Protein Family IF01213
Metagenome
Isolate
124
Members
46
Samples
119
Scaffolds
209.31
Avg Length
Representative Sequence
- ID
- 3300005083|Ga0068305_10332061|Ga0068305_103320612
- Length
- 230 aa
- Sequence
- MPRFFLLLQSQISTCNTKFMQIINLKDIKNIVFDLGGVIITLDHARAIERFKAAGVSRAAEYLDPYHQNGIFLDLEAGRLTKEEFGEALRRETGKNIPDSAIAHGWLGFLKDVPPQKLAMLEDLRQRGFRLYLLSNTNPLVMEWALTSDFSPAGKPLDSYFDRMYLSYQMKCVKPDLEIFQKMIADSGMKPEETLFIDDGKNNVVAAAQLGFHTYQPRNGEDFADLFRF*
Sample Types
Isolate
4.0%
Metagenome
96.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
37.8%
Kalotermitidae
26.7%
Unclassified
13.3%
Rhinotermitidae
6.7%
Termopsidae
6.7%
Blattidae
4.4%
Passalidae
4.4%
Taxonomy
Archaea
1
Bacteria
119
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 2 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 3 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 4 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 5 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 6 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 7 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 8 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 9 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 10 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 11 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 12 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 13 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 14 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 15 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 16 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 17 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 18 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 19 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 20 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 21 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 22 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 23 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 24 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 25 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 26 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 27 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 28 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 29 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 30 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 31 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 32 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 33 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 34 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 35 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 36 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 37 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 38 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 39 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 40 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 41 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 42 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 43 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 44 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 45 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 46 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466715_159807 | 3300042616 | Bacteria | 19701 |
| 2 | Ga0466715_305516 | 3300042616 | Bacteria | 7694 |
| 3 | Ga0466715_459244 | 3300042616 | Bacteria | 40519 |
