Protein Family IF01223

Metagenome Isolate
110 Members
38 Samples
106 Scaffolds
283.48 Avg Length

🧬 Representative Sequence

ID
3300005083|Ga0068305_10922660|Ga0068305_109226602
Length
324 aa
Sequence
MGSLRGLAACCAGRSFAEKAAENPEKRAAGSLAGDYRLGLYEKAMPPGLSFEEKLEAAKGGGFDFLELSIDETDEKLARLDWTGAEIRALLRAVQDRDMPVSSICLSGHRRFPLGDPDPETRARGLEIMEKAILLAGRLGVRLIQIAGYDVYYKPGDETTRSLFAENLARSVEMAARSSVLLAFETMETPFLNTVEKAMVWVRKFSSPYLAVYPDLGNITCAAGGDRRAVAADLEKGRGHLAALHLKETRPGVFREVPYGEGHVDFGEGIKTAWALGVRMFNAEFWWTPAVGEGWRALLEKNAAFLRGKIGEDVTVNFNHRDP*

📊 Sample Types

Isolate 3.6%
Metagenome 96.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 34.2%
Termitidae 26.3%
Unclassified 18.4%
Rhinotermitidae 10.5%
Termopsidae 7.9%
Hodotermitidae 2.6%

🌳 Taxonomy

Archaea 1
Bacteria 106
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125652 Treponema sp. Cu122P5bin1 Isolate Unclassified
2 2781125685 Treponema sp. Lab288P1bin13 Isolate Unclassified
3 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
4 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
5 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
6 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
7 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
8 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
9 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
10 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
11 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
12 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
13 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
14 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
15 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
16 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
17 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
18 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
19 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
20 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
21 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
22 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
23 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
24 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
25 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
26 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
27 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
28 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
29 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
30 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
31 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
32 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
33 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
34 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
35 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
36 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
37 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
38 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466707_406554 3300042601 Bacteria 2414
2 Ga0466713_043845 3300042602 Bacteria 115614
3 Ga0466716_299204 3300042605 Unclassified 1935
4 Ga0466719_348275 3300042606 Bacteria 1635
5 Ga0466705_394256 3300042612 Bacteria 20674
6 Ga0466705_523754 3300042612 Bacteria 6694
7 Ga0466723_172557 3300042618 Bacteria 4243
8 Ga0466728_112463 3300042620 Bacteria 3816
9 Ga0466690_183201 3300042590 Bacteria 2312
10 Ga0466690_186779 3300042590 Bacteria 6619
11 Ga0466691_010181 3300042593 Bacteria 15310
12 Ga0123353_10257945 3300010167 Bacteria 2695
13 Ga0466703_070280 3300042636 Bacteria 7199
14 Ga0466703_099422 3300042636 Bacteria 9978
15 Ga0123357_10001103 3300009784 Bacteria 27990
16 Ga0466707_078617 3300042601 Bacteria 1998
17 Ga0466719_133300 3300042606 Bacteria 4755
18 Ga0466711_118855 3300042615 Bacteria 11396
19 Ga0466715_015275 3300042616 Bacteria 5861
20 Ga0466718_136488 3300042617 Bacteria 3462
21 Ga0466723_212087 3300042618 Bacteria 1482
