Protein Family IF01225

Metagenome Metatranscriptome Isolate
344 Members
238 Samples
173 Scaffolds
374.26 Avg Length

🧬 Representative Sequence

ID
3300005200|Ga0072940_1004697|Ga0072940_10046971
Length
453 aa
Sequence
MASLSLRGIYKRYPGGVVAVSDFTMNIKDKEFIILVGPSGCGKSTTLRMIAGLEEISEGELFIGDRLVNDVAPKDRDIAMVFQNYALYPHMSVFENMAFGLKLRKVPKDQIKKLVDEAAKILDITHLLDRKPKALSGGQRQRVALGRAIVRDPQVFLLDEPLSNLDAKLRAQMRTELAKLHKKLGTTFIYVTHDQIEAMTMGDRIVVMKDGYIQQIDSPINLYSNPVNKFVAGFMGSPQMNFIDAKLIMLNNKYTLEFGSEDSKTTRGRKFYIEIPPAKADTEALRYYLDKDVILGIRPENIHDSEMFLSNAKTGIIEATVDVTEMMGAETYLYLSCEGTPLTVRVSSRSVARPQDVIKLAIDPXXXXRRNRNDGRGNLSVPVLRGYAADSPRFVPLRRETAGRYQARDRPGVYPPFRRERRTLDISVINTGNRRIKRPLRVSRIGLFNKKA*

📊 Sample Types

Isolate 49.7%
Metagenome 50.0%
MAG 0.0%
Metatranscriptome 0.3%
Single Cell 0.0%

🐛 Taxa Family Distribution

Coreidae 34.5%
Unclassified 21.6%
Termitidae 9.5%
Culicidae 5.2%
Blattidae 4.3%
Kalotermitidae 4.3%
Curculionidae 3.9%
Elmidae 3.9%
Tenebrionidae 1.7%
Armadillidiidae 1.7%
Termopsidae 1.3%
Formicidae 1.3%
Rhinotermitidae 0.9%
Largidae 0.9%
Berytidae 0.9%
Passalidae 0.9%
Apidae 0.9%
Hodotermitidae 0.4%
Siricidae 0.4%
Noctuidae 0.4%
Alydidae 0.4%
Ceratopogonidae 0.4%
Stratiomyidae 0.4%

🌳 Taxonomy

Archaea 0
Bacteria 319
Eukaryota 0
Viruses 0
Unclassified 25

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940292506 Lachnoclostridium sp. PH5-23 Isolate Blattidae
2 2519899622 Pseudomonas sp. Ag1 Isolate Culicidae
3 2529293168 Ruminiclostridium cellobioparum termitidis CT1112 Isolate Termitidae
4 2820453354 Unclassified Firmicutes Lab288P3bin172 Isolate Unclassified
5 2820507989 Unclassified Firmicutes Lab288P1bin41 Isolate Unclassified
6 2820533259 Unclassified Firmicutes Lab288P1bin140 Isolate Unclassified
7 2820551407 Unclassified Firmicutes Emb289P4bin38 Isolate Unclassified
8 2820560510 Unclassified Firmicutes Emb289P3bin72 Isolate Unclassified
9 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
10 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
11 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
12 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
13 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
14 8011329375 Pseudomonas sp. S31 Isolate Curculionidae
15 8023747282 Caballeronia zhejiangensis LZ019 Isolate Coreidae
16 8024025509 Caballeronia grimmiae Lep1A1 Isolate Coreidae
17 8024037630 Caballeronia zhejiangensis A33_M4_a Isolate Coreidae
18 8025685901 Caballeronia fortuita LZ035 Isolate Coreidae
19 8025723035 Caballeronia grimmiae LZ025 Isolate Coreidae
20 8025756023 Caballeronia peredens LZ002 Isolate Coreidae
21 8078130113 Caballeronia sp. INDeC2 Isolate Coreidae
22 8102054868 Caballeronia sp. GAFFF1 Isolate Coreidae
23 8102102351 Caballeronia sp. INML1 Isolate Coreidae
24 8102161003 Caballeronia sp. LZ002 Isolate Coreidae
25 8102174626 Caballeronia sp. LZ024 Isolate Coreidae
26 8102246966 Caballeronia sp. LZ050 Isolate Coreidae
27 3003869270 Paraburkholderia sp. PGU16 Isolate Largidae
28 3007473699 Pseudomonas sp. S30 Isolate Curculionidae
29 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
30 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
31 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
32 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
33 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
34 2940277027 Lachnospiraceae bacterium PF1-21 Isolate Blattidae
35 2035918003 Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine Metagenome Curculionidae
36 2820336130 Unclassified Firmicutes Nt197P3bin70 Isolate Unclassified
37 2820403592 Unclassified Firmicutes Lab288P4bin93 Isolate Unclassified
38 2820418027 Unclassified Firmicutes Lab288P3bin85 Isolate Unclassified
39 2820570671 Unclassified Firmicutes Emb289P3bin19 Isolate Unclassified
40 2820639607 Unclassified Firmicutes Cu122P5bin9 Isolate Unclassified
41 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
42 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
43 8024014383 Caballeronia sp. SL2Y3 Isolate Berytidae
44 8025740903 Caballeronia zhejiangensis LZ008 Isolate Coreidae
45 8069748016 Caballeronia sp. LP003 Isolate Coreidae
46 8102033761 Caballeronia sp. AZ7_KS35 Isolate Coreidae
47 8102094248 Caballeronia sp. GaOx3 Isolate Coreidae
48 8102109360 Caballeronia sp. INML2 Isolate Coreidae
49 8102145433 Caballeronia sp. LP006 Isolate Coreidae
50 8102186987 Caballeronia sp. LZ028 Isolate Coreidae
51 8102223607 Caballeronia sp. LZ034LL Isolate Coreidae
52 8102286609 Caballeronia sp. NCTM5 Isolate Coreidae
53 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
54 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
55 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
56 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
57 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
58 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
59 2827179085 Paenibacillus alvei DSM 29 Isolate Apidae
60 2864739902 Pseudomonas viridiflavia S00001 Isolate Elmidae
61 2864853652 Pseudomonas rhodesiae S00114 Isolate Elmidae
62 2940280053 Lachnospiraceae bacterium PF1-22 Isolate Blattidae
63 2944625312 Dysgonomonas sp. PF1-3 Isolate Blattidae
64 2964145936 Entomospira culicis BR149 Isolate Culicidae
65 2065487013 Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm Metagenome
66 2820254385 Unclassified Firmicutes Th196P3bin54 Isolate Unclassified
