Protein Family IF01202
Metagenome
Isolate
172
Members
58
Samples
154
Scaffolds
426.2
Avg Length
Representative Sequence
- ID
- 3300005083|Ga0068305_10204721|Ga0068305_102047214
- Length
- 489 aa
- Sequence
- MSKNVYELVQDRLDIIFREFDNVYVSFSGGKDSGVLLNLCIDYIRKHNLNVRLGVFHLDYEIQYKMTLDYVDRVFKSYPDIVDVYHICVPFRVTTCTSMYQKYWRPWDEKAKESWVRPLPEGAMTQNDFPFYDTRQWDYDFQEEFSRWLHKKKNAKRTCCLVGIRTQESYNRWRTIYRGNKEQYGSYEWSTKIDEDVYNFYPLFDWKTTDIWVANGKFEWDYNRLYDLYYQAGVTLDKQRVASPFISEAIESLSLYKVIDPDMWGRMIGRVNGVNFTGIYGNTQAMGHKRIHLPEGHTWKSFMEFLLSTLPXRGYQSKLNTSIRFWKKNGGCLSKEVIQKLKDRNIPIEVVENTNYKTDKLPVRMDYLDDIDIPEFREIPTYKRMCICILRNDHVCKYMGFALTKEEREMKHRAMQQYGDFEYPEGFAGVEMVQSSNDSGTEFAAWVTNPSGPGSATFLGLIRPENWDGFQREFDRIMDTYIEKNNKA*
Sample Types
Isolate
10.5%
Metagenome
89.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
24.6%
Blattidae
21.1%
Termitidae
14.0%
Unclassified
12.3%
Formicidae
8.8%
Rhinotermitidae
8.8%
Termopsidae
5.3%
Passalidae
3.5%
Tenebrionidae
1.8%
Taxonomy
Archaea
0
Bacteria
165
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 2 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 3 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 4 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 5 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 6 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 7 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 8 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 9 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 10 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 11 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 12 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 13 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 14 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 15 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 16 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 17 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 18 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 19 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 20 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 21 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 22 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 23 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 24 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 25 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 26 | 3300006995 | Ant gut microbial communities from Cephalotes angustus, Brazil | Metagenome | Formicidae |
| 27 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 28 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 29 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 30 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 31 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 32 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 33 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 34 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 35 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 36 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 37 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 38 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 39 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 40 