22 Ga0466723_304266 3300042618 Bacteria 5211
23 Ga0466726_275557 3300042619 Bacteria 1119
24 Ga0466690_020743 3300042590 Bacteria 4756
25 Ga0466690_194791 3300042590 Bacteria 3766
26 Ga0466692_152595 3300042591 Bacteria 2190
27 Ga0466691_023778 3300042593 Bacteria 29657
28 Ga0466691_183986 3300042593 Bacteria 7931
29 Ga0123354_10169877 3300010882 Unclassified 2543
30 Ga0466705_317216 3300042612 Bacteria 18450
31 Ga0466704_055884 3300042643 Bacteria 73215
32 Ga0466704_275455 3300042643 Bacteria 13689
33 Ga0466716_283114 3300042605 Bacteria 7641
34 Ga0466723_277846 3300042618 Bacteria 8582
35 Ga0466694_169990 3300042594 Bacteria 1325
36 Ga0466703_375575 3300042636 Bacteria 12370
37 Ga0466704_341431 3300042643 Bacteria 1497
38 Ga0466704_584315 3300042643 Bacteria 1311
39 Ga0466727_300364 3300042655 Bacteria 1308
40 Ga0068305_10922660 3300005083 Bacteria 2602
41 Ga0466706_148571 3300042599 Bacteria 2656
42 Ga0466707_406641 3300042601 Bacteria 4462
43 Ga0466719_058933 3300042606 Bacteria 4077
44 Ga0466723_010074 3300042618 Bacteria 7246
45 Ga0466726_014565 3300042619 Bacteria 1497
46 Ga0466692_035618 3300042591 Bacteria 7133
47 Ga0466691_207462 3300042593 Bacteria 8152
48 Ga0123357_10104557 3300009784 Bacteria 3635
49 Ga0466705_073172 3300042612 Bacteria 1446
50 Ga0466703_008219 3300042636 Bacteria 15461
51 Ga0466703_017911 3300042636 Bacteria 4811
52 Ga0466703_256484 3300042636 Bacteria 12078
53 Ga0466704_335796 3300042643 Bacteria 67702
54 Ga0072940_1223851 3300005200 Bacteria 4249
55 Ga0466700_495127 3300042600 Archaea 1460
56 Ga0466717_053705 3300042604 Bacteria 1382
57 Ga0466715_308218 3300042616 Bacteria 1617
58 Ga0466723_080860 3300042618 Bacteria 3801
59 Ga0466690_331614 3300042590 Bacteria 6721
60 Ga0466705_067689 3300042612 Unclassified 1035
61 Ga0466703_049531 3300042636 Bacteria 42822
62 Ga0466727_080136 3300042655 Bacteria 1897
63 Ga0466707_345199 3300042601 Bacteria 1156
64 Ga0466719_167098 3300042606 Bacteria 38069
65 Ga0466719_356796 3300042606 Bacteria 3826
66 Ga0466715_356871 3300042616 Bacteria 26175
67 Ga0415639_202855 3300038395 Bacteria 1972
68 Ga0456237_0000119 3300041968 Bacteria 11641
69 Ga0466690_218839 3300042590 Bacteria 9807
70 Ga0466691_058953 3300042593 Bacteria 19492
71 Ga0466696_264993 3300042596 Bacteria 4704
72 Ga0123353_10269028 3300010167 Bacteria 2627
73 Ga0123353_10346445 3300010167 Bacteria 2241
74 Ga0466705_016553 3300042612 Bacteria 1503
75 Ga0466705_176870 3300042612 Bacteria 2966
76 Ga0466735_039233 3300042624 Bacteria 12442
77 Ga0466703_024326 3300042636 Bacteria 2444
78 Ga0466703_227062 3300042636 Bacteria 13903
79 Ga0466704_387013 3300042643 Bacteria 3266
80 Ga0466709_115669 3300042648 Bacteria 217304
81 Ga0466706_138260 3300042599 Bacteria 1533
82 Ga0466706_170397 3300042599 Bacteria 6967
83 Ga0466719_094348 3300042606 Bacteria 14801
84 Ga0466711_115224 3300042615 Bacteria 1197
85 Ga0466715_322054 3300042616 Bacteria 11900
86 Ga0466715_326990 3300042616 Bacteria 2213
87 Ga0466723_018082 3300042618 Bacteria 4680
88 Ga0466723_064185 3300042618 Bacteria 19759
89 Ga0466723_211951 3300042618 Bacteria 2327
90 Ga0466690_025761 3300042590 Bacteria 4292
91 Ga0466699_019687 3300042597 Bacteria 1099
92 Ga0123353_10090367 3300010167 Bacteria 4931
93 Ga0466705_023303 3300042612 Bacteria 2186
94 Ga0466704_027870 3300042643 Bacteria 7376
95 Ga0466709_373763 3300042648 Bacteria 29333
96 Ga0466727_046302 3300042655 Bacteria 1850
97 Ga0466716_312097 3300042605 Bacteria 4570
98 Ga0466716_468865 3300042605 Bacteria 2727
99 Ga0466722_150664 3300042609 Bacteria 25191
100 Ga0466715_516662 3300042616 Bacteria 30690
101 Ga0466692_092846 3300042591 Bacteria 1250
102 Ga0466694_037428 3300042594 Bacteria 17187
103 Ga0123353_10514717 3300010167 Bacteria 1739
104 Ga0466705_086225 3300042612 Bacteria 10012
105 Ga0466729_229187 3300042621 Bacteria 2145
106 Ga0466709_093189 3300042648 Bacteria 3037

