Protein Family IF01208
Metagenome
Isolate
130
Members
63
Samples
112
Scaffolds
109.24
Avg Length
Representative Sequence
- ID
- 3300005083|Ga0068305_10234432|Ga0068305_102344324
- Length
- 123 aa
- Sequence
- VEKIAENKELTLKDTQKLVDEWIKTYGVRYFSELTNMAVLTEEVGELARVIARTYGDQSFKKEDLSHSLADEMADVLWVLLCLANQTGVDLTDAFLANIHKKTRRDNVRHQQNEKLKNVPQS*
Sample Types
Isolate
13.8%
Metagenome
86.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
24.2%
Kalotermitidae
19.4%
Blattidae
17.7%
Unclassified
11.3%
Rhinotermitidae
6.5%
Termopsidae
6.5%
Passalidae
4.8%
Drosophilidae
3.2%
Hydrophilidae
3.2%
Hodotermitidae
1.6%
Tenebrionidae
1.6%
Taxonomy
Archaea
0
Bacteria
128
Eukaryota
0
Viruses
0
Unclassified
2
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 2 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 3 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 4 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 5 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 6 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 7 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 8 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 9 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 10 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 11 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 12 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 13 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 14 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 15 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 16 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 17 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 18 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 19 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 20 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 21 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 22 | 3300007130 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut | Metagenome | Drosophilidae |
| 23 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 24 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 25 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 26 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 27 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 28 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 29 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 30 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 31 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 32 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 33 | 3300005299 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 1 gut | Metagenome | Drosophilidae |
| 34 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 35 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 36 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 37 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 38 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 39 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 40 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 41 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 42 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 43 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 44 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 45 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 46 