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 41 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 42 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 43 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 44 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 45 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 46 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 47 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 48 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 49 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 50 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 51 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 52 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 53 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 54 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 55 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 56 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 57 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 58 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_007128 | 3300042659 | Bacteria | 3610 |
| 2 | Ga0466703_305258 | 3300042636 | Bacteria | 4845 |
| 3 | Ga0466703_429214 | 3300042636 | Bacteria | 6069 |
| 4 | Ga0466704_284565 | 3300042643 | Bacteria | 2535 |
| 5 | Ga0466704_541758 | 3300042643 | Bacteria | 43707 |
| 6 | Ga0466708_066599 | 3300042652 | Bacteria | 2796 |
| 7 | Ga0466708_198096 | 3300042652 | Bacteria | 40779 |
| 8 | Ga0466690_081611 | 3300042590 | Bacteria | 8837 |
| 9 | Ga0466690_122039 | 3300042590 | Unclassified | 13192 |
| 10 | Ga0466690_285211 | 3300042590 | Bacteria | 14473 |
| 11 | Ga0466690_297222 | 3300042590 | Bacteria | 4918 |
| 12 | Ga0466691_057655 | 3300042593 | Bacteria | 8670 |
| 13 | Ga0466691_087689 | 3300042593 | Bacteria | 15679 |
| 14 | Ga0466696_195168 | 3300042596 | Bacteria | 3859 |
| 15 | Ga0466696_488650 | 3300042596 | Bacteria | 7187 |
| 16 | Ga0466715_093274 | 3300042616 | Bacteria | 5659 |
| 17 | Ga0466715_231415 | 3300042616 | Bacteria | 17252 |
| 18 | Ga0466707_160184 | 3300042601 | Bacteria | 6067 |
| 19 | Ga0466716_381412 | 3300042605 | Bacteria | 24623 |
| 20 | Ga0466719_529906 | 3300042606 | Bacteria | 2321 |
| 21 | Ga0466722_256515 | 3300042609 | Bacteria | 14206 |
| 22 | JGI24705J35276_12228298 | 3300002504 | Bacteria | 3161 |
| 23 | Ga0466733_038901 | 3300042659 | Bacteria | 1628 |
| 24 | Ga0466733_059361 | 3300042659 | Bacteria | 18084 |
| 25 | Ga0466733_083509 | 3300042659 | Bacteria | 14519 |
| 26 | Ga0466704_035761 | 3300042643 | Bacteria | 5564 |
| 27 | Ga0466709_313570 | 3300042648 | Bacteria | 7986 |
| 28 | Ga0466690_150757 | 3300042590 | Bacteria | 28046 |
| 29 | Ga0466696_445316 | 3300042596 | Bacteria | 2412 |
| 30 | Ga0466696_459672 | 3300042596 | Bacteria | 110905 |
| 31 | Ga0466715_367634 | 3300042616 | Bacteria | 77620 |
| 32 | Ga0466728_004763 | 3300042620 | Bacteria | 36943 |
| 33 | Ga0466714_004532 | 3300042603 | Bacteria | 15956 |
| 34 | Ga0068305_10204721 | 3300005083 | Bacteria | 3736 |
| 35 | Ga0466705_016046 | 3300042612 | Bacteria | 10943 |
| 36 | Ga0466705_052794 | 3300042612 | Bacteria | 13475 |
| 37 | Ga0466705_166005 | 3300042612 | Bacteria | 4630 |
| 38 | Ga0466704_145383 | 3300042643 | Bacteria | 4626 |