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042612 Ga0466705_394256 Ga0466705_394256_5414_6277 261
2 3300005200 Ga0072940_1223851 Ga0072940_12238512 262
3 3300042615 Ga0466711_115224 Ga0466711_115224_26_820 264
4 3300042597 Ga0466699_019687 Ga0466699_019687_79_876 265
5 3300042612 Ga0466705_067689 Ga0466705_067689_24_827 267
6 3300042618 Ga0466723_211951 Ga0466723_211951_1410_2216 268
7 3300010882 Ga0123354_10169877 Ga0123354_101698772 269
8 3300042596 Ga0466696_264993 Ga0466696_264993_157_966 269
9 3300042612 Ga0466705_523754 Ga0466705_523754_1047_1859 270
10 3300042636 Ga0466703_099422 Ga0466703_099422_8428_9240 270
11 3300042594 Ga0466694_169990 Ga0466694_169990_434_1249 271
12 3300042617 Ga0466718_136488 Ga0466718_136488_1523_2338 271
13 3300042605 Ga0466716_312097 Ga0466716_312097_2533_3351 272
14 3300010167 Ga0123353_10090367 Ga0123353_100903673 273
15 3300010167 Ga0123353_10257945 Ga0123353_102579452 273
16 3300010167 Ga0123353_10346445 Ga0123353_103464452 273
17 3300042590 Ga0466690_025761 Ga0466690_025761_116_937 273
18 3300042621 Ga0466729_229187 Ga0466729_229187_427_1248 273
19 3300042590 Ga0466690_183201 Ga0466690_183201_119_949 276
20 3300042616 Ga0466715_308218 Ga0466715_308218_342_1178 278
21 3300010167 Ga0123353_10514717 Ga0123353_105147172 279
22 iso_pr_bacteria 2781125685 2781416580 279
23 3300042599 Ga0466706_138260 Ga0466706_138260_317_1159 280
24 3300042600 Ga0466700_495127 Ga0466700_495127_175_1017 280
25 3300042601 Ga0466707_078617 Ga0466707_078617_198_1040 280
26 3300042602 Ga0466713_043845 Ga0466713_043845_14929_15771 280
27 3300042612 Ga0466705_023303 Ga0466705_023303_989_1831 280
28 3300042612 Ga0466705_086225 Ga0466705_086225_9013_9855 280
29 3300042636 Ga0466703_070280 Ga0466703_070280_5971_6813 280
30 3300042643 Ga0466704_341431 Ga0466704_341431_254_1096 280
31 3300042643 Ga0466704_584315 Ga0466704_584315_91_933 280
32 3300042648 Ga0466709_115669 Ga0466709_115669_204139_204981 280
33 3300042655 Ga0466727_300364 Ga0466727_300364_91_933 280
34 3300010167 Ga0123353_10269028 Ga0123353_102690282 281
35 3300042599 Ga0466706_148571 Ga0466706_148571_89_934 281
36 3300042599 Ga0466706_170397 Ga0466706_170397_5892_6737 281
37 3300042601 Ga0466707_406641 Ga0466707_406641_947_1792 281
38 3300042619 Ga0466726_275557 Ga0466726_275557_154_999 281
39 3300042636 Ga0466703_375575 Ga0466703_375575_154_999 281
40 3300042655 Ga0466727_046302 Ga0466727_046302_538_1383 281
41 3300042605 Ga0466716_283114 Ga0466716_283114_3475_4323 282
42 3300042605 Ga0466716_299204 Ga0466716_299204_698_1546 282
43 3300042606 Ga0466719_058933 Ga0466719_058933_828_1676 282
44 3300042620 Ga0466728_112463 Ga0466728_112463_379_1227 282
45 3300042636 Ga0466703_256484 Ga0466703_256484_4744_5592 282
46 3300042643 Ga0466704_027870 Ga0466704_027870_5743_6591 282
47 3300042648 Ga0466709_373763 Ga0466709_373763_7273_8121 282
48 iso_pr_bacteria 2781125652 2781311065 282
49 iso_pr_bacteria 2781125666 2781344728 282
50 3300009784 Ga0123357_10001103 Ga0123357_1000110311 283
51 3300009784 Ga0123357_10104557 Ga0123357_101045573 283
52 3300038395 Ga0415639_202855 Ga0415639_202855_609_1460 283
53 3300042593 Ga0466691_023778 Ga0466691_023778_25760_26611 283
54 3300042593 Ga0466691_058953 Ga0466691_058953_13895_14746 283
55 3300042594 Ga0466694_037428 Ga0466694_037428_1683_2534 283
56 3300042604 Ga0466717_053705 Ga0466717_053705_253_1104 283