67 2820275298 Unclassified Firmicutes Th196P3bin17 Isolate Unclassified
68 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
69 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
70 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
71 8025716094 Caballeronia zhejiangensis LZ028 Isolate Coreidae
72 8101960468 Caballeronia sp. AAUFL_F2_KS46 Isolate Coreidae
73 8101988189 Caballeronia sp. ATUFL_F1_KS4A Isolate Coreidae
74 8102014801 Caballeronia sp. ATUFL_M2_KS44 Isolate Coreidae
75 8102060671 Caballeronia sp. GAFFF2 Isolate Coreidae
76 8102152052 Caballeronia sp. LZ001 Isolate Coreidae
77 8102208438 Caballeronia sp. LZ032 Isolate Coreidae
78 8102251710 Caballeronia sp. LZ065 Isolate Coreidae
79 8102279326 Caballeronia sp. NCTM1 Isolate Coreidae
80 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
81 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
82 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
83 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
84 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
85 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
86 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
87 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
88 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
89 2864812326 Chitinimonas taiwanensis S00057 Isolate Elmidae
90 2100351016 Sirex noctilio microbial communities from Pennsylvania, USA - adult community Metagenome Siricidae
91 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
92 2820272499 Unclassified Firmicutes Th196P3bin18 Isolate Unclassified
93 2820277137 Unclassified Firmicutes Th196P3bin150 Isolate Unclassified
94 2820282995 Unclassified Firmicutes Th196P3bin147 Isolate Unclassified
95 2820362221 Unclassified Firmicutes Nt197P3bin116 Isolate Unclassified
96 2820401926 Unclassified Firmicutes Mp193P1bin2 Isolate Unclassified
97 2820483401 Unclassified Firmicutes Lab288P1bin74 Isolate Unclassified
98 2820528380 Unclassified Firmicutes Lab288P1bin143 Isolate Unclassified
99 2820573558 Unclassified Firmicutes Emb289P3bin140 Isolate Unclassified
100 8023757577 Caballeronia peredens LP006 Isolate Coreidae
101 8023764196 Caballeronia peredens LZ001 Isolate Coreidae
102 8025678175 Caballeronia hypogeia LZ043 Isolate Coreidae
103 8025728939 Caballeronia telluris LZ024 Isolate Coreidae
104 8025747911 Caballeronia peredens LZ003 Isolate Coreidae
105 8035321120 Pseudomonas prosekii A2-NA12 Isolate Curculionidae
106 8069755105 Caballeronia sp. LZ003 Isolate Coreidae
107 8069775773 Caballeronia sp. LZ062 Isolate Coreidae
108 8101951471 Caballeronia sp. AAUFL_F1_KS45 Isolate Coreidae
109 8101974301 Caballeronia sp. ASUFL_F2_KS49 Isolate Coreidae
110 8101981714 Caballeronia sp. ATUFL_F1_KS39 Isolate Coreidae
111 8102020860 Caballeronia sp. AZ10_KS36 Isolate Coreidae
112 8102026984 Caballeronia sp. AZ1_KS37 Isolate Coreidae
113 8102067727 Caballeronia sp. GAFFF3 Isolate Coreidae
114 2997878596 Pseudomonas bohemica IA9 Isolate Unclassified
115 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
116 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
117 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
118 2864751016 Pseudomonas oryzihabitans S00005 Isolate Elmidae
119 2940289514 Lachnospiraceae bacterium PM6-15 Isolate Blattidae
120 2551306396 Paenibacillus sp. ICGEB2008 Isolate Noctuidae
121 2820234266 Unclassified Firmicutes Th196P3bin99 Isolate Unclassified
122 2820250282 Unclassified Firmicutes Th196P3bin66 Isolate Unclassified
123 2820360414 Unclassified Firmicutes Nt197P3bin121 Isolate Unclassified
124 2820690275 Unclassified Firmicutes Co191P1bin72 Isolate Unclassified
125 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
126 637000219 Pseudomonas entomophila L48 Isolate Unclassified
127 8025658853 Caballeronia temeraria LZ065 Isolate Coreidae
128 8025708040 Caballeronia jiangsuensis LZ029 Isolate Coreidae
129 8035326735 Pseudomonas prosekii A2-NA13 Isolate Curculionidae
130 8063597228 Entomospira culicis BR151 Isolate Culicidae
131 8069770227 Caballeronia sp. LZ019 Isolate Coreidae
132 8101994502 Caballeronia sp. ATUFL_F2_KS42 Isolate Coreidae
133 8102124461 Caballeronia sp. INML3B Isolate Coreidae
134 8102193924 Caballeronia sp. LZ029 Isolate Coreidae
135 8102312426 Caballeronia sp. AAUFL_F1_KS47 Isolate Coreidae
136 2990166910 Pseudomonas typographi CA3A Isolate Curculionidae
137 3007478678 Pseudomonas sp. S37 Isolate Curculionidae
138 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
139 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
140 3300012803 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG Metagenome
141 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
142 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
143 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
144 2864808494 Chitinimonas taiwanensis S00056 Isolate Elmidae
145 2864926767 Pseudomonas nitritireducens S00179 Isolate Elmidae
146 2940233634 Lachnoclostridium sp. PF5-10 Isolate Blattidae
147 2597489944 Caballeronia insecticola RPE64 Isolate Alydidae
148 2820244222 Unclassified Firmicutes Th196P3bin75 Isolate Unclassified
149 2820292184 Unclassified Firmicutes Th196P3bin109 Isolate Unclassified
150 2820296961 Unclassified Firmicutes Th196P3bin102 Isolate Unclassified
151 2820414148 Unclassified Firmicutes Lab288P3bin93 Isolate Unclassified
152 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