| 39 | Ga0466704_371229 | 3300042643 | Unclassified | 2192 |
| 40 | Ga0466709_140267 | 3300042648 | Bacteria | 28990 |
| 41 | Ga0466708_134461 | 3300042652 | Bacteria | 6663 |
| 42 | Ga0466708_162006 | 3300042652 | Bacteria | 52388 |
| 43 | Ga0466690_408627 | 3300042590 | Bacteria | 146519 |
| 44 | Ga0466696_000510 | 3300042596 | Bacteria | 3494 |
| 45 | Ga0466696_177504 | 3300042596 | Bacteria | 5433 |
| 46 | Ga0466696_323741 | 3300042596 | Bacteria | 9951 |
| 47 | Ga0466715_142479 | 3300042616 | Bacteria | 5656 |
| 48 | Ga0466726_147093 | 3300042619 | Bacteria | 3020 |
| 49 | Ga0466716_023642 | 3300042605 | Bacteria | 8848 |
| 50 | Ga0466719_093852 | 3300042606 | Bacteria | 11046 |
| 51 | Ga0466719_132659 | 3300042606 | Bacteria | 30972 |
| 52 | CVPL010W_10000853 | 3300002931 | Bacteria | 34299 |
| 53 | Ga0466733_038999 | 3300042659 | Bacteria | 1740 |
| 54 | Ga0466733_207737 | 3300042659 | Bacteria | 7052 |
| 55 | Ga0466703_057160 | 3300042636 | Bacteria | 16209 |
| 56 | Ga0466704_278821 | 3300042643 | Bacteria | 2792 |
| 57 | Ga0466704_558421 | 3300042643 | Bacteria | 18047 |
| 58 | Ga0466709_268623 | 3300042648 | Bacteria | 4699 |
| 59 | Ga0466709_347855 | 3300042648 | Bacteria | 5748 |
| 60 | Ga0466708_093057 | 3300042652 | Bacteria | 12735 |
| 61 | Ga0466725_285561 | 3300042654 | Bacteria | 2844 |
| 62 | Ga0466727_310160 | 3300042655 | Bacteria | 2478 |
| 63 | Ga0466692_084849 | 3300042591 | Bacteria | 17385 |
| 64 | Ga0466692_089185 | 3300042591 | Bacteria | 67312 |
| 65 | Ga0466696_026771 | 3300042596 | Bacteria | 20491 |
| 66 | Ga0466696_422431 | 3300042596 | Bacteria | 7896 |
| 67 | Ga0466723_300572 | 3300042618 | Bacteria | 6380 |
| 68 | Ga0466707_065713 | 3300042601 | Bacteria | 21872 |
| 69 | Ga0466714_015125 | 3300042603 | Bacteria | 1796 |
| 70 | Ga0466716_511141 | 3300042605 | Bacteria | 10920 |
| 71 | Ga0466716_541528 | 3300042605 | Bacteria | 12605 |
| 72 | IMNBL1DRAFT_c0002085 | 3300000062 | Bacteria | 14228 |
| 73 | Ga0466735_072437 | 3300042624 | Bacteria | 2216 |
| 74 | Ga0466703_257172 | 3300042636 | Bacteria | 2632 |
| 75 | Ga0466704_092839 | 3300042643 | Bacteria | 5558 |
| 76 | Ga0466704_483917 | 3300042643 | Bacteria | 6481 |
| 77 | Ga0466690_070020 | 3300042590 | Bacteria | 35822 |
| 78 | Ga0466690_278296 | 3300042590 | Bacteria | 6912 |
| 79 | Ga0466696_156506 | 3300042596 | Bacteria | 11427 |
| 80 | Ga0466715_050392 | 3300042616 | Bacteria | 13819 |
| 81 | Ga0466715_150984 | 3300042616 | Unclassified | 3867 |
| 82 | Ga0466726_428664 | 3300042619 | Bacteria | 2633 |
| 83 | Ga0466707_152983 | 3300042601 | Bacteria | 2181 |
| 84 | Ga0466714_016026 | 3300042603 | Bacteria | 3443 |
| 85 | Ga0466714_041457 | 3300042603 | Bacteria | 19640 |
| 86 | Ga0466716_128873 | 3300042605 | Bacteria | 20808 |
| 87 | 2227491304 | 2225789004 | Bacteria | 20472 |
| 88 | JGI24699J35502_11134050 | 3300002509 | Bacteria | 27006 |
| 89 | Ga0123357_10000035 | 3300009784 | Bacteria | 111591 |
| 90 | Ga0466733_003737 | 3300042659 | Bacteria | 2858 |
| 91 | Ga0466733_150302 | 3300042659 | Bacteria | 45980 |
| 92 | Ga0562374_2553 | 3300057007 | Bacteria | 15247 |
| 93 | Ga0466703_208523 | 3300042636 | Unclassified | 2781 |
| 94 | Ga0466704_176207 | 3300042643 | Bacteria | 5126 |