| 4 | Ga0466726_458338 | 3300042619 | Bacteria | 2434 |
| 5 | Ga0466729_204169 | 3300042621 | Bacteria | 3894 |
| 6 | Ga0466703_183488 | 3300042636 | Bacteria | 1174 |
| 7 | Ga0466704_141215 | 3300042643 | Bacteria | 14513 |
| 8 | Ga0466704_354911 | 3300042643 | Bacteria | 15781 |
| 9 | Ga0123354_10001044 | 3300010882 | Bacteria | 31803 |
| 10 | 2227496865 | 2225789004 | Bacteria | 3913 |
| 11 | Ga0466701_023951 | 3300042598 | Bacteria | 11112 |
| 12 | Ga0466707_171217 | 3300042601 | Bacteria | 16651 |
| 13 | Ga0466719_095212 | 3300042606 | Bacteria | 6204 |
| 14 | Ga0466719_388389 | 3300042606 | Bacteria | 1244 |
| 15 | Ga0466733_124766 | 3300042659 | Bacteria | 2169 |
| 16 | Ga0466704_123162 | 3300042643 | Bacteria | 5623 |
| 17 | Ga0466709_361030 | 3300042648 | Bacteria | 5642 |
| 18 | Ga0123354_10405245 | 3300010882 | Bacteria | 1150 |
| 19 | IMNBL1DRAFT_c0101960 | 3300000062 | Bacteria | 771 |
| 20 | Ga0068305_10394183 | 3300005083 | Bacteria | 1113 |
| 21 | Ga0072941_1550994 | 3300005201 | Bacteria | 1566 |
| 22 | Ga0466701_034992 | 3300042598 | Bacteria | 1842 |
| 23 | Ga0466701_098080 | 3300042598 | Bacteria | 65896 |
| 24 | Ga0466713_009775 | 3300042602 | Bacteria | 66246 |
| 25 | Ga0466713_054718 | 3300042602 | Bacteria | 26012 |
| 26 | Ga0466713_133339 | 3300042602 | Unclassified | 6176 |
| 27 | Ga0466719_248971 | 3300042606 | Bacteria | 12171 |
| 28 | Ga0466690_062794 | 3300042590 | Bacteria | 1024 |
| 29 | Ga0466690_169631 | 3300042590 | Bacteria | 13199 |
| 30 | Ga0466735_076017 | 3300042624 | Bacteria | 1888 |
| 31 | Ga0466704_194858 | 3300042643 | Bacteria | 20469 |
| 32 | Ga0466727_079881 | 3300042655 | Bacteria | 3045 |
| 33 | Ga0123354_10015129 | 3300010882 | Bacteria | 12033 |
| 34 | Ga0123354_10044609 | 3300010882 | Bacteria | 6796 |
| 35 | Ga0123354_10216796 | 3300010882 | Bacteria | 2048 |
| 36 | IMNBL1DRAFT_c0024767 | 3300000062 | Bacteria | 2316 |
| 37 | Ga0068305_10373841 | 3300005083 | Unclassified | 2494 |
| 38 | Ga0466707_144970 | 3300042601 | Bacteria | 107655 |
| 39 | Ga0466716_029554 | 3300042605 | Bacteria | 22788 |
| 40 | Ga0466716_155522 | 3300042605 | Bacteria | 5523 |
| 41 | Ga0466719_018562 | 3300042606 | Bacteria | 9891 |
| 42 | Ga0466693_255414 | 3300042592 | Bacteria | 1772 |
| 43 | Ga0466696_058157 | 3300042596 | Bacteria | 2348 |
| 44 | Ga0466697_246626 | 3300042611 | Bacteria | 3103 |
| 45 | Ga0466705_147552 | 3300042612 | Bacteria | 14073 |
| 46 | Ga0466729_279572 | 3300042621 | Bacteria | 3006 |
| 47 | Ga0466734_137251 | 3300042623 | Bacteria | 1207 |
| 48 | Ga0466735_235871 | 3300042624 | Bacteria | 3594 |
| 49 | Ga0466708_086991 | 3300042652 | Bacteria | 84818 |
| 50 | Ga0123353_11681055 | 3300010167 | Bacteria | 796 |
| 51 | Ga0123354_10004213 | 3300010882 | Bacteria | 20291 |
| 52 | IMNBL1DRAFT_c0004944 | 3300000062 | Unclassified | 7796 |
| 53 | Ga0068305_10102761 | 3300005083 | Bacteria | 3362 |
| 54 | Ga0466700_387135 | 3300042600 | Bacteria | 3909 |
| 55 | Ga0466713_048900 | 3300042602 | Bacteria | 39147 |
| 56 | Ga0466719_160725 | 3300042606 | Bacteria | 1015 |
| 57 | Ga0466722_117502 | 3300042609 | Bacteria | 4019 |
| 58 | Ga0466692_073426 | 3300042591 | Bacteria | 43614 |
| 59 | Ga0466696_360854 | 3300042596 | Bacteria | 2205 |
| 60 | Ga0466697_159766 | 3300042611 | Bacteria | 1040 |
| 61 | Ga0466705_395757 | 3300042612 | Bacteria | 7249 |
| 62 | Ga0466715_029877 | 3300042616 | Bacteria | 5701 |