153 8023752828 Caballeronia grimmiae LZ062 Isolate Coreidae
154 8024019580 Caballeronia sp. Lep1P3 Isolate Coreidae
155 8024044713 Caballeronia sp. Sq4a Isolate Coreidae
156 8035422605 Pseudomonas monteilii CY06 Isolate
157 8069763219 Caballeronia sp. LZ008 Isolate Coreidae
158 8102001125 Caballeronia sp. ATUFL_F2_KS9A Isolate Coreidae
159 8102169119 Caballeronia sp. LZ016 Isolate Coreidae
160 8102181083 Caballeronia sp. LZ025 Isolate Coreidae
161 8102271933 Caballeronia sp. NCF4 Isolate Coreidae
162 3003878002 Paraburkholderia sp. PGU19 Isolate Largidae
163 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
164 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
165 2864903489 Pseudomonas aeuginosa S00161 Isolate Elmidae
166 2914375287 Culicoidibacter larvae CS-1 Isolate Ceratopogonidae
167 2940230426 Lachnospiraceae bacterium PH5-48 Isolate Blattidae
168 2940283334 Lachnospiraceae bacterium PF1-4 Isolate Blattidae
169 2940295490 Lachnospiraceae bacterium PH1-22 Isolate Blattidae
170 2964144231 Entomospira culicis BR151 Isolate Culicidae
171 2032320009 Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine Metagenome Curculionidae
172 2820280018 Unclassified Firmicutes Th196P3bin149 Isolate Unclassified
173 2820353569 Unclassified Firmicutes Nt197P3bin28 Isolate Unclassified
174 2820518089 Unclassified Firmicutes Lab288P1bin27 Isolate Unclassified
175 2820661146 Unclassified Firmicutes Co191P3bin61 Isolate Unclassified
176 2820707375 Unclassified Firmicutes Co191P1bin31 Isolate Unclassified
177 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
178 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
179 8025650824 Caballeronia hypogeia LZ032 Isolate Coreidae
180 8025671076 Caballeronia cordobensis LZ034LL Isolate Coreidae
181 8025735396 Caballeronia zhejiangensis LZ016 Isolate Coreidae
182 8102047609 Caballeronia sp. GACF5 Isolate Coreidae
183 8102074813 Caballeronia sp. GAWG1-1 Isolate Coreidae
184 8102081745 Caballeronia sp. GAWG1-5s-s Isolate Coreidae
185 8102117041 Caballeronia sp. INML3 Isolate Coreidae
186 8102131453 Caballeronia sp. INML5 Isolate Coreidae
187 8102138357 Caballeronia sp. INSB1 Isolate Coreidae
188 8102216467 Caballeronia sp. LZ033 Isolate Coreidae
189 8102230706 Caballeronia sp. LZ035 Isolate Coreidae
190 8102239244 Caballeronia sp. LZ043 Isolate Coreidae
191 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
192 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
193 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
194 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
195 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
196 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
197 2834951433 Brochothrix thermosphacta CD 337 Isolate Unclassified
198 2864745180 Pseudomonas rhodesiae S00002 Isolate Elmidae
199 2864847319 Pseudomonas alcaligenes S00099 Isolate Elmidae
200 2940286528 Lachnospiraceae bacterium PFB1-21 Isolate Blattidae
201 2044078006 Dendroctonus frontalis bacterial communities from Mississippi, USA Metagenome Curculionidae
202 2518645556 Nocardiopsis alba ATCC BAA-2165 Isolate Apidae
203 2820252425 Unclassified Firmicutes Th196P3bin6 Isolate Unclassified
204 2820259584 Unclassified Firmicutes Th196P3bin43 Isolate Unclassified
205 2820265624 Unclassified Firmicutes Th196P3bin36 Isolate Unclassified
206 2820288918 Unclassified Firmicutes Th196P3bin137 Isolate Unclassified
207 2820294436 Unclassified Firmicutes Th196P3bin104 Isolate Unclassified
208 2820321184 Unclassified Firmicutes Nt197P3bin86 Isolate Unclassified
209 2820332331 Unclassified Firmicutes Nt197P3bin75 Isolate Unclassified
210 2820342392 Unclassified Firmicutes Nt197P3bin64 Isolate Unclassified
211 2820387566 Unclassified Firmicutes Nt197P1bin1 Isolate Unclassified
212 2820569216 Unclassified Firmicutes Emb289P3bin33 Isolate Unclassified
213 2820671341 Unclassified Firmicutes Co191P3bin20 Isolate Unclassified
214 8023724303 Caballeronia zhejiangensis LP003 Isolate Coreidae
215 8024001094 Caballeronia sp. TF1N1 Isolate Berytidae
216 8025666332 Caballeronia grimmiae LZ050 Isolate Coreidae
217 8025694439 Caballeronia cordobensis LZ033 Isolate Coreidae
218 8025701579 Caballeronia telluris LZ031 Isolate Coreidae
219 8030343600 Proteiniborus sp. MB09-C3 Isolate Stratiomyidae
220 8052469819 Pseudomonas putida DZ-F23 Isolate
221 8063595521 Entomospira culicis BR149 Isolate Culicidae
222 8101967387 Caballeronia sp. AAUFL_F3_KS11A Isolate Coreidae
223 8102007614 Caballeronia sp. ATUFL_M1_KS5A Isolate Coreidae
224 8102041249 Caballeronia sp. GACF4 Isolate Coreidae
225 8102087471 Caballeronia sp. GAWG2-1 Isolate Coreidae
226 8102201977 Caballeronia sp. LZ031 Isolate Coreidae
227 8102264549 Caballeronia sp. NCF2 Isolate Coreidae
228 2983866074 Paenibacillus polymyxa A18 Isolate Unclassified
229 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
230 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
231 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
232 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
233 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
234 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
235 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
236 3300022820 Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA Metatranscriptome Termitidae
237 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