| 95 | Ga0466704_395121 | 3300042643 | Bacteria | 4135 |
| 96 | Ga0123354_10206364 | 3300010882 | Bacteria | 2140 |
| 97 | Ga0466691_146746 | 3300042593 | Bacteria | 4086 |
| 98 | Ga0466696_112668 | 3300042596 | Bacteria | 4570 |
| 99 | Ga0466711_017192 | 3300042615 | Bacteria | 5332 |
| 100 | Ga0466715_484472 | 3300042616 | Bacteria | 8507 |
| 101 | Ga0466723_022551 | 3300042618 | Bacteria | 13991 |
| 102 | Ga0466729_083708 | 3300042621 | Bacteria | 5197 |
| 103 | Ga0466714_046589 | 3300042603 | Unclassified | 4959 |
| 104 | Ga0466722_006150 | 3300042609 | Bacteria | 3087 |
| 105 | Ga0466722_007122 | 3300042609 | Bacteria | 9045 |
| 106 | Ga0466722_050501 | 3300042609 | Bacteria | 3354 |
| 107 | Ga0102734_1000410 | 3300007129 | Bacteria | 12797 |
| 108 | Ga0466705_097005 | 3300042612 | Bacteria | 10594 |
| 109 | Ga0466705_357538 | 3300042612 | Bacteria | 16159 |
| 110 | Ga0466733_102294 | 3300042659 | Bacteria | 17348 |
| 111 | Ga0466729_224969 | 3300042621 | Bacteria | 15725 |
| 112 | Ga0466703_039999 | 3300042636 | Bacteria | 10489 |
| 113 | Ga0466703_119624 | 3300042636 | Bacteria | 4179 |
| 114 | Ga0466703_230264 | 3300042636 | Bacteria | 5938 |
| 115 | Ga0466703_398632 | 3300042636 | Bacteria | 13773 |
| 116 | Ga0466704_165655 | 3300042643 | Bacteria | 6145 |
| 117 | Ga0466704_472099 | 3300042643 | Bacteria | 6082 |
| 118 | Ga0466691_123325 | 3300042593 | Bacteria | 67193 |
| 119 | Ga0466696_123241 | 3300042596 | Bacteria | 2556 |
| 120 | Ga0466696_212940 | 3300042596 | Bacteria | 1311 |
| 121 | Ga0466711_332890 | 3300042615 | Bacteria | 5631 |
| 122 | Ga0466711_517461 | 3300042615 | Bacteria | 41123 |
| 123 | Ga0466715_215776 | 3300042616 | Bacteria | 39785 |
| 124 | Ga0466701_046428 | 3300042598 | Bacteria | 3104 |
| 125 | Ga0466707_180077 | 3300042601 | Bacteria | 4004 |
| 126 | Ga0466713_150747 | 3300042602 | Bacteria | 1962 |
| 127 | Ga0466714_151852 | 3300042603 | Bacteria | 4239 |
| 128 | Ga0466716_026765 | 3300042605 | Bacteria | 33053 |
| 129 | Ga0466716_164489 | 3300042605 | Unclassified | 2830 |
| 130 | Ga0466722_049429 | 3300042609 | Bacteria | 30179 |
| 131 | Ga0068305_10302624 | 3300005083 | Bacteria | 3667 |
| 132 | Ga0072941_1020942 | 3300005201 | Bacteria | 3277 |
| 133 | Ga0102733_100615 | 3300006995 | Bacteria | 2048 |
| 134 | Ga0103263_103296 | 3300007042 | Bacteria | 1935 |
| 135 | Ga0102740_1000192 | 3300007140 | Bacteria | 17226 |
| 136 | Ga0466705_196144 | 3300042612 | Unclassified | 2340 |
| 137 | Ga0466705_236904 | 3300042612 | Bacteria | 5111 |
| 138 | Ga0466733_091621 | 3300042659 | Bacteria | 4121 |
| 139 | Ga0466733_185063 | 3300042659 | Bacteria | 14463 |
| 140 | Ga0466733_222369 | 3300042659 | Bacteria | 8077 |
| 141 | Ga0466703_168527 | 3300042636 | Bacteria | 35100 |
| 142 | Ga0466703_430994 | 3300042636 | Bacteria | 2761 |
| 143 | Ga0466704_275608 | 3300042643 | Bacteria | 3206 |
| 144 | Ga0466704_531304 | 3300042643 | Bacteria | 11382 |
| 145 | Ga0466692_168628 | 3300042591 | Bacteria | 2859 |
| 146 | Ga0466691_011475 | 3300042593 | Bacteria | 15015 |
| 147 | Ga0466715_079574 | 3300042616 | Bacteria | 30299 |
| 148 | Ga0466715_211362 | 3300042616 | Bacteria | 21735 |
| 149 | Ga0466728_023725 | 3300042620 | Bacteria | 54030 |