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 47 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 48 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 49 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 50 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 51 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 52 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 53 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 54 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 55 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 56 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 57 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 58 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 59 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 60 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 61 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 62 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 63 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_210608 | 3300042659 | Bacteria | 40939 |
| 2 | Ga0466735_234357 | 3300042624 | Bacteria | 1812 |
| 3 | Ga0466708_056965 | 3300042652 | Bacteria | 14666 |
| 4 | Ga0123357_10149123 | 3300009784 | Bacteria | 2845 |
| 5 | Ga0123356_10072688 | 3300010049 | Bacteria | 3232 |
| 6 | Ga0466657_210485 | 3300042582 | Bacteria | 22461 |
| 7 | Ga0466706_043646 | 3300042599 | Bacteria | 9905 |
| 8 | Ga0466706_254656 | 3300042599 | Bacteria | 4712 |
| 9 | Ga0466705_043883 | 3300042612 | Bacteria | 44680 |
| 10 | Ga0466733_071653 | 3300042659 | Bacteria | 6866 |
| 11 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 12 | Ga0466729_214354 | 3300042621 | Bacteria | 4455 |
| 13 | Ga0466735_023878 | 3300042624 | Bacteria | 1209 |
| 14 | Ga0466703_038398 | 3300042636 | Bacteria | 12958 |
| 15 | Ga0466725_194480 | 3300042654 | Bacteria | 6695 |
| 16 | Ga0466727_115723 | 3300042655 | Bacteria | 2065 |
| 17 | Ga0466715_076767 | 3300042616 | Bacteria | 23423 |
| 18 | Ga0466728_311604 | 3300042620 | Bacteria | 10551 |
| 19 | Ga0265387_1003611 | 3300024582 | Bacteria | 2124 |
| 20 | Ga0466692_073863 | 3300042591 | Bacteria | 38781 |
| 21 | Ga0466701_092879 | 3300042598 | Bacteria | 8782 |
| 22 | Ga0466706_151978 | 3300042599 | Bacteria | 59315 |
| 23 | Ga0466706_180415 | 3300042599 | Bacteria | 1010 |
| 24 | Ga0466707_136654 | 3300042601 | Bacteria | 15946 |
| 25 | Ga0466707_144321 | 3300042601 | Bacteria | 17726 |
| 26 | Ga0466713_066220 | 3300042602 | Bacteria | 1228 |
| 27 | Ga0466714_156697 | 3300042603 | Bacteria | 1896 |
| 28 | Ga0466722_052256 | 3300042609 | Bacteria | 7178 |
| 29 | IMNBL1DRAFT_c0010863 | 3300000062 | Bacteria | 4308 |
| 30 | Ga0466705_291938 | 3300042612 | Bacteria | 2066 |
| 31 | Ga0466729_219149 | 3300042621 | Bacteria | 1745 |
| 32 | Ga0466735_132024 | 3300042624 | Bacteria | 7960 |
| 33 | Ga0466710_078446 | 3300042613 | Bacteria | 7785 |
| 34 | Ga0466710_429230 | 3300042613 | Bacteria | 1478 |
| 35 | Ga0466715_217509 | 3300042616 | Bacteria | 7111 |
| 36 | Ga0466690_185737 | 3300042590 | Bacteria | 33974 |
| 37 | Ga0466692_156027 | 3300042591 | Bacteria | 99798 |
| 38 | Ga0466706_032825 | 3300042599 | Bacteria | 47486 |
| 39 | Ga0466706_098015 | 3300042599 | Bacteria | 58460 |
| 40 | Ga0466716_435464 | 3300042605 | Bacteria | 6362 |
| 41 | IMNBL1DRAFT_c0000335 | 3300000062 | Bacteria | 39826 |
| 42 | IMNBL1DRAFT_c0003440 | 3300000062 | Bacteria | 10186 |