238 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0562379_0003 3300056790 Bacteria 3011780
2 Ga0466701_032157 3300042598 Bacteria 6258
3 Ga0466707_314791 3300042601 Bacteria 1904
4 Ga0466711_039073 3300042615 Bacteria 8618
5 Ga0466711_282119 3300042615 Bacteria 18149
6 Ga0123355_10003518 3300009826 Bacteria 22478
7 Ga0123355_10247323 3300009826 Bacteria 2517
8 Ga0123355_10286456 3300009826 Bacteria 2267
9 Ga0160464_101371 3300012805 Bacteria 8750
10 Ga0466735_129136 3300042624 Bacteria 4840
11 Ga0466702_085745 3300042635 Bacteria 153497
12 Ga0466704_448849 3300042643 Bacteria 8452
13 DPOL_contig15748 2035918003 Unclassified 10086
14 IMNBL1DRAFT_c0026635 3300000062 Bacteria 2192
15 JGI24697J35500_11272113 3300002507 Bacteria 4798
16 Ga0562378_2658 3300056814 Unclassified 13840
17 Ga0466701_044241 3300042598 Bacteria 190116
18 Ga0466701_091404 3300042598 Bacteria 73007
19 Ga0466706_134222 3300042599 Bacteria 5399
20 Ga0466706_173479 3300042599 Bacteria 49734
21 Ga0466706_251547 3300042599 Bacteria 84388
22 Ga0466714_040389 3300042603 Bacteria 3795
23 Ga0466719_208594 3300042606 Bacteria 13260
24 Ga0123356_10000006 3300010049 Bacteria 247371
25 Ga0123356_10269780 3300010049 Unclassified 1791
26 Ga0123353_10000166 3300010167 Bacteria 83177
27 Ga0123353_10357841 3300010167 Bacteria 2195
28 Ga0123354_10025103 3300010882 Bacteria 9399
29 Ga0160471_101084 3300012812 Unclassified 5835
30 Ga0466703_410236 3300042636 Bacteria 2803
31 Ga0466724_20392 3300042649 Bacteria 43032
32 Ga0466724_33487 3300042649 Bacteria 79889
33 Ga0160470_100169 3300012813 Bacteria 58987
34 Ga0160472_100357 3300012839 Bacteria 41006
35 Ga0160444_100570 3300012841 Bacteria 14099
36 Ga0160435_1000932 3300012857 Bacteria 7881
37 Ga0160457_1008418 3300012858 Bacteria 1487
38 IMNBL1DRAFT_c0000030 3300000062 Bacteria 129938
39 IMNBL1DRAFT_c0026878 3300000062 Bacteria 2177
40 JGI24695J34938_10001145 3300002450 Bacteria 23702
41 JGI24695J34938_10023535 3300002450 Unclassified 2968
42 JGI24703J35330_11677799 3300002501 Bacteria 1783
43 JGI24703J35330_11735581 3300002501 Bacteria 2979
44 CVPL010W_10005043 3300002931 Bacteria 14333
45 CVPL010L_1001083 3300002932 Bacteria 12930
46 Ga0466733_214729 3300042659 Bacteria 2196
47 Ga0466706_052707 3300042599 Unclassified 9358
48 Ga0466706_087602 3300042599 Unclassified 8353
49 Ga0466700_449218 3300042600 Bacteria 1481
50 Ga0466707_385701 3300042601 Bacteria 2601
51 Ga0466714_159261 3300042603 Bacteria 2014
52 Ga0466716_168734 3300042605 Bacteria 1572
53 Ga0466721_395057 3300042608 Bacteria 1427
54 Ga0466722_268467 3300042609 Bacteria 11403
55 Ga0466705_437505 3300042612 Bacteria 2812
56 Ga0466715_014633 3300042616 Bacteria 8144
57 Ga0123355_10005261 3300009826 Bacteria 18895
58 Ga0160465_101177 3300012803 Unclassified 8195
59 Ga0466730_005411 3300042625 Bacteria 2170
60 Ga0466702_310410 3300042635 Bacteria 57730
61 Ga0466724_31109 3300042649 Bacteria 49504
62 Ga0466727_262987 3300042655 Bacteria 2206
63 Ga0160433_100037 3300012846 Bacteria 158548
64 SWWA_contig07510__length_2908___numreads_51 2100351016 Bacteria 2908
65 JGI24703J35330_11748046 3300002501 Bacteria 10151
66 Ga0466733_173067 3300042659 Bacteria 7514
67 Ga0562379_0268 3300056790 Bacteria 136199
68 Ga0562378_2877 3300056814 Unclassified 12355
69 Ga0466706_002831 3300042599 Bacteria 37676
70 Ga0466706_031583 3300042599 Bacteria 20995
71 Ga0466706_032665 3300042599 Unclassified 5579
72 Ga0466706_071220 3300042599 Bacteria 12544
73 Ga0466706_166937 3300042599 Bacteria 29473
74 Ga0466706_232304 3300042599 Unclassified 13436
75 Ga0466707_350404 3300042601 Bacteria 15405
76 Ga0466714_064562 3300042603 Bacteria 45553
77 Ga0466711_332778 3300042615 Bacteria 1454
78 Ga0466715_112471 3300042616 Bacteria 7236
79 Ga0466715_144415 3300042616 Bacteria 40548
80 Ga0123355_10114375 3300009826 Bacteria 4206
81 Ga0123356_10585824 3300010049 Bacteria 1279
82 Ga0123353_10012327 3300010167 Bacteria 12141
83 Ga0123353_10049411 3300010167 Bacteria 6700
84 Ga0123353_10069428 3300010167 Bacteria 5661
85 Ga0123353_10355947 3300010167 Bacteria 2203
86 Ga0466735_210417 3300042624 Bacteria 4288
87 Ga0466730_039769 3300042625 Bacteria 41814
88 Ga0466709_352307 3300042648 Bacteria 2437
89 Ga0466724_61539 3300042649 Bacteria 3263
90 Ga0255809_1008669 3300022820 Bacteria 1374
91 Ga0415639_026716 3300038395 Bacteria 4559
92 FGTW_contig30925 2065487013 Unclassified 7608
93 2227105807 2225789004 Bacteria 9493
94 Ga0068305_10148152 3300005083 Bacteria 1511
95 Ga0072940_1379028 3300005200 Unclassified 3503
96 Ga0562379_0016 3300056790 Bacteria 1192610
97 Ga0466706_138829 3300042599 Bacteria 2705
98 Ga0466706_274406 3300042599 Unclassified 1930
99 Ga0466700_494716 3300042600 Bacteria 2899
100 Ga0466707_356416 3300042601 Bacteria 23192
101 Ga0466714_102972 3300042603 Bacteria 11382
102 Ga0466714_120213 3300042603 Bacteria 3352
103 Ga0466721_060278 3300042608 Bacteria 1237
104 Ga0466715_403879 3300042616 Bacteria 11580
105 Ga0123353_10017927 3300010167 Bacteria 10439
106 Ga0123353_10153812 3300010167 Bacteria 3670
107 Ga0415639_000895 3300038395 Bacteria 89488
108 DPOL_contig01759 2035918003 Bacteria 10659
109 2227607953 2225789004 Unclassified 12200
110 Ga0123357_10000707 3300009784 Bacteria 33513
111 Ga0562375_1315 3300056856 Bacteria 34813
112 Ga0466701_061643 3300042598 Bacteria 58895
113 Ga0466706_085592 3300042599 Unclassified 13613
