5 3300005200 Ga0072940_1007484 Ga0072940_10074843 315
6 3300010049 Ga0123356_10018827 Ga0123356_100188277 318
7 3300042635 Ga0466702_078035 Ga0466702_078035_14392_15429 320
8 3300010049 Ga0123356_10012336 Ga0123356_100123368 321
9 3300010049 Ga0123356_10000240 Ga0123356_1000024045 323
10 3300042636 Ga0466703_255570 Ga0466703_255570_1953_2981 323
11 3300042655 Ga0466727_039521 Ga0466727_039521_258_1280 323
12 3300002450 JGI24695J34938_10002280 JGI24695J34938_1000228016 324
13 3300042592 Ga0466693_039798 Ga0466693_039798_731_1786 325
14 3300042606 Ga0466719_396391 Ga0466719_396391_1783_2778 325
15 3300042608 Ga0466721_220378 Ga0466721_220378_37497_38498 325
16 3300002450 JGI24695J34938_10065867 JGI24695J34938_100658672 326
17 3300010049 Ga0123356_10020848 Ga0123356_100208484 326
18 3300042597 Ga0466699_140940 Ga0466699_140940_6383_7483 326
19 3300042604 Ga0466717_038350 Ga0466717_038350_325_1329 326
20 3300042618 Ga0466723_011294 Ga0466723_011294_47787_48791 326
21 3300042619 Ga0466726_086990 Ga0466726_086990_12406_13410 326
22 3300042643 Ga0466704_002963 Ga0466704_002963_9816_10844 326
23 3300002450 JGI24695J34938_10005072 JGI24695J34938_100050727 327
24 3300010049 Ga0123356_10007299 Ga0123356_100072993 327
25 3300010049 Ga0123356_10048132 Ga0123356_100481325 327
26 3300042636 Ga0466703_213711 Ga0466703_213711_17206_18222 327
27 3300005201 Ga0072941_1009212 Ga0072941_10092126 329
28 3300010167 Ga0123353_10566964 Ga0123353_105669642 329
29 3300042594 Ga0466694_200290 Ga0466694_200290_242_1375 329
30 3300042597 Ga0466699_303629 Ga0466699_303629_6068_7081 329
31 3300042607 Ga0466720_201987 Ga0466720_201987_443_1534 329
32 3300042656 Ga0466732_029143 Ga0466732_029143_4843_5904 329
33 iso_pr_bacteria 2781125657 2781323206 329
34 3300042590 Ga0466690_316764 Ga0466690_316764_1819_2835 330
35 3300042593 Ga0466691_056468 Ga0466691_056468_14888_15904 330
36 3300042614 Ga0466712_000470 Ga0466712_000470_13737_14753 330
37 3300042616 Ga0466715_006525 Ga0466715_006525_680_1828 330
38 3300042643 Ga0466704_151352 Ga0466704_151352_1666_2682 330
39 3300042607 Ga0466720_171874 Ga0466720_171874_372_1439 331
40 3300042614 Ga0466712_028735 Ga0466712_028735_27438_28454 331
41 3300042614 Ga0466712_040231 Ga0466712_040231_5180_6244 331
42 3300002449 JGI24698J34947_10000117 JGI24698J34947_1000011726 332
43 3300002449 JGI24698J34947_10000264 JGI24698J34947_1000026410 332
44 3300010049 Ga0123356_10000561 Ga0123356_1000056115 332
45 3300042607 Ga0466720_175813 Ga0466720_175813_4384_5457 332
46 3300042614 Ga0466712_099818 Ga0466712_099818_6427_7476 332
47 3300010049 Ga0123356_10004193 Ga0123356_100041938 333
48 3300042597 Ga0466699_055698 Ga0466699_055698_4600_5601 333
49 3300042597 Ga0466699_123446 Ga0466699_123446_6246_7247 333
50 3300042597 Ga0466699_255149 Ga0466699_255149_1263_2264 333
51 3300042597 Ga0466699_380842 Ga0466699_380842_309_1310 333
52 3300042608 Ga0466721_292592 Ga0466721_292592_2963_3985 333
53 3300042620 Ga0466728_160467 Ga0466728_160467_1250_2392 333
54 3300038395 Ga0415639_145998 Ga0415639_145998_1438_2457 334
55 3300000089 AustNasuHG_c1000005 AustNasuHG_100000511 335
56 3300042594 Ga0466694_066477 Ga0466694_066477_494_1522 335
57 3300042607 Ga0466720_031024 Ga0466720_031024_313_1407 335
58 3300042614 Ga0466712_084186 Ga0466712_084186_6352_7407 336
59 3300042617 Ga0466718_033452 Ga0466718_033452_13768_14805 336
60 3300042635 Ga0466702_174439 Ga0466702_174439_278_1336 337
61 3300042635 Ga0466702_271442 Ga0466702_271442_586_1668 337
62 3300002449 JGI24698J34947_10003487 JGI24698J34947_100034879 339
63 3300002450 JGI24695J34938_10009583 JGI24695J34938_100095832 339
64 3300002449 JGI24698J34947_10005898 JGI24698J34947_100058986 340
65 3300002450 JGI24695J34938_10005061 JGI24695J34938_100050618 340