| 43 | IMNBL1DRAFT_c0015170 | 3300000062 | Bacteria | 3353 |
| 44 | JGI24699J35502_11134211 | 3300002509 | Bacteria | 60442 |
| 45 | Ga0466733_126709 | 3300042659 | Bacteria | 25436 |
| 46 | Ga0466735_113258 | 3300042624 | Bacteria | 1100 |
| 47 | Ga0466735_191563 | 3300042624 | Bacteria | 5729 |
| 48 | Ga0466704_503070 | 3300042643 | Bacteria | 2006 |
| 49 | Ga0466725_039921 | 3300042654 | Bacteria | 2675 |
| 50 | Ga0466715_085937 | 3300042616 | Bacteria | 11857 |
| 51 | Ga0265387_1016919 | 3300024582 | Bacteria | 1051 |
| 52 | Ga0466692_102274 | 3300042591 | Bacteria | 5109 |
| 53 | Ga0466696_044686 | 3300042596 | Bacteria | 6405 |
| 54 | Ga0466706_133021 | 3300042599 | Bacteria | 3265 |
| 55 | Ga0466713_000880 | 3300042602 | Bacteria | 20825 |
| 56 | Ga0466719_065218 | 3300042606 | Bacteria | 22853 |
| 57 | Ga0466698_185422 | 3300042610 | Bacteria | 1378 |
| 58 | JGI24702J35022_10056214 | 3300002462 | Bacteria | 2099 |
| 59 | Ga0074146_1012184 | 3300005299 | Bacteria | 1621 |
| 60 | Ga0466733_093205 | 3300042659 | Bacteria | 6293 |
| 61 | Ga0466735_088715 | 3300042624 | Bacteria | 1353 |
| 62 | Ga0123357_10542749 | 3300009784 | Bacteria | 933 |
| 63 | Ga0466710_174404 | 3300042613 | Bacteria | 6957 |
| 64 | Ga0466711_070021 | 3300042615 | Bacteria | 21814 |
| 65 | Ga0466715_175518 | 3300042616 | Bacteria | 23921 |
| 66 | Ga0466723_123771 | 3300042618 | Bacteria | 12843 |
| 67 | Ga0466726_060416 | 3300042619 | Unclassified | 1172 |
| 68 | Ga0466696_239113 | 3300042596 | Bacteria | 9395 |
| 69 | Ga0466701_000462 | 3300042598 | Bacteria | 39838 |
| 70 | Ga0466722_227975 | 3300042609 | Bacteria | 13095 |
| 71 | IMNBL1DRAFT_c0000175 | 3300000062 | Bacteria | 57822 |
| 72 | JGI24699J35502_11134229 | 3300002509 | Bacteria | 98606 |
| 73 | Ga0466733_054545 | 3300042659 | Bacteria | 1055 |
| 74 | Ga0466734_122583 | 3300042623 | Bacteria | 1617 |
| 75 | Ga0466711_244271 | 3300042615 | Bacteria | 4718 |
| 76 | Ga0466696_057309 | 3300042596 | Bacteria | 8007 |
| 77 | Ga0466707_072525 | 3300042601 | Bacteria | 13511 |
| 78 | Ga0068305_10234432 | 3300005083 | Bacteria | 4781 |
| 79 | Ga0466697_096879 | 3300042611 | Bacteria | 330838 |
| 80 | Ga0466705_056487 | 3300042612 | Bacteria | 11616 |
| 81 | Ga0466733_125240 | 3300042659 | Bacteria | 4913 |
| 82 | Ga0466733_150639 | 3300042659 | Bacteria | 185699 |
| 83 | Ga0466733_192833 | 3300042659 | Bacteria | 2209 |
| 84 | Ga0466735_004308 | 3300042624 | Bacteria | 8699 |
| 85 | Ga0466735_128327 | 3300042624 | Bacteria | 3173 |
| 86 | Ga0466730_044603 | 3300042625 | Bacteria | 4878 |
| 87 | Ga0466730_094522 | 3300042625 | Bacteria | 1857 |
| 88 | Ga0466703_079081 | 3300042636 | Bacteria | 8301 |
| 89 | Ga0466703_268275 | 3300042636 | Bacteria | 1867 |
| 90 | Ga0123357_10012499 | 3300009784 | Unclassified | 10956 |
| 91 | Ga0123354_10133205 | 3300010882 | Bacteria | 3126 |
| 92 | Ga0466711_335108 | 3300042615 | Bacteria | 1376 |
| 93 | Ga0466715_140634 | 3300042616 | Bacteria | 1635 |
| 94 | Ga0466726_234425 | 3300042619 | Bacteria | 6071 |
| 95 | Ga0466690_018936 | 3300042590 | Bacteria | 8628 |
| 96 | Ga0466706_210096 | 3300042599 | Bacteria | 35546 |
| 97 | Ga0466713_134320 | 3300042602 | Bacteria | 10928 |
| 98 | Ga0466714_056213 | 3300042603 | Bacteria | 1875 |
| 99 | 2227631579 | 2225789004 | Bacteria | 2119 |
| 100 | Ga0068302_10101704 | 3300005071 | Bacteria | 4872 |