114 Ga0466706_100751 3300042599 Bacteria 6295
115 Ga0466706_117767 3300042599 Unclassified 18838
116 Ga0466706_161558 3300042599 Bacteria 23538
117 Ga0466714_147045 3300042603 Bacteria 6014
118 Ga0466721_100978 3300042608 Bacteria 228571
119 Ga0466697_022999 3300042611 Bacteria 13757
120 Ga0466723_111262 3300042618 Unclassified 1206
121 Ga0123356_10007335 3300010049 Bacteria 11004
122 Ga0123353_10228889 3300010167 Bacteria 2900
123 Ga0160453_101431 3300012814 Bacteria 8274
124 DPO_contig08735 2032320009 Bacteria 73498
125 SPBB_contig11591 2044078006 Bacteria 22857
126 SWWA_contig31718__length_12923___numreads_678 2100351016 Bacteria 12923
127 2227502118 2225789004 Bacteria 3779
128 AustNasuHG_c1000039 3300000089 Bacteria 32381
129 Ga0068302_10015921 3300005071 Bacteria 6347
130 Ga0072940_1004697 3300005200 Bacteria 10333
131 Ga0466705_128064 3300042612 Bacteria 302359
132 Ga0562374_0902 3300057007 Bacteria 41188
133 Ga0466706_141554 3300042599 Unclassified 9670
134 Ga0466706_260369 3300042599 Unclassified 11122
135 Ga0466722_173116 3300042609 Bacteria 181242
136 Ga0123356_10049873 3300010049 Bacteria 3896
137 Ga0123356_10174914 3300010049 Unclassified 2162
138 Ga0123353_10009815 3300010167 Bacteria 13263
139 Ga0123353_10321680 3300010167 Bacteria 2347
140 Ga0466729_270647 3300042621 Bacteria 4127
141 Ga0466702_381445 3300042635 Unclassified 3811
142 Ga0466704_165905 3300042643 Unclassified 2276
143 Ga0160459_101708 3300012831 Bacteria 4286
144 Ga0160447_101000 3300012849 Unclassified 11674
145 Ga0160448_101849 3300012854 Bacteria 6734
146 Ga0102734_1001375 3300007129 Bacteria 13945
147 Ga0562379_3124 3300056790 Bacteria 11766
148 Ga0466706_002154 3300042599 Bacteria 19953
149 Ga0466706_150021 3300042599 Bacteria 39335
150 Ga0466706_157630 3300042599 Bacteria 63777
151 Ga0466706_169569 3300042599 Bacteria 17329
152 Ga0466706_279559 3300042599 Bacteria 2104
153 Ga0466700_447445 3300042600 Bacteria 2541
154 Ga0466714_109440 3300042603 Bacteria 1551
155 Ga0466711_277797 3300042615 Bacteria 3864
156 Ga0123355_10102305 3300009826 Bacteria 4506
157 Ga0123356_10000088 3300010049 Bacteria 96559
158 Ga0123356_10061742 3300010049 Bacteria 3500
159 Ga0123356_10237462 3300010049 Bacteria 1891
160 Ga0123353_10093220 3300010167 Bacteria 4852
161 Ga0123353_10342428 3300010167 Bacteria 2258
162 Ga0123353_10690988 3300010167 Bacteria 1434
163 Ga0123353_10872460 3300010167 Bacteria 1230
164 Ga0466730_000184 3300042625 Bacteria 3614
165 Ga0160455_100592 3300012837 Bacteria 16196
166 Ga0415639_008847 3300038395 Bacteria 27275
167 Ga0415639_010063 3300038395 Unclassified 10818
168 Ga0466696_372328 3300042596 Bacteria 19194
169 DPO_contig09150 2032320009 Bacteria 22352
170 SPBB_contig00117 2044078006 Bacteria 69125
171 IMNBL1DRAFT_c0000003 3300000062 Bacteria 275310
172 JGI24703J35330_11746920 3300002501 Bacteria 5837
173 JGI24703J35330_11748871 3300002501 Bacteria 109529

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042643 Ga0466704_165905 Ga0466704_165905_692_1639 315
2 3300042618 Ga0466723_111262 Ga0466723_111262_48_1001 317
3 3300042649 Ga0466724_33487 Ga0466724_33487_53955_55109 349
4 3300042600 Ga0466700_449218 Ga0466700_449218_172_1266 359
5 3300056790 Ga0562379_0268 Ga0562379_0268_16513_17610 359
6 3300056814 Ga0562378_2658 Ga0562378_2658_3776_4873 359
7 3300056814 Ga0562378_2877 Ga0562378_2877_3882_4979 359
8 3300057007 Ga0562374_0902 Ga0562374_0902_26947_28044 359
9 3300012846 Ga0160433_100037 Ga0160433_10003782 360
10 3300042612 Ga0466705_437505 Ga0466705_437505_1642_2730 362
11 3300010049 Ga0123356_10007335 Ga0123356_100073356 363
12 3300010049 Ga0123356_10174914 Ga0123356_101749142 363
13 3300010167 Ga0123353_10355947 Ga0123353_103559471 363
14 3300012803 Ga0160465_101177 Ga0160465_1011772 363
15 3300042606 Ga0466719_208594 Ga0466719_208594_7962_9053 363
16 3300042648 Ga0466709_352307 Ga0466709_352307_1112_2203 363
17 3300002450 JGI24695J34938_10023535 JGI24695J34938_100235352 364
18 3300042599 Ga0466706_002154 Ga0466706_002154_18841_19935 364
19 3300042599 Ga0466706_138829 Ga0466706_138829_66_1217 364
20 3300042599 Ga0466706_232304 Ga0466706_232304_19_1113 364
21 iso_pr_bacteria 2820353569 2820354730 364
22 3300002501 JGI24703J35330_11735581 JGI24703J35330_117355811 365
23 3300002501 JGI24703J35330_11748046 JGI24703J35330_117480462 365
24 3300010167 Ga0123353_10017927 Ga0123353_100179277 365
25 3300010167 Ga0123353_10228889 Ga0123353_102288891 365
26 3300042611 Ga0466697_022999 Ga0466697_022999_4078_5175 365
27 3300042615 Ga0466711_332778 Ga0466711_332778_218_1315 365
28 3300042616 Ga0466715_014633 Ga0466715_014633_497_1594 365
29 3300056790 Ga0562379_0016 Ga0562379_0016_1085742_1086839 365
30 3300009826 Ga0123355_10286456 Ga0123355_102864562 366
31 iso_pr_bacteria 2820518089 2820518621 366
32 iso_pr_bacteria 2864751016 2864752044 366
33 3300002501 JGI24703J35330_11748871 JGI24703J35330_1174887176 367
34 3300042616 Ga0466715_403879 Ga0466715_403879_918_2021 367
35 3300056856 Ga0562375_1315 Ga0562375_1315_14108_15211 367
36 iso_pr_bacteria 2834951433 2834953445 367
37 3300002501 JGI24703J35330_11677799 JGI24703J35330_116777991 368
38 3300005071 Ga0068302_10015921 Ga0068302_100159211 368
39 3300038395 Ga0415639_010063 Ga0415639_010063_119_1225 368
40 iso_pr_bacteria 2820528380 2820528988 368
41 iso_pr_bacteria 2820661146 2820662069 368
42 iso_pr_bacteria 2820690275 2820690993 368