| 150 | Ga0466707_349670 | 3300042601 | Bacteria | 5610 |
| 151 | Ga0466713_106512 | 3300042602 | Bacteria | 8832 |
| 152 | Ga0466714_008830 | 3300042603 | Bacteria | 7760 |
| 153 | JGI24699J35502_11134218 | 3300002509 | Bacteria | 66161 |
| 154 | Ga0068305_10010097 | 3300005083 | Bacteria | 67125 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042606 | Ga0466719_132659 | Ga0466719_132659_17777_18910 | 377 |
| 2 | 3300005083 | Ga0068305_10302624 | Ga0068305_103026243 | 383 |
| 3 | 3300042636 | Ga0466703_208523 | Ga0466703_208523_759_1925 | 388 |
| 4 | 3300042655 | Ga0466727_310160 | Ga0466727_310160_1042_2316 | 399 |
| 5 | 3300042643 | Ga0466704_531304 | Ga0466704_531304_6544_7818 | 402 |
| 6 | 3300057007 | Ga0562374_2553 | Ga0562374_2553_3559_4875 | 409 |
| 7 | 3300002504 | JGI24705J35276_12228298 | JGI24705J35276_122282985 | 411 |
| 8 | 3300042593 | Ga0466691_057655 | Ga0466691_057655_6691_7932 | 413 |
| 9 | 3300042605 | Ga0466716_128873 | Ga0466716_128873_2320_3564 | 414 |
| 10 | 3300042616 | Ga0466715_050392 | Ga0466715_050392_8830_10101 | 416 |
| 11 | 3300042601 | Ga0466707_152983 | Ga0466707_152983_273_1553 | 417 |
| 12 | 3300042596 | Ga0466696_026771 | Ga0466696_026771_16615_17871 | 418 |
| 13 | 3300042596 | Ga0466696_212940 | Ga0466696_212940_33_1289 | 418 |
| 14 | 3300042648 | Ga0466709_140267 | Ga0466709_140267_26427_27683 | 418 |
| 15 | 3300042593 | Ga0466691_123325 | Ga0466691_123325_38074_39357 | 419 |
| 16 | 3300042643 | Ga0466704_395121 | Ga0466704_395121_517_1776 | 419 |
| 17 | 3300042648 | Ga0466709_268623 | Ga0466709_268623_981_2240 | 419 |
| 18 | 3300042659 | Ga0466733_059361 | Ga0466733_059361_13704_14963 | 419 |
| 19 | 3300042659 | Ga0466733_207737 | Ga0466733_207737_1969_3228 | 419 |
| 20 | 3300042596 | Ga0466696_445316 | Ga0466696_445316_90_1352 | 420 |
| 21 | 3300042612 | Ga0466705_052794 | Ga0466705_052794_3177_4439 | 420 |
| 22 | 3300042616 | Ga0466715_079574 | Ga0466715_079574_27248_28510 | 420 |
| 23 | 3300042643 | Ga0466704_278821 | Ga0466704_278821_1326_2588 | 420 |
| 24 | 3300002509 | JGI24699J35502_11134218 | JGI24699J35502_1113421828 | 421 |
| 25 | 3300042603 | Ga0466714_016026 | Ga0466714_016026_467_1732 | 421 |
| 26 | 3300042590 | Ga0466690_150757 | Ga0466690_150757_26233_27504 | 423 |
| 27 | 3300042596 | Ga0466696_112668 | Ga0466696_112668_639_1910 | 423 |
| 28 | 3300042603 | Ga0466714_041457 | Ga0466714_041457_8121_9392 | 423 |
| 29 | 3300042636 | Ga0466703_398632 | Ga0466703_398632_6069_7340 | 423 |
| 30 | 3300042659 | Ga0466733_102294 | Ga0466733_102294_5552_6823 | 423 |
| 31 | 3300002931 | CVPL010W_10000853 | CVPL010W_100008535 | 424 |
| 32 | 3300007042 | Ga0103263_103296 | Ga0103263_1032962 | 424 |
| 33 | 3300007129 | Ga0102734_1000410 | Ga0102734_10004105 | 424 |
| 34 | 3300007140 | Ga0102740_1000192 | Ga0102740_10001925 | 424 |
| 35 | 3300042591 | Ga0466692_084849 | Ga0466692_084849_5477_6751 | 424 |
| 36 | 3300042591 | Ga0466692_089185 | Ga0466692_089185_52184_53458 | 424 |
| 37 | 3300042596 | Ga0466696_000510 | Ga0466696_000510_262_1536 | 424 |
| 38 | 3300042601 | Ga0466707_065713 | Ga0466707_065713_6669_7943 | 424 |
| 39 | 3300042603 | Ga0466714_015125 | Ga0466714_015125_328_1602 | 424 |
| 40 | 3300042603 | Ga0466714_151852 | Ga0466714_151852_1196_2470 | 424 |