| 101 | Ga0466735_031351 | 3300042624 | Bacteria | 11211 |
| 102 | Ga0466727_282753 | 3300042655 | Bacteria | 2592 |
| 103 | Ga0466710_413770 | 3300042613 | Bacteria | 1256 |
| 104 | Ga0466696_030088 | 3300042596 | Bacteria | 9675 |
| 105 | Ga0466707_012465 | 3300042601 | Bacteria | 1444 |
| 106 | Ga0466713_147122 | 3300042602 | Bacteria | 45505 |
| 107 | Ga0466716_305771 | 3300042605 | Bacteria | 2470 |
| 108 | IMNBGM34_c019322 | 3300000036 | Bacteria | 853 |
| 109 | IMNBGM34_c041106 | 3300000036 | Bacteria | 598 |
| 110 | IMNBL1DRAFT_c0000112 | 3300000062 | Bacteria | 72967 |
| 111 | IMNBL1DRAFT_c0162862 | 3300000062 | Bacteria | 569 |
| 112 | Ga0104042_1129066 | 3300007130 | Bacteria | 1048 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300000062 | IMNBL1DRAFT_c0015170 | IMNBL1DRAFT_00151703 | 99 |
| 2 | 3300042596 | Ga0466696_239113 | Ga0466696_239113_4463_4789 | 100 |
| 3 | iso_pr_bacteria | 2820762746 | 2820764974 | 103 |
| 4 | 3300002509 | JGI24699J35502_11134211 | JGI24699J35502_1113421130 | 104 |
| 5 | 3300042598 | Ga0466701_092879 | Ga0466701_092879_2841_3155 | 104 |
| 6 | 3300009784 | Ga0123357_10149123 | Ga0123357_101491233 | 105 |
| 7 | 3300042599 | Ga0466706_043646 | Ga0466706_043646_4828_5148 | 106 |
| 8 | 3300042599 | Ga0466706_151978 | Ga0466706_151978_37233_37553 | 106 |
| 9 | iso_pr_bacteria | 3004677695 | 3004679600 | 106 |
| 10 | 3300042596 | Ga0466696_044686 | Ga0466696_044686_752_1075 | 107 |
| 11 | 3300042601 | Ga0466707_072525 | Ga0466707_072525_2493_2816 | 107 |
| 12 | 3300042624 | Ga0466735_031351 | Ga0466735_031351_3884_4207 | 107 |
| 13 | 3300042659 | Ga0466733_071653 | Ga0466733_071653_3596_3919 | 107 |
| 14 | 3300024582 | Ga0265387_1016919 | Ga0265387_10169192 | 108 |
| 15 | 3300042590 | Ga0466690_018936 | Ga0466690_018936_2299_2625 | 108 |
| 16 | 3300042591 | Ga0466692_102274 | Ga0466692_102274_2908_3234 | 108 |
| 17 | 3300042591 | Ga0466692_156027 | Ga0466692_156027_7101_7427 | 108 |
| 18 | 3300042596 | Ga0466696_057309 | Ga0466696_057309_7529_7855 | 108 |
| 19 | 3300042598 | Ga0466701_000462 | Ga0466701_000462_28918_29244 | 108 |
| 20 | 3300042599 | Ga0466706_098015 | Ga0466706_098015_27022_27348 | 108 |
| 21 | 3300042599 | Ga0466706_133021 | Ga0466706_133021_2082_2408 | 108 |
| 22 | 3300042601 | Ga0466707_012465 | Ga0466707_012465_1065_1391 | 108 |
| 23 | 3300042601 | Ga0466707_136654 | Ga0466707_136654_3009_3335 | 108 |
| 24 | 3300042601 | Ga0466707_144321 | Ga0466707_144321_13846_14172 | 108 |
| 25 | 3300042602 | Ga0466713_066220 | Ga0466713_066220_296_622 | 108 |
| 26 | 3300042602 | Ga0466713_134320 | Ga0466713_134320_9113_9439 | 108 |
| 27 | 3300042602 | Ga0466713_147122 | Ga0466713_147122_22059_22385 | 108 |
| 28 | 3300042603 | Ga0466714_056213 | Ga0466714_056213_577_903 | 108 |
| 29 | 3300042603 | Ga0466714_156697 | Ga0466714_156697_333_659 | 108 |
| 30 | 3300042605 | Ga0466716_305771 | Ga0466716_305771_458_784 | 108 |
| 31 | 3300042606 | Ga0466719_065218 | Ga0466719_065218_6377_6703 | 108 |
| 32 | 3300042609 | Ga0466722_052256 | Ga0466722_052256_3592_3918 | 108 |
| 33 | 3300042609 | Ga0466722_227975 | Ga0466722_227975_7051_7377 | 108 |
| 34 | 3300042610 | Ga0466698_185422 | Ga0466698_185422_694_1020 | 108 |
| 35 | 3300042611 | Ga0466697_096879 | Ga0466697_096879_269297_269623 | 108 |
| 36 | 3300042612 | Ga0466705_056487 | Ga0466705_056487_5929_6255 | 108 |