43 iso_pr_bacteria 8030343600 8030346999 368
44 2225789004 2227105807 2227491408 369
45 3300042600 Ga0466700_447445 Ga0466700_447445_1210_2319 369
46 3300042601 Ga0466707_350404 Ga0466707_350404_14282_15391 369
47 3300042608 Ga0466721_395057 Ga0466721_395057_133_1242 369
48 3300042659 Ga0466733_173067 Ga0466733_173067_2790_3899 369
49 iso_pr_bacteria 2820234266 2820234895 369
50 iso_pr_bacteria 2820277137 2820279352 369
51 iso_pr_bacteria 2820282995 2820283401 369
52 iso_pr_bacteria 2820483401 2820484563 369
53 iso_pr_bacteria 2820507989 2820508277 369
54 iso_pr_bacteria 2820533259 2820534746 369
55 iso_pr_bacteria 2820639607 2820641126 369
56 iso_pr_bacteria 2820671341 2820671766 369
57 2225789004 2227502118 2227985725 370
58 3300002450 JGI24695J34938_10001145 JGI24695J34938_1000114513 370
59 3300009826 Ga0123355_10003518 Ga0123355_1000351813 370
60 3300009826 Ga0123355_10005261 Ga0123355_1000526111 370
61 3300009826 Ga0123355_10247323 Ga0123355_102473232 370
62 3300010167 Ga0123353_10009815 Ga0123353_100098151 370
63 3300010167 Ga0123353_10069428 Ga0123353_100694282 370
64 3300010167 Ga0123353_10690988 Ga0123353_106909882 370
65 3300022820 Ga0255809_1008669 Ga0255809_10086691 370
66 3300038395 Ga0415639_026716 Ga0415639_026716_2680_3792 370
67 3300042596 Ga0466696_372328 Ga0466696_372328_7083_8195 370
68 3300042599 Ga0466706_087602 Ga0466706_087602_6367_7479 370
69 3300042599 Ga0466706_141554 Ga0466706_141554_4985_6097 370
70 3300042599 Ga0466706_251547 Ga0466706_251547_82216_83328 370
71 3300042599 Ga0466706_260369 Ga0466706_260369_3597_4709 370
72 3300042599 Ga0466706_274406 Ga0466706_274406_753_1865 370
73 3300042600 Ga0466700_494716 Ga0466700_494716_1738_2850 370
74 3300042603 Ga0466714_040389 Ga0466714_040389_368_1480 370
75 3300042603 Ga0466714_109440 Ga0466714_109440_244_1356 370
76 3300042612 Ga0466705_128064 Ga0466705_128064_213344_214456 370
77 3300042615 Ga0466711_277797 Ga0466711_277797_918_2030 370
78 3300042624 Ga0466735_129136 Ga0466735_129136_206_1318 370
79 3300056790 Ga0562379_3124 Ga0562379_3124_8443_9573 370
80 iso_pr_bacteria 2820252425 2820254265 370
81 iso_pr_bacteria 2820275298 2820275912 370
82 iso_pr_bacteria 2820292184 2820294176 370
83 iso_pr_bacteria 2820336130 2820337100 370
84 iso_pr_bacteria 2820342392 2820342542 370
85 iso_pr_bacteria 2820362221 2820364514 370
86 iso_pr_bacteria 2820551407 2820552560 370
87 iso_pr_bacteria 2864808494 2864808922 370
88 iso_pr_bacteria 2864812326 2864812754 370
89 iso_pr_bacteria 2940230426 2940231903 370
90 iso_pr_bacteria 2940233634 2940234903 370
91 iso_pr_bacteria 2940277027 2940278321 370
92 iso_pr_bacteria 2940280053 2940280960 370
93 iso_pr_bacteria 2940283334 2940284809 370
94 iso_pr_bacteria 2940286528 2940288793 370
95 iso_pr_bacteria 2940289514 2940290383 370
96 iso_pr_bacteria 2940292506 2940293217 370
97 iso_pr_bacteria 2940295490 2940296200 370
98 iso_pr_bacteria 2944625312 2944626256 370
99 2225789004 2227607953 2228178024 371
100 3300000062 IMNBL1DRAFT_c0000030 IMNBL1DRAFT_0000030106 371
101 3300005083 Ga0068305_10148152 Ga0068305_101481522 371
102 3300009784 Ga0123357_10000707 Ga0123357_1000070718 371
103 3300009826 Ga0123355_10114375 Ga0123355_101143753 371
104 3300010167 Ga0123353_10357841 Ga0123353_103578413 371
105 3300042615 Ga0466711_282119 Ga0466711_282119_16808_17923 371
106 3300042621 Ga0466729_270647 Ga0466729_270647_1814_2929 371
107 iso_pr_bacteria 2820414148 2820416346 371
108 iso_pr_bacteria 2820707375 2820708603 371
109 iso_pr_bacteria 3003869270 3003869980 371
110 iso_pr_bacteria 3003878002 3003878808 371
111 3300000062 IMNBL1DRAFT_c0000003 IMNBL1DRAFT_000000387 372
112 3300000062 IMNBL1DRAFT_c0026635 IMNBL1DRAFT_00266352 372
113 3300010167 Ga0123353_10321680 Ga0123353_103216802 372
114 3300010167 Ga0123353_10872460 Ga0123353_108724602 372
115 3300042598 Ga0466701_061643 Ga0466701_061643_39919_41037 372
116 3300042599 Ga0466706_031583 Ga0466706_031583_10355_11473 372
117 3300042603 Ga0466714_120213 Ga0466714_120213_475_1593 372
118 3300042609 Ga0466722_173116 Ga0466722_173116_151978_153096 372
119 3300042625 Ga0466730_000184 Ga0466730_000184_1967_3085 372
120 3300042659 Ga0466733_214729 Ga0466733_214729_882_2000 372
121 iso_pr_bacteria 2529293168 2531454831 372
122 iso_pr_bacteria 2597489944 2598056922 372
123 iso_pr_bacteria 2820265624 2820265689 372
124 iso_pr_bacteria 2820272499 2820273907 372
125 iso_pr_bacteria 2820401926 2820402346 372
126 iso_pr_bacteria 8023724303 8023728912 372
127 iso_pr_bacteria 8023747282 8023752032 372
128 iso_pr_bacteria 8023752828 8023755703 372
129 iso_pr_bacteria 8023757577 8023762186 372
130 iso_pr_bacteria 8023764196 8023768739 372
131 iso_pr_bacteria 8024001094 8024001910 372
132 iso_pr_bacteria 8024014383 8024015116 372
133 iso_pr_bacteria 8024019580 8024021659 372
134 iso_pr_bacteria 8024025509 8024027534 372
135 iso_pr_bacteria 8024037630 8024038368 372
136 iso_pr_bacteria 8024044713 8024045470 372
137 iso_pr_bacteria 8025650824 8025651565 372
138 iso_pr_bacteria 8025658853 8025659934 372
139 iso_pr_bacteria 8025666332 8025667086 372
140 iso_pr_bacteria 8025671076 8025671794 372
141 iso_pr_bacteria 8025678175 8025678935 372
142 iso_pr_bacteria 8025685901 8025687026 372
143 iso_pr_bacteria 8025694439 8025695268 372
144 iso_pr_bacteria 8025701579 8025705167 372
145 iso_pr_bacteria 8025708040 8025708848 372