57 3300042606 Ga0466719_094348 Ga0466719_094348_12456_13307 283
58 3300042606 Ga0466719_356796 Ga0466719_356796_1142_1993 283
59 3300042612 Ga0466705_176870 Ga0466705_176870_1985_2836 283
60 3300042612 Ga0466705_317216 Ga0466705_317216_407_1258 283
61 3300042618 Ga0466723_064185 Ga0466723_064185_621_1472 283
62 3300042618 Ga0466723_172557 Ga0466723_172557_2099_2950 283
63 3300042605 Ga0466716_468865 Ga0466716_468865_79_933 284
64 3300042612 Ga0466705_016553 Ga0466705_016553_492_1346 284
65 3300042612 Ga0466705_073172 Ga0466705_073172_452_1306 284
66 3300042616 Ga0466715_516662 Ga0466715_516662_3138_3992 284
67 3300042636 Ga0466703_017911 Ga0466703_017911_1544_2398 284
68 3300042643 Ga0466704_387013 Ga0466704_387013_1565_2419 284
69 3300042655 Ga0466727_080136 Ga0466727_080136_1032_1886 284
70 3300042591 Ga0466692_092846 Ga0466692_092846_199_1056 285
71 3300042591 Ga0466692_152595 Ga0466692_152595_1033_1890 285
72 3300042609 Ga0466722_150664 Ga0466722_150664_4938_5795 285
73 3300042618 Ga0466723_018082 Ga0466723_018082_3056_3913 285
74 3300042619 Ga0466726_014565 Ga0466726_014565_205_1062 285
75 3300042618 Ga0466723_010074 Ga0466723_010074_2307_3167 286
76 3300042643 Ga0466704_275455 Ga0466704_275455_6280_7140 286
77 3300042593 Ga0466691_010181 Ga0466691_010181_7156_8019 287
78 3300042615 Ga0466711_118855 Ga0466711_118855_9059_9922 287
79 3300042636 Ga0466703_227062 Ga0466703_227062_12003_12866 287
80 3300042648 Ga0466709_093189 Ga0466709_093189_301_1164 287
81 3300042590 Ga0466690_194791 Ga0466690_194791_1197_2063 288
82 3300042624 Ga0466735_039233 Ga0466735_039233_536_1402 288
83 3300042636 Ga0466703_024326 Ga0466703_024326_150_1016 288
84 3300042606 Ga0466719_133300 Ga0466719_133300_1586_2455 289
85 3300042606 Ga0466719_348275 Ga0466719_348275_683_1552 289
86 3300042616 Ga0466715_015275 Ga0466715_015275_1478_2347 289
87 3300042616 Ga0466715_326990 Ga0466715_326990_1055_1924 289
88 3300042618 Ga0466723_212087 Ga0466723_212087_556_1425 289
89 3300042618 Ga0466723_277846 Ga0466723_277846_5838_6707 289
90 3300042618 Ga0466723_304266 Ga0466723_304266_4251_5120 289
91 3300042636 Ga0466703_049531 Ga0466703_049531_2936_3808 290
92 3300042593 Ga0466691_207462 Ga0466691_207462_2521_3396 291
93 3300042601 Ga0466707_406554 Ga0466707_406554_1512_2387 291
94 3300042590 Ga0466690_020743 Ga0466690_020743_609_1490 293
95 3300042590 Ga0466690_186779 Ga0466690_186779_5704_6585 293
96 3300042601 Ga0466707_345199 Ga0466707_345199_43_924 293
97 3300042636 Ga0466703_008219 Ga0466703_008219_1858_2739 293
98 iso_pr_bacteria 650716099 650878512 293
99 3300042606 Ga0466719_167098 Ga0466719_167098_31350_32234 294
100 3300042593 Ga0466691_183986 Ga0466691_183986_5570_6457 295
101 3300042643 Ga0466704_055884 Ga0466704_055884_50383_51270 295
102 3300042616 Ga0466715_322054 Ga0466715_322054_3489_4379 296
103 3300041968 Ga0456237_0000119 Ga0456237_0000119_2719_3612 297
104 3300042591 Ga0466692_035618 Ga0466692_035618_6042_6935 297
105 3300042618 Ga0466723_080860 Ga0466723_080860_2788_3681 297
106 3300042643 Ga0466704_335796 Ga0466704_335796_3783_4676 297
107 3300042590 Ga0466690_331614 Ga0466690_331614_2839_3738 299
108 3300042616 Ga0466715_356871 Ga0466715_356871_15653_16573 306
109 3300042590 Ga0466690_218839 Ga0466690_218839_298_1227 309
110 3300005083 Ga0068305_10922660 Ga0068305_109226602 324