| 37 | 3300042612 | Ga0466705_291938 | Ga0466705_291938_732_1058 | 108 |
| 38 | 3300042613 | Ga0466710_078446 | Ga0466710_078446_42_368 | 108 |
| 39 | 3300042613 | Ga0466710_413770 | Ga0466710_413770_605_931 | 108 |
| 40 | 3300042613 | Ga0466710_429230 | Ga0466710_429230_1116_1442 | 108 |
| 41 | 3300042615 | Ga0466711_070021 | Ga0466711_070021_1704_2030 | 108 |
| 42 | 3300042615 | Ga0466711_335108 | Ga0466711_335108_233_559 | 108 |
| 43 | 3300042616 | Ga0466715_076767 | Ga0466715_076767_1115_1441 | 108 |
| 44 | 3300042616 | Ga0466715_140634 | Ga0466715_140634_1089_1415 | 108 |
| 45 | 3300042616 | Ga0466715_217509 | Ga0466715_217509_5519_5845 | 108 |
| 46 | 3300042618 | Ga0466723_123771 | Ga0466723_123771_10233_10559 | 108 |
| 47 | 3300042619 | Ga0466726_060416 | Ga0466726_060416_268_594 | 108 |
| 48 | 3300042620 | Ga0466728_311604 | Ga0466728_311604_1288_1614 | 108 |
| 49 | 3300042621 | Ga0466729_214354 | Ga0466729_214354_1487_1813 | 108 |
| 50 | 3300042621 | Ga0466729_219149 | Ga0466729_219149_518_844 | 108 |
| 51 | 3300042624 | Ga0466735_128327 | Ga0466735_128327_2825_3151 | 108 |
| 52 | 3300042624 | Ga0466735_191563 | Ga0466735_191563_2433_2759 | 108 |
| 53 | 3300042625 | Ga0466730_044603 | Ga0466730_044603_1552_1878 | 108 |
| 54 | 3300042625 | Ga0466730_094522 | Ga0466730_094522_1334_1660 | 108 |
| 55 | 3300042636 | Ga0466703_079081 | Ga0466703_079081_2807_3133 | 108 |
| 56 | 3300042636 | Ga0466703_268275 | Ga0466703_268275_850_1176 | 108 |
| 57 | 3300042643 | Ga0466704_503070 | Ga0466704_503070_636_962 | 108 |
| 58 | 3300042654 | Ga0466725_039921 | Ga0466725_039921_1215_1541 | 108 |
| 59 | 3300042655 | Ga0466727_282753 | Ga0466727_282753_1036_1362 | 108 |
| 60 | 3300042659 | Ga0466733_054545 | Ga0466733_054545_37_363 | 108 |
| 61 | 3300042659 | Ga0466733_093205 | Ga0466733_093205_3733_4059 | 108 |
| 62 | 3300042659 | Ga0466733_150639 | Ga0466733_150639_108186_108512 | 108 |
| 63 | 3300042659 | Ga0466733_210608 | Ga0466733_210608_1775_2101 | 108 |
| 64 | 3300056842 | Ga0562377_0004 | Ga0562377_0004_2992327_2992653 | 108 |
| 65 | iso_pr_bacteria | 2695420314 | 2695471461 | 108 |
| 66 | iso_pr_bacteria | 2910926975 | 2910929722 | 108 |
| 67 | iso_pr_bacteria | 2910930387 | 2910931936 | 108 |
| 68 | iso_pr_bacteria | 2910942425 | 2910946567 | 108 |
| 69 | iso_pr_bacteria | 2910949487 | 2910951160 | 108 |
| 70 | iso_pr_bacteria | 2920168565 | 2920169325 | 108 |
| 71 | 2225789004 | 2227631579 | 2228216016 | 109 |
| 72 | 3300000036 | IMNBGM34_c041106 | IMNBGM34_0411061 | 109 |
| 73 | 3300000062 | IMNBL1DRAFT_c0000175 | IMNBL1DRAFT_000017543 | 109 |
| 74 | 3300000062 | IMNBL1DRAFT_c0003440 | IMNBL1DRAFT_00034402 | 109 |
| 75 | 3300000062 | IMNBL1DRAFT_c0010863 | IMNBL1DRAFT_00108632 | 109 |
| 76 | 3300005299 | Ga0074146_1012184 | Ga0074146_10121843 | 109 |
| 77 | 3300007130 | Ga0104042_1129066 | Ga0104042_11290662 | 109 |
| 78 | 3300042582 | Ga0466657_210485 | Ga0466657_210485_5257_5586 | 109 |
| 79 | 3300042591 | Ga0466692_073863 | Ga0466692_073863_22552_22881 | 109 |
| 80 | 3300042613 | Ga0466710_174404 | Ga0466710_174404_4628_4957 | 109 |
| 81 | 3300042619 | Ga0466726_234425 | Ga0466726_234425_5173_5502 | 109 |
| 82 | 3300042654 | Ga0466725_194480 | Ga0466725_194480_4552_4881 | 109 |
| 83 | 3300042655 | Ga0466727_115723 | Ga0466727_115723_162_491 | 109 |
| 84 | iso_pr_bacteria | 2820757377 | 2820759880 | 109 |