| 63 | Ga0123357_10134048 | 3300009784 | Bacteria | 3071 |
| 64 | Ga0123356_10092702 | 3300010049 | Bacteria | 2881 |
| 65 | JGI24699J35502_11133220 | 3300002509 | Bacteria | 9277 |
| 66 | JGI24699J35502_11134126 | 3300002509 | Bacteria | 34532 |
| 67 | JGI24696J40584_12902754 | 3300002834 | Bacteria | 1197 |
| 68 | Ga0068305_10332061 | 3300005083 | Bacteria | 1383 |
| 69 | Ga0123357_10001409 | 3300009784 | Bacteria | 25443 |
| 70 | Ga0466707_040196 | 3300042601 | Bacteria | 3673 |
| 71 | Ga0466707_055689 | 3300042601 | Bacteria | 3229 |
| 72 | Ga0466713_102905 | 3300042602 | Bacteria | 10717 |
| 73 | Ga0466722_029480 | 3300042609 | Bacteria | 2446 |
| 74 | Ga0466698_404409 | 3300042610 | Bacteria | 1564 |
| 75 | Ga0466656_269934 | 3300042550 | Bacteria | 13790 |
| 76 | Ga0466690_203578 | 3300042590 | Bacteria | 19293 |
| 77 | Ga0466705_094253 | 3300042612 | Bacteria | 10518 |
| 78 | Ga0466705_427892 | 3300042612 | Unclassified | 1064 |
| 79 | Ga0466708_060795 | 3300042652 | Bacteria | 9950 |
| 80 | Ga0123357_10264172 | 3300009784 | Bacteria | 1813 |
| 81 | Ga0123353_10351865 | 3300010167 | Bacteria | 2219 |
| 82 | Ga0123354_10428155 | 3300010882 | Bacteria | 1093 |
| 83 | JGI24695J34938_10150231 | 3300002450 | Archaea | 954 |
| 84 | JGI24702J35022_10103897 | 3300002462 | Bacteria | 1558 |
| 85 | Ga0466707_298022 | 3300042601 | Bacteria | 1518 |
| 86 | Ga0466713_055250 | 3300042602 | Bacteria | 2397 |
| 87 | Ga0466713_120276 | 3300042602 | Bacteria | 10363 |
| 88 | Ga0466713_145607 | 3300042602 | Bacteria | 14033 |
| 89 | Ga0466719_558674 | 3300042606 | Bacteria | 2027 |
| 90 | Ga0466722_160000 | 3300042609 | Bacteria | 2201 |
| 91 | Ga0466691_047346 | 3300042593 | Bacteria | 83606 |
| 92 | Ga0466691_051237 | 3300042593 | Bacteria | 17740 |
| 93 | Ga0466726_248477 | 3300042619 | Bacteria | 2783 |
| 94 | Ga0466729_281449 | 3300042621 | Bacteria | 3602 |
| 95 | Ga0123357_10034913 | 3300009784 | Bacteria | 6836 |
| 96 | Ga0123357_10205700 | 3300009784 | Bacteria | 2227 |
| 97 | Ga0123354_10206905 | 3300010882 | Bacteria | 2135 |
| 98 | 2227082221 | 2225789004 | Bacteria | 1874 |
| 99 | JGI24699J35502_11134157 | 3300002509 | Bacteria | 40557 |
| 100 | Ga0123357_10002416 | 3300009784 | Bacteria | 20828 |
| 101 | Ga0466700_084952 | 3300042600 | Bacteria | 4546 |
| 102 | Ga0466690_387157 | 3300042590 | Bacteria | 5912 |
| 103 | Ga0466696_404625 | 3300042596 | Bacteria | 2046 |
| 104 | Ga0466732_248436 | 3300042656 | Bacteria | 1779 |
| 105 | Ga0466711_306086 | 3300042615 | Bacteria | 5439 |
| 106 | Ga0466715_150656 | 3300042616 | Bacteria | 3085 |
| 107 | Ga0466703_101524 | 3300042636 | Bacteria | 5328 |
| 108 | Ga0466704_362201 | 3300042643 | Bacteria | 7723 |
| 109 | Ga0123357_10020389 | 3300009784 | Bacteria | 8860 |
| 110 | Ga0123357_10251898 | 3300009784 | Bacteria | 1887 |
| 111 | Ga0123354_10046614 | 3300010882 | Bacteria | 6619 |
| 112 | IMNBL1DRAFT_c0000815 | 3300000062 | Bacteria | 24587 |
| 113 | IMNBL1DRAFT_c0009991 | 3300000062 | Bacteria | 4603 |
| 114 | JGI24702J35022_10062460 | 3300002462 | Bacteria | 1994 |
| 115 | JGI24696J40584_12951709 | 3300002834 | Bacteria | 2271 |
| 116 | Ga0466700_137703 | 3300042600 | Bacteria | 14926 |
| 117 | Ga0466707_073803 | 3300042601 | Bacteria | 2351 |
| 118 | Ga0466716_243809 | 3300042605 | Bacteria | 5172 |
| 119 | Ga0466691_227760 | 3300042593 | Bacteria | 5506 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.