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel 56 305 0.88

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
3cqi-assembly1.cif.gz_B Crystal Structure of L-xylulose-5-phosphate 3-epimerase UlaE (form B) complex with sulfate 0.964 36 310
3cqj-assembly1.cif.gz_B Crystal Structure of L-xylulose-5-phosphate 3-epimerase UlaE (form B) complex with Zn2+ 0.964 36 310
3cqk-assembly1.cif.gz_B Crystal Structure of L-xylulose-5-phosphate 3-epimerase UlaE (form B) complex with Zn2+ and sulfate 0.949 36 310
3cqh-assembly1.cif.gz_B Crystal Structure of L-xylulose-5-phosphate 3-epimerase UlaE from the Anaerobic L-ascorbate Utilization Pathway of Escherichia coli 0.94 37 310
3cqh-assembly1.cif.gz_A Crystal Structure of L-xylulose-5-phosphate 3-epimerase UlaE from the Anaerobic L-ascorbate Utilization Pathway of Escherichia coli 0.927 36 310
IDDescriptionScoreStartEndSuperfamily
3cqiB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9644 36 310 3.20.20.150
3cqhB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9318 37 309 3.20.20.150
af_P45541_1_270_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8668 37 308 3.20.20.150
af_P76044_1_262_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8425 37 308 3.20.20.150
af_Q58587_1_265_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8208 36 302 3.20.20.150
IDDescriptionScoreStartEndGO Terms
AF-A0A4Q8WR59-F1-model_v4 Uncharacterized/unreviewed 0.991 36 220
AF-A0A7X8W8A4-F1-model_v4 Uncharacterized/unreviewed 0.9887 35 224

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.84 0.9 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.