| 85 | 3300000062 | IMNBL1DRAFT_c0000335 | IMNBL1DRAFT_00003352 | 110 |
| 86 | 3300000062 | IMNBL1DRAFT_c0162862 | IMNBL1DRAFT_01628621 | 110 |
| 87 | 3300002509 | JGI24699J35502_11134229 | JGI24699J35502_1113422961 | 110 |
| 88 | 3300005071 | Ga0068302_10101704 | Ga0068302_101017045 | 110 |
| 89 | 3300009784 | Ga0123357_10542749 | Ga0123357_105427491 | 110 |
| 90 | 3300010882 | Ga0123354_10133205 | Ga0123354_101332052 | 110 |
| 91 | 3300042615 | Ga0466711_244271 | Ga0466711_244271_2535_2867 | 110 |
| 92 | 3300042616 | Ga0466715_085937 | Ga0466715_085937_788_1120 | 110 |
| 93 | 3300042636 | Ga0466703_038398 | Ga0466703_038398_5257_5589 | 110 |
| 94 | 3300042652 | Ga0466708_056965 | Ga0466708_056965_2913_3245 | 110 |
| 95 | 3300042659 | Ga0466733_125240 | Ga0466733_125240_937_1269 | 110 |
| 96 | iso_pr_bacteria | 2695420317 | 2695486386 | 110 |
| 97 | iso_pr_bacteria | 2873600114 | 2873601538 | 110 |
| 98 | iso_pr_bacteria | 2873610414 | 2873611892 | 110 |
| 99 | iso_pr_bacteria | 2940244548 | 2940247856 | 110 |
| 100 | iso_pr_bacteria | 2940253009 | 2940256381 | 110 |
| 101 | iso_pr_bacteria | 2940257232 | 2940260479 | 110 |
| 102 | iso_pr_bacteria | 8100157865 | 8100159366 | 110 |
| 103 | 3300000062 | IMNBL1DRAFT_c0000112 | IMNBL1DRAFT_000011237 | 111 |
| 104 | 3300002462 | JGI24702J35022_10056214 | JGI24702J35022_100562144 | 111 |
| 105 | 3300009784 | Ga0123357_10012499 | Ga0123357_100124996 | 111 |
| 106 | 3300024582 | Ga0265387_1003611 | Ga0265387_10036112 | 111 |
| 107 | iso_pr_bacteria | 2940193328 | 2940193350 | 111 |
| 108 | iso_pr_bacteria | 2940336608 | 2940336630 | 111 |
| 109 | 3300010049 | Ga0123356_10072688 | Ga0123356_100726884 | 112 |
| 110 | 3300042590 | Ga0466690_185737 | Ga0466690_185737_6814_7152 | 112 |
| 111 | 3300042599 | Ga0466706_180415 | Ga0466706_180415_322_660 | 112 |
| 112 | 3300042599 | Ga0466706_210096 | Ga0466706_210096_28756_29094 | 112 |
| 113 | 3300042616 | Ga0466715_175518 | Ga0466715_175518_7294_7632 | 112 |
| 114 | 3300042623 | Ga0466734_122583 | Ga0466734_122583_321_659 | 112 |
| 115 | 3300042624 | Ga0466735_023878 | Ga0466735_023878_800_1138 | 112 |
| 116 | 3300042624 | Ga0466735_088715 | Ga0466735_088715_953_1291 | 112 |
| 117 | 3300042624 | Ga0466735_113258 | Ga0466735_113258_617_955 | 112 |
| 118 | 3300042624 | Ga0466735_132024 | Ga0466735_132024_6986_7324 | 112 |
| 119 | 3300042624 | Ga0466735_234357 | Ga0466735_234357_1340_1678 | 112 |
| 120 | 3300042605 | Ga0466716_435464 | Ga0466716_435464_5728_6069 | 113 |
| 121 | 3300042659 | Ga0466733_192833 | Ga0466733_192833_1054_1395 | 113 |
| 122 | 3300000036 | IMNBGM34_c019322 | IMNBGM34_0193222 | 114 |
| 123 | 3300042596 | Ga0466696_030088 | Ga0466696_030088_824_1168 | 114 |
| 124 | 3300042599 | Ga0466706_032825 | Ga0466706_032825_34400_34744 | 114 |
| 125 | 3300042624 | Ga0466735_004308 | Ga0466735_004308_223_567 | 114 |
| 126 | 3300042599 | Ga0466706_254656 | Ga0466706_254656_309_656 | 115 |
| 127 | 3300042659 | Ga0466733_126709 | Ga0466733_126709_12197_12553 | 118 |
| 128 | 3300042612 | Ga0466705_043883 | Ga0466705_043883_35783_36145 | 120 |
| 129 | 3300042602 | Ga0466713_000880 | Ga0466713_000880_18547_18915 | 122 |
| 130 | 3300005083 | Ga0068305_10234432 | Ga0068305_102344324 | 123 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.8 | 0.89 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.