| 41 | 3300042605 | Ga0466716_511141 | Ga0466716_511141_1492_2766 | 424 |
| 42 | 3300042605 | Ga0466716_541528 | Ga0466716_541528_4866_6140 | 424 |
| 43 | 3300042609 | Ga0466722_007122 | Ga0466722_007122_7719_8993 | 424 |
| 44 | 3300042619 | Ga0466726_147093 | Ga0466726_147093_1671_2945 | 424 |
| 45 | 3300042636 | Ga0466703_168527 | Ga0466703_168527_17628_18902 | 424 |
| 46 | 3300042636 | Ga0466703_429214 | Ga0466703_429214_4765_6039 | 424 |
| 47 | 3300042643 | Ga0466704_165655 | Ga0466704_165655_4311_5585 | 424 |
| 48 | 3300042643 | Ga0466704_176207 | Ga0466704_176207_1754_3028 | 424 |
| 49 | 3300042643 | Ga0466704_483917 | Ga0466704_483917_1124_2398 | 424 |
| 50 | 3300042652 | Ga0466708_162006 | Ga0466708_162006_486_1760 | 424 |
| 51 | 3300042654 | Ga0466725_285561 | Ga0466725_285561_661_1935 | 424 |
| 52 | 3300042659 | Ga0466733_091621 | Ga0466733_091621_2701_3975 | 424 |
| 53 | iso_pr_bacteria | 2695420931 | 2698110693 | 424 |
| 54 | 3300042606 | Ga0466719_529906 | Ga0466719_529906_532_1809 | 425 |
| 55 | 3300042593 | Ga0466691_011475 | Ga0466691_011475_1055_2335 | 426 |
| 56 | 3300042601 | Ga0466707_160184 | Ga0466707_160184_3734_5014 | 426 |
| 57 | 3300042601 | Ga0466707_180077 | Ga0466707_180077_1189_2469 | 426 |
| 58 | 3300042601 | Ga0466707_349670 | Ga0466707_349670_3402_4682 | 426 |
| 59 | 3300042605 | Ga0466716_026765 | Ga0466716_026765_25135_26415 | 426 |
| 60 | 3300042615 | Ga0466711_017192 | Ga0466711_017192_3215_4495 | 426 |
| 61 | 3300042615 | Ga0466711_332890 | Ga0466711_332890_1893_3173 | 426 |
| 62 | 3300042616 | Ga0466715_484472 | Ga0466715_484472_333_1613 | 426 |
| 63 | 3300042619 | Ga0466726_428664 | Ga0466726_428664_1003_2283 | 426 |
| 64 | 3300042624 | Ga0466735_072437 | Ga0466735_072437_137_1417 | 426 |
| 65 | 3300042636 | Ga0466703_430994 | Ga0466703_430994_633_1913 | 426 |
| 66 | 3300042652 | Ga0466708_198096 | Ga0466708_198096_1765_3045 | 426 |
| 67 | 3300002509 | JGI24699J35502_11134050 | JGI24699J35502_1113405032 | 427 |
| 68 | 3300042590 | Ga0466690_278296 | Ga0466690_278296_658_1941 | 427 |
| 69 | 3300042596 | Ga0466696_123241 | Ga0466696_123241_858_2141 | 427 |
| 70 | 3300042596 | Ga0466696_195168 | Ga0466696_195168_41_1324 | 427 |
| 71 | 3300042596 | Ga0466696_422431 | Ga0466696_422431_3008_4291 | 427 |
| 72 | 3300042596 | Ga0466696_459672 | Ga0466696_459672_43794_45077 | 427 |
| 73 | 3300042596 | Ga0466696_488650 | Ga0466696_488650_4256_5539 | 427 |
| 74 | 3300042616 | Ga0466715_093274 | Ga0466715_093274_1508_2791 | 427 |
| 75 | 3300042616 | Ga0466715_142479 | Ga0466715_142479_3055_4338 | 427 |
| 76 | 3300042616 | Ga0466715_150984 | Ga0466715_150984_281_1564 | 427 |
| 77 | 3300042616 | Ga0466715_211362 | Ga0466715_211362_522_1805 | 427 |
| 78 | 3300042616 | Ga0466715_215776 | Ga0466715_215776_38006_39289 | 427 |
| 79 | 3300042636 | Ga0466703_057160 | Ga0466703_057160_9627_10910 | 427 |
| 80 | 3300042636 | Ga0466703_257172 | Ga0466703_257172_1151_2434 | 427 |
| 81 | 3300042652 | Ga0466708_066599 | Ga0466708_066599_1083_2366 | 427 |
| 82 | 3300042652 | Ga0466708_134461 | Ga0466708_134461_4950_6233 | 427 |
| 83 | iso_pr_bacteria | 2820757377 | 2820759587 | 427 |
| 84 | iso_pr_bacteria | 2940205530 | 2940206365 | 427 |