146 iso_pr_bacteria 8025716094 8025717145 372
147 iso_pr_bacteria 8025723035 8025723762 372
148 iso_pr_bacteria 8025728939 8025729728 372
149 iso_pr_bacteria 8025735396 8025735414 372
150 iso_pr_bacteria 8025740903 8025741637 372
151 iso_pr_bacteria 8025747911 8025748717 372
152 iso_pr_bacteria 8025756023 8025756829 372
153 iso_pr_bacteria 8069748016 8069751144 372
154 iso_pr_bacteria 8069755105 8069755911 372
155 iso_pr_bacteria 8069763219 8069763953 372
156 iso_pr_bacteria 8069770227 8069774977 372
157 iso_pr_bacteria 8069775773 8069778648 372
158 iso_pr_bacteria 8078130113 8078130848 372
159 iso_pr_bacteria 8101951471 8101952241 372
160 iso_pr_bacteria 8101960468 8101961240 372
161 iso_pr_bacteria 8101967387 8101968157 372
162 iso_pr_bacteria 8101974301 8101975076 372
163 iso_pr_bacteria 8101981714 8101982545 372
164 iso_pr_bacteria 8101988189 8101989044 372
165 iso_pr_bacteria 8101994502 8101995550 372
166 iso_pr_bacteria 8102001125 8102001815 372
167 iso_pr_bacteria 8102007614 8102008385 372
168 iso_pr_bacteria 8102014801 8102015552 372
169 iso_pr_bacteria 8102020860 8102021922 372
170 iso_pr_bacteria 8102026984 8102027863 372
171 iso_pr_bacteria 8102033761 8102034774 372
172 iso_pr_bacteria 8102041249 8102042013 372
173 iso_pr_bacteria 8102047609 8102048527 372
174 iso_pr_bacteria 8102054868 8102055656 372
175 iso_pr_bacteria 8102060671 8102061587 372
176 iso_pr_bacteria 8102067727 8102068580 372
177 iso_pr_bacteria 8102074813 8102075672 372
178 iso_pr_bacteria 8102081745 8102082679 372
179 iso_pr_bacteria 8102087471 8102088306 372
180 iso_pr_bacteria 8102094248 8102095290 372
181 iso_pr_bacteria 8102102351 8102103120 372
182 iso_pr_bacteria 8102109360 8102110145 372
183 iso_pr_bacteria 8102117041 8102117778 372
184 iso_pr_bacteria 8102124461 8102125401 372
185 iso_pr_bacteria 8102131453 8102131910 372
186 iso_pr_bacteria 8102138357 8102139084 372
187 iso_pr_bacteria 8102145433 8102150042 372
188 iso_pr_bacteria 8102152052 8102156595 372
189 iso_pr_bacteria 8102161003 8102165619 372
190 iso_pr_bacteria 8102169119 8102169137 372
191 iso_pr_bacteria 8102174626 8102175415 372
192 iso_pr_bacteria 8102181083 8102181810 372
193 iso_pr_bacteria 8102186987 8102188040 372
194 iso_pr_bacteria 8102193924 8102194731 372
195 iso_pr_bacteria 8102201977 8102205565 372
196 iso_pr_bacteria 8102208438 8102209179 372
197 iso_pr_bacteria 8102216467 8102217296 372
198 iso_pr_bacteria 8102223607 8102224325 372
199 iso_pr_bacteria 8102230706 8102231831 372
200 iso_pr_bacteria 8102239244 8102240004 372
201 iso_pr_bacteria 8102246966 8102247720 372
202 iso_pr_bacteria 8102251710 8102252791 372
203 iso_pr_bacteria 8102264549 8102265428 372
204 iso_pr_bacteria 8102271933 8102272890 372
205 iso_pr_bacteria 8102279326 8102280081 372
206 iso_pr_bacteria 8102286609 8102287601 372
207 iso_pr_bacteria 8102312426 8102313144 372
208 3300000062 IMNBL1DRAFT_c0026878 IMNBL1DRAFT_00268781 373
209 3300002507 JGI24697J35500_11272113 JGI24697J35500_112721132 373
210 3300012812 Ga0160471_101084 Ga0160471_1010843 373
211 3300012831 Ga0160459_101708 Ga0160459_1017084 373
212 3300012849 Ga0160447_101000 Ga0160447_1010003 373
213 3300042598 Ga0466701_032157 Ga0466701_032157_3943_5064 373
214 3300042599 Ga0466706_032665 Ga0466706_032665_3786_4907 373
215 3300042599 Ga0466706_071220 Ga0466706_071220_2589_3710 373
216 3300042603 Ga0466714_147045 Ga0466714_147045_3392_4513 373
217 3300042609 Ga0466722_268467 Ga0466722_268467_7448_8569 373
218 3300042616 Ga0466715_112471 Ga0466715_112471_2974_4095 373
219 3300042616 Ga0466715_144415 Ga0466715_144415_38971_40092 373
220 3300042635 Ga0466702_310410 Ga0466702_310410_33141_34262 373
221 3300042643 Ga0466704_448849 Ga0466704_448849_2888_4009 373
222 3300042649 Ga0466724_61539 Ga0466724_61539_1046_2167 373
223 3300042655 Ga0466727_262987 Ga0466727_262987_781_1902 373
224 iso_pr_bacteria 2820332331 2820333553 373
225 iso_pr_bacteria 2820573558 2820576279 373
226 iso_pr_bacteria 2827179085 2827181734 373
227 3300012805 Ga0160464_101371 Ga0160464_1013718 374
228 3300012837 Ga0160455_100592 Ga0160455_1005928 374
229 3300012858 Ga0160457_1008418 Ga0160457_10084181 374
230 3300042636 Ga0466703_410236 Ga0466703_410236_845_1969 374
231 iso_pr_bacteria 2551306396 2552923366 374
232 iso_pr_bacteria 2964144231 2964144873 374
233 iso_pr_bacteria 2964145936 2964146760 374
234 iso_pr_bacteria 2983866074 2983870337 374
235 iso_pr_bacteria 8063595521 8063596350 374
236 iso_pr_bacteria 8063597228 8063598053 374
237 3300007129 Ga0102734_1001375 Ga0102734_10013758 375
238 3300009826 Ga0123355_10102305 Ga0123355_101023054 375
239 3300042601 Ga0466707_314791 Ga0466707_314791_491_1618 375
240 3300002931 CVPL010W_10005043 CVPL010W_100050434 376
241 3300002932 CVPL010L_1001083 CVPL010L_100108315 378
242 3300038395 Ga0415639_008847 Ga0415639_008847_19865_21001 378
243 3300042599 Ga0466706_134222 Ga0466706_134222_810_1949 379
244 3300042608 Ga0466721_060278 Ga0466721_060278_83_1222 379
245 iso_pr_bacteria 2914375287 2914376104 379
246 3300010167 Ga0123353_10153812 Ga0123353_101538122 380
247 3300042599 Ga0466706_002831 Ga0466706_002831_1046_2188 380
248 3300042599 Ga0466706_052707 Ga0466706_052707_5531_6673 380
249 3300042599 Ga0466706_085592 Ga0466706_085592_1542_2684 380
250 3300042599 Ga0466706_100751 Ga0466706_100751_61_1203 380
251 3300042599 Ga0466706_117767 Ga0466706_117767_1021_2163 380