66 3300002509 JGI24699J35502_11106304 JGI24699J35502_111063042 340
67 3300038395 Ga0415639_034121 Ga0415639_034121_3955_5022 340
68 3300042617 Ga0466718_034581 Ga0466718_034581_56_1114 340
69 3300002449 JGI24698J34947_10033365 JGI24698J34947_100333652 341
70 3300002450 JGI24695J34938_10005353 JGI24695J34938_100053536 341
71 3300042617 Ga0466718_065755 Ga0466718_065755_5618_6709 341
72 3300000089 AustNasuHG_c1002635 AustNasuHG_10026359 342
73 3300002450 JGI24695J34938_10003707 JGI24695J34938_100037079 342
74 3300005201 Ga0072941_1032280 Ga0072941_10322805 342
75 3300005201 Ga0072941_1003306 Ga0072941_10033065 343
76 3300010049 Ga0123356_10468140 Ga0123356_104681402 343
77 3300002450 JGI24695J34938_10005648 JGI24695J34938_100056488 344
78 3300038395 Ga0415639_041956 Ga0415639_041956_13513_14550 345
79 3300038395 Ga0415639_042755 Ga0415639_042755_262_1323 345
80 3300042597 Ga0466699_276206 Ga0466699_276206_6338_7393 345
81 3300042597 Ga0466699_420360 Ga0466699_420360_550_1641 345
82 3300042614 Ga0466712_248012 Ga0466712_248012_4919_5980 345
83 iso_pr_bacteria 2781125661 2781332947 345
84 3300002449 JGI24698J34947_10037754 JGI24698J34947_100377542 346
85 3300042612 Ga0466705_446328 Ga0466705_446328_4325_5389 346
86 3300042614 Ga0466712_227966 Ga0466712_227966_2733_3797 347
87 iso_pr_bacteria 2781125662 2781337104 347
88 3300002449 JGI24698J34947_10000080 JGI24698J34947_1000008011 348
89 3300042635 Ga0466702_273378 Ga0466702_273378_4254_5324 348
90 3300002450 JGI24695J34938_10000045 JGI24695J34938_1000004513 349
91 3300002450 JGI24695J34938_10000766 JGI24695J34938_1000076616 349
92 3300002450 JGI24695J34938_10003864 JGI24695J34938_1000386411 349
93 3300010049 Ga0123356_10084251 Ga0123356_100842515 350
94 3300024493 Ga0264413_101471 Ga0264413_10147128 350
95 3300042597 Ga0466699_314935 Ga0466699_314935_27711_28763 350
96 3300042635 Ga0466702_329253 Ga0466702_329253_2589_3665 350
97 3300000089 AustNasuHG_c1039234 AustNasuHG_10392342 351
98 3300002450 JGI24695J34938_10007527 JGI24695J34938_100075279 351
99 3300042614 Ga0466712_155179 Ga0466712_155179_7584_8657 351
100 3300042635 Ga0466702_320955 Ga0466702_320955_294_1373 351
101 3300002450 JGI24695J34938_10001205 JGI24695J34938_1000120524 353
102 3300042617 Ga0466718_078288 Ga0466718_078288_15364_16449 353
103 3300042635 Ga0466702_145974 Ga0466702_145974_840_1925 353
104 3300009826 Ga0123355_10423051 Ga0123355_104230511 354
105 iso_pr_bacteria 2781125634 2781274899 354
106 3300002450 JGI24695J34938_10005687 JGI24695J34938_100056873 355
107 3300002450 JGI24695J34938_10021463 JGI24695J34938_100214632 355
108 iso_pr_bacteria 2781125650 2781308489 355
109 3300002450 JGI24695J34938_10002277 JGI24695J34938_100022778 356
110 3300010049 Ga0123356_10000125 Ga0123356_1000012575 356
111 3300042592 Ga0466693_004183 Ga0466693_004183_7703_8869 356
112 iso_pr_bacteria 2781125636 2781280776 356
113 iso_pr_bacteria 2781125665 2781342150 356
114 3300010049 Ga0123356_10167891 Ga0123356_101678912 358
115 iso_pr_bacteria 2781125638 2781284795 358
116 3300002450 JGI24695J34938_10001095 JGI24695J34938_1000109510 362
117 iso_pr_bacteria 2781125660 2781330972 363
118 3300042597 Ga0466699_274412 Ga0466699_274412_4138_5289 367
119 iso_pr_bacteria 2781125647 2781302488 372
120 3300002450 JGI24695J34938_10000133 JGI24695J34938_1000013351 379

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01018 GTP1_OBG GTP1/OBG 6 128 0.95
PF02421 FeoB_N Ferrous iron transport protein B 133 187 0.95
PF01926 MMR_HSR1 50S ribosome-binding GTPase 133 248 0.88

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02421 GO:0005525 GTP binding MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.64 0.66 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.