| 85 | iso_pr_bacteria | 2940212447 | 2940213360 | 427 |
| 86 | iso_pr_bacteria | 2940298504 | 2940299336 | 427 |
| 87 | iso_pr_bacteria | 2940302308 | 2940303221 | 427 |
| 88 | iso_pr_bacteria | 2940306115 | 2940306881 | 427 |
| 89 | iso_pr_bacteria | 2940309933 | 2940310698 | 427 |
| 90 | iso_pr_bacteria | 2940313741 | 2940314587 | 427 |
| 91 | iso_pr_bacteria | 2940317558 | 2940318402 | 427 |
| 92 | iso_pr_bacteria | 2940321370 | 2940322214 | 427 |
| 93 | iso_pr_bacteria | 2940325180 | 2940326093 | 427 |
| 94 | iso_pr_bacteria | 2940328985 | 2940329819 | 427 |
| 95 | iso_pr_bacteria | 2940332795 | 2940333561 | 427 |
| 96 | 2225789004 | 2227491304 | 2227963564 | 428 |
| 97 | 3300005201 | Ga0072941_1020942 | Ga0072941_10209423 | 428 |
| 98 | 3300009784 | Ga0123357_10000035 | Ga0123357_100000356 | 428 |
| 99 | 3300010882 | Ga0123354_10206364 | Ga0123354_102063642 | 428 |
| 100 | 3300042590 | Ga0466690_070020 | Ga0466690_070020_21487_22773 | 428 |
| 101 | 3300042590 | Ga0466690_122039 | Ga0466690_122039_11234_12520 | 428 |
| 102 | 3300042590 | Ga0466690_285211 | Ga0466690_285211_2643_3929 | 428 |
| 103 | 3300042590 | Ga0466690_297222 | Ga0466690_297222_2885_4171 | 428 |
| 104 | 3300042593 | Ga0466691_146746 | Ga0466691_146746_588_1874 | 428 |
| 105 | 3300042596 | Ga0466696_156506 | Ga0466696_156506_1989_3275 | 428 |
| 106 | 3300042596 | Ga0466696_177504 | Ga0466696_177504_2833_4119 | 428 |
| 107 | 3300042596 | Ga0466696_323741 | Ga0466696_323741_7998_9284 | 428 |
| 108 | 3300042603 | Ga0466714_004532 | Ga0466714_004532_12337_13623 | 428 |
| 109 | 3300042605 | Ga0466716_023642 | Ga0466716_023642_4478_5764 | 428 |
| 110 | 3300042605 | Ga0466716_164489 | Ga0466716_164489_794_2080 | 428 |
| 111 | 3300042612 | Ga0466705_016046 | Ga0466705_016046_896_2182 | 428 |
| 112 | 3300042612 | Ga0466705_196144 | Ga0466705_196144_119_1405 | 428 |
| 113 | 3300042612 | Ga0466705_236904 | Ga0466705_236904_690_1976 | 428 |
| 114 | 3300042612 | Ga0466705_357538 | Ga0466705_357538_804_2090 | 428 |
| 115 | 3300042615 | Ga0466711_517461 | Ga0466711_517461_33442_34728 | 428 |
| 116 | 3300042616 | Ga0466715_367634 | Ga0466715_367634_16117_17403 | 428 |
| 117 | 3300042618 | Ga0466723_300572 | Ga0466723_300572_4602_5888 | 428 |
| 118 | 3300042620 | Ga0466728_004763 | Ga0466728_004763_33836_35122 | 428 |
| 119 | 3300042620 | Ga0466728_023725 | Ga0466728_023725_40805_42091 | 428 |
| 120 | 3300042636 | Ga0466703_119624 | Ga0466703_119624_2437_3723 | 428 |
| 121 | 3300042636 | Ga0466703_305258 | Ga0466703_305258_624_1910 | 428 |
| 122 | 3300042643 | Ga0466704_035761 | Ga0466704_035761_3441_4727 | 428 |
| 123 | 3300042643 | Ga0466704_092839 | Ga0466704_092839_953_2239 | 428 |
| 124 | 3300042643 | Ga0466704_145383 | Ga0466704_145383_1539_2825 | 428 |
| 125 | 3300042643 | Ga0466704_275608 | Ga0466704_275608_402_1688 | 428 |
| 126 | 3300042643 | Ga0466704_371229 | Ga0466704_371229_92_1378 | 428 |
| 127 | 3300042643 | Ga0466704_472099 | Ga0466704_472099_984_2270 | 428 |
| 128 | 3300042643 | Ga0466704_541758 | Ga0466704_541758_23368_24654 | 428 |
| 129 | 3300042648 | Ga0466709_313570 | Ga0466709_313570_841_2127 | 428 |
| 130 | 3300042648 | Ga0466709_347855 | Ga0466709_347855_1110_2396 | 428 |
| 131 | 3300042659 | Ga0466733_007128 | Ga0466733_007128_1323_2609 | 428 |