252 3300042599 Ga0466706_150021 Ga0466706_150021_31403_32545 380
253 3300042599 Ga0466706_157630 Ga0466706_157630_27043_28185 380
254 3300042599 Ga0466706_166937 Ga0466706_166937_3373_4515 380
255 3300042599 Ga0466706_169569 Ga0466706_169569_1602_2744 380
256 3300042599 Ga0466706_173479 Ga0466706_173479_47578_48720 380
257 3300042599 Ga0466706_279559 Ga0466706_279559_358_1500 380
258 3300042603 Ga0466714_159261 Ga0466714_159261_426_1568 380
259 3300042615 Ga0466711_039073 Ga0466711_039073_918_2060 380
260 3300042624 Ga0466735_210417 Ga0466735_210417_2594_3736 380
261 3300042635 Ga0466702_085745 Ga0466702_085745_109465_110607 380
262 3300042635 Ga0466702_381445 Ga0466702_381445_2231_3373 380
263 iso_pr_bacteria 2820280018 2820280933 380
264 iso_pr_bacteria 2820288918 2820289595 380
265 iso_pr_bacteria 2820296961 2820297233 380
266 iso_pr_bacteria 2820360414 2820361425 380
267 iso_pr_bacteria 2820570671 2820570971 380
268 iso_pr_bacteria 8011329375 8011332404 380
269 3300000089 AustNasuHG_c1000039 AustNasuHG_100003942 381
270 3300005200 Ga0072940_1379028 Ga0072940_13790282 381
271 3300010049 Ga0123356_10000006 Ga0123356_1000000655 381
272 3300010049 Ga0123356_10269780 Ga0123356_102697802 381
273 3300010049 Ga0123356_10585824 Ga0123356_105858241 381
274 3300010167 Ga0123353_10012327 Ga0123353_100123276 381
275 3300010167 Ga0123353_10049411 Ga0123353_100494117 381
276 3300042601 Ga0466707_356416 Ga0466707_356416_8412_9557 381
277 3300042603 Ga0466714_064562 Ga0466714_064562_11930_13075 381
278 iso_pr_bacteria 2820250282 2820250320 381
279 iso_pr_bacteria 2820259584 2820259683 381
280 iso_pr_bacteria 2820387566 2820387674 381
281 iso_pr_bacteria 2820403592 2820403701 381
282 iso_pr_bacteria 2820569216 2820570436 381
283 3300002501 JGI24703J35330_11746920 JGI24703J35330_117469204 382
284 3300010049 Ga0123356_10061742 Ga0123356_100617423 382
285 3300010882 Ga0123354_10025103 Ga0123354_1002510310 382
286 3300042598 Ga0466701_044241 Ga0466701_044241_14133_15281 382
287 3300042605 Ga0466716_168734 Ga0466716_168734_95_1243 382
288 iso_pr_bacteria 637000219 638003305 382
289 3300038395 Ga0415639_000895 Ga0415639_000895_25266_26417 383
290 3300042601 Ga0466707_385701 Ga0466707_385701_511_1662 383
291 3300042608 Ga0466721_100978 Ga0466721_100978_103456_104607 383
292 iso_pr_bacteria 2820244222 2820246376 383
293 iso_pr_bacteria 2820254385 2820254528 383
294 iso_pr_bacteria 2820294436 2820296685 383
295 iso_pr_bacteria 2820321184 2820322435 383
296 iso_pr_bacteria 2820453354 2820453778 383
297 iso_pr_bacteria 2820560510 2820560937 383
298 3300010049 Ga0123356_10000088 Ga0123356_100000881 384
299 3300010049 Ga0123356_10049873 Ga0123356_100498735 384
300 3300010167 Ga0123353_10000166 Ga0123353_1000016617 384
301 3300010167 Ga0123353_10093220 Ga0123353_100932204 384
302 3300042598 Ga0466701_091404 Ga0466701_091404_67005_68159 384
303 3300042625 Ga0466730_039769 Ga0466730_039769_23342_24496 384
304 3300042649 Ga0466724_20392 Ga0466724_20392_33551_34705 384
305 3300042649 Ga0466724_31109 Ga0466724_31109_13912_15066 384
306 3300056790 Ga0562379_0003 Ga0562379_0003_123360_124514 384
307 iso_pr_bacteria 2990166910 2990171145 384
308 iso_pr_bacteria 3007473699 3007478452 384
309 iso_pr_bacteria 3007478678 3007484741 384
310 iso_pr_bacteria 8035422605 8035426108 384
311 iso_pr_bacteria 8052469819 8052471679 384
312 3300010167 Ga0123353_10342428 Ga0123353_103424283 385
313 3300012814 Ga0160453_101431 Ga0160453_1014312 385
314 2032320009 DPO_contig08735 DPOB_441650 386
315 2035918003 DPOL_contig01759 DPOLB_1127330 386
316 2035918003 DPOL_contig15748 DPOLB_1530290 386
317 2044078006 SPBB_contig00117 SPBB_1119630 386
318 2044078006 SPBB_contig11591 SPBB_529630 386
319 2065487013 FGTW_contig30925 FGTW_00444920 386
320 2100351016 SWWA_contig07510__length_2908___numreads_51 SWWA_01443070 386
321 2100351016 SWWA_contig31718__length_12923___numreads_678 SWWA_02189690 386
322 3300042625 Ga0466730_005411 Ga0466730_005411_95_1255 386
323 iso_pr_bacteria 2519899622 2520386740 386
324 iso_pr_bacteria 2864739902 2864740133 386
325 iso_pr_bacteria 2864745180 2864747646 386
326 iso_pr_bacteria 2864847319 2864851598 386
327 iso_pr_bacteria 2864853652 2864854220 386
328 iso_pr_bacteria 2864903489 2864905351 386
329 iso_pr_bacteria 2864926767 2864929345 386
330 iso_pr_bacteria 2997878596 2997878601 386
331 iso_pr_bacteria 8035321120 8035324909 386
332 iso_pr_bacteria 8035326735 8035330185 386
333 2032320009 DPO_contig09150 DPOB_123160 387
334 3300012813 Ga0160470_100169 Ga0160470_1001692 387
335 3300012839 Ga0160472_100357 Ga0160472_10035714 387
336 3300012841 Ga0160444_100570 Ga0160444_1005705 387
337 3300012854 Ga0160448_101849 Ga0160448_1018494 387
338 3300012857 Ga0160435_1000932 Ga0160435_10009325 387
339 3300010049 Ga0123356_10237462 Ga0123356_102374622 401
340 3300042599 Ga0466706_161558 Ga0466706_161558_181_1389 402
341 iso_pr_bacteria 2820418027 2820419818 403
342 iso_pr_bacteria 2518645556 2518833362 406
343 3300042603 Ga0466714_102972 Ga0466714_102972_2806_4047 413
344 3300005200 Ga0072940_1004697 Ga0072940_10046971 453

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF17912 OB_MalK MalK OB fold domain 236 302 0.93
PF00005 ABC_tran ABC transporter 21 162 0.92
PF08402 TOBE_2 TOBE domain 295 364 0.86

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.79 0.88 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.