| 132 | 3300042659 | Ga0466733_038901 | Ga0466733_038901_43_1329 | 428 |
| 133 | 3300042659 | Ga0466733_038999 | Ga0466733_038999_43_1329 | 428 |
| 134 | 3300042659 | Ga0466733_150302 | Ga0466733_150302_16587_17873 | 428 |
| 135 | 3300042659 | Ga0466733_185063 | Ga0466733_185063_1191_2477 | 428 |
| 136 | 3300000062 | IMNBL1DRAFT_c0002085 | IMNBL1DRAFT_00020857 | 429 |
| 137 | 3300006995 | Ga0102733_100615 | Ga0102733_1006153 | 429 |
| 138 | 3300042603 | Ga0466714_046589 | Ga0466714_046589_2929_4218 | 429 |
| 139 | 3300042605 | Ga0466716_381412 | Ga0466716_381412_7371_8660 | 429 |
| 140 | 3300042612 | Ga0466705_166005 | Ga0466705_166005_2905_4194 | 429 |
| 141 | 3300042643 | Ga0466704_284565 | Ga0466704_284565_499_1788 | 429 |
| 142 | 3300042643 | Ga0466704_558421 | Ga0466704_558421_15492_16781 | 429 |
| 143 | 3300042652 | Ga0466708_093057 | Ga0466708_093057_3860_5149 | 429 |
| 144 | 3300042609 | Ga0466722_006150 | Ga0466722_006150_936_2228 | 430 |
| 145 | 3300042609 | Ga0466722_050501 | Ga0466722_050501_1221_2513 | 430 |
| 146 | 3300005083 | Ga0068305_10010097 | Ga0068305_1001009734 | 431 |
| 147 | 3300042591 | Ga0466692_168628 | Ga0466692_168628_676_1971 | 431 |
| 148 | 3300042636 | Ga0466703_039999 | Ga0466703_039999_1475_2770 | 431 |
| 149 | 3300042636 | Ga0466703_230264 | Ga0466703_230264_1365_2660 | 431 |
| 150 | 3300042659 | Ga0466733_003737 | Ga0466733_003737_1005_2300 | 431 |
| 151 | 3300042659 | Ga0466733_222369 | Ga0466733_222369_1020_2318 | 432 |
| 152 | 3300042602 | Ga0466713_150747 | Ga0466713_150747_333_1634 | 433 |
| 153 | 3300042590 | Ga0466690_081611 | Ga0466690_081611_1636_2940 | 434 |
| 154 | 3300042590 | Ga0466690_408627 | Ga0466690_408627_2726_4030 | 434 |
| 155 | 3300042593 | Ga0466691_087689 | Ga0466691_087689_676_1980 | 434 |
| 156 | 3300042606 | Ga0466719_093852 | Ga0466719_093852_5003_6307 | 434 |
| 157 | 3300042616 | Ga0466715_231415 | Ga0466715_231415_13398_14702 | 434 |
| 158 | 3300042621 | Ga0466729_083708 | Ga0466729_083708_3550_4854 | 434 |
| 159 | 3300042659 | Ga0466733_083509 | Ga0466733_083509_12152_13456 | 434 |
| 160 | iso_pr_bacteria | 2609459943 | 2610742795 | 434 |
| 161 | iso_pr_bacteria | 2695420317 | 2695485165 | 434 |
| 162 | iso_pr_bacteria | 2830041218 | 2830042720 | 434 |
| 163 | iso_pr_bacteria | 8100157865 | 8100159960 | 434 |
| 164 | 3300042609 | Ga0466722_256515 | Ga0466722_256515_1715_3022 | 435 |
| 165 | 3300042612 | Ga0466705_097005 | Ga0466705_097005_7656_8963 | 435 |
| 166 | 3300042618 | Ga0466723_022551 | Ga0466723_022551_7293_8600 | 435 |
| 167 | 3300042621 | Ga0466729_224969 | Ga0466729_224969_12361_13674 | 437 |
| 168 | 3300042598 | Ga0466701_046428 | Ga0466701_046428_350_1669 | 439 |
| 169 | 3300042603 | Ga0466714_008830 | Ga0466714_008830_4950_6269 | 439 |
| 170 | 3300042602 | Ga0466713_106512 | Ga0466713_106512_5539_6894 | 451 |
| 171 | 3300042609 | Ga0466722_049429 | Ga0466722_049429_5596_6960 | 454 |
| 172 | 3300005083 | Ga0068305_10204721 | Ga0068305_102047214 | 489 |
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01507 | GO:0003824 | catalytic activity | MF |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.61 | 0.63 | Medium |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.