Protein Family IF01198

Metagenome Isolate
188 Members
69 Samples
167 Scaffolds
240.62 Avg Length

🧬 Representative Sequence

ID
3300005083|Ga0068305_10097552|Ga0068305_100975526
Length
271 aa
Sequence
MIPTKIRLLKNKKRNRTLEYKPIFYVIEPEMNALITGGTKGIGFSVAKCLGAAGYDLLLSYNSDTLTAQKSCGELEKSLNISAIALKADSADPKSIDIIARHIENRDMQLDVIVFNAGLTCRDSFETMKRDDWERVFFANVHFPTFLLQRLLKRINEGGSIVFTGSLMGILPHAMSLSYGVSKSAVHALVKNLAKFLAPYKIRVNAVAPGFVDTEWQKNKPSEIRQSIESKIALGRFCEPDELAEVYKLLIQNPYINSEIIVVDGGYSYK*

📊 Sample Types

Isolate 11.2%
Metagenome 88.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 29.9%
Blattidae 28.4%
Kalotermitidae 20.9%
Unclassified 7.5%
Termopsidae 6.0%
Rhinotermitidae 4.5%
Passalidae 3.0%

🌳 Taxonomy

Archaea 0
Bacteria 184
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
2 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
3 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
4 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
5 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
6 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
7 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
8 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
9 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
10 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
11 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
12 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
13 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
14 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
15 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
16 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
17 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
18 2820751898 Unclassified Bacteroidetes Nc150P4bin22 Isolate Unclassified
19 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
20 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
21 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
22 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
23 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
24 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
25 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
26 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
27 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
28 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
29 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
30 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
31 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
32 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
33 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
34 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
35 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
36 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
37 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
38 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
39 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
40 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
41 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
42 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
43 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
44 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
45 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
46 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
47 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
48 2923982719 Parabacteroides sp. 52 Isolate Blattidae
49 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
50 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
51 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
52 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
53 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
54 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
55 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
56 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
57 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
58 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
59 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
60 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
61 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
62 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
63 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
64 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
65 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
66 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
67 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
68 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
69 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123356_10099046 3300010049 Bacteria 2793
2 Ga0123356_10556391 3300010049 Bacteria 1309
3 Ga0466713_139558 3300042602 Bacteria 11141
4 Ga0466717_161012 3300042604 Bacteria 1367
5 Ga0466717_173354 3300042604 Bacteria 1158
6 Ga0466719_427840 3300042606 Bacteria 1159
7 AustNasuHG_c1009398 3300000089 Bacteria 3432
8 JGI24702J35022_10000173 3300002462 Bacteria 33823
9 JGI24702J35022_10022894 3300002462 Bacteria 3379
10 Ga0068305_10097552 3300005083 Bacteria 14521
11 Ga0466711_075194 3300042615 Bacteria 13386
12 Ga0466711_243201 3300042615 Bacteria 2377
13 Ga0466715_063927 3300042616 Bacteria 20242
14 Ga0466715_286957 3300042616 Bacteria 6283
15 Ga0466723_049242 3300042618 Bacteria 72461
16 Ga0466723_194485 3300042618 Bacteria 2797
17 Ga0466728_016383 3300042620 Bacteria 48703
18 Ga0466728_420477 3300042620 Bacteria 25205
19 Ga0466735_049790 3300042624 Bacteria 1808
20 Ga0466703_148815 3300042636 Bacteria 16579
21 Ga0466703_163918 3300042636 Bacteria 9786
22 Ga0466704_094066 3300042643 Bacteria 24442
23 Ga0466709_004107 3300042648 Bacteria 9539
24 Ga0466709_260764 3300042648 Bacteria 7385
25 Ga0466727_242964 3300042655 Bacteria 3328
26 Ga0466727_316724 3300042655 Bacteria 6701
27 Ga0466657_041687 3300042582 Bacteria 1071
28 Ga0466693_249105 3300042592 Bacteria 3102
29 Ga0123356_11345304 3300010049 Bacteria 876
30 Ga0466713_131527 3300042602 Bacteria 55397
31 Ga0466716_340066 3300042605 Bacteria 22650
32 Ga0466711_009294 3300042615 Bacteria 6431
33 Ga0466723_238552 3300042618 Bacteria 7344
34 Ga0466723_347886 3300042618 Bacteria 4748
35 Ga0466728_306930 3300042620 Bacteria 116996
36 Ga0466728_313391 3300042620 Bacteria 9508
37 Ga0466735_036328 3300042624 Bacteria 5654
38 Ga0466703_004639 3300042636 Bacteria 9442
39 Ga0466727_202107 3300042655 Bacteria 7371
40 Ga0466692_143028 3300042591 Bacteria 24568
41 Ga0466696_059060 3300042596 Bacteria 8993
42 Ga0466733_051930 3300042659 Bacteria 8553
43 Ga0123356_10319720 3300010049 Bacteria 1665
44 Ga0466707_030267 3300042601 Bacteria 2404
45 Ga0466719_158873 3300042606 Bacteria 5768
46 2227527402 2225789004 Bacteria 16682
47 IMNBL1DRAFT_c0001124 3300000062 Bacteria 20490
48 IMNBL1DRAFT_c0003741 3300000062 Bacteria 9531
49 JGI24702J35022_10105539 3300002462 Bacteria 1546
50 JGI24699J35502_10982977 3300002509 Bacteria 1279
51 Ga0072940_1066815 3300005200 Bacteria 2280
52 Ga0466711_133490 3300042615 Bacteria 1509
53 Ga0466715_276082 3300042616 Bacteria 11278
54 Ga0466708_211570 3300042652 Bacteria 26487
55 Ga0466725_276656 3300042654 Bacteria 14850
56 Ga0466690_072790 3300042590 Bacteria 21646
57 Ga0466690_122210 3300042590 Bacteria 13871
58 Ga0466690_375807 3300042590 Bacteria 12353
59 Ga0466691_012716 3300042593 Bacteria 19248
60 Ga0466691_093973 3300042593 Bacteria 13680
61 Ga0466694_101256 3300042594 Bacteria 10822
62 Ga0466696_197138 3300042596 Bacteria 5747
63 Ga0466696_287535 3300042596 Bacteria 43348
64 Ga0123355_10110697 3300009826 Bacteria 4292
65 Ga0123356_10123608 3300010049 Bacteria 2522
66 Ga0466707_085837 3300042601 Bacteria 6920
67 Ga0466707_358349 3300042601 Bacteria 18807
68 Ga0466719_229549 3300042606 Bacteria 20920
69 Ga0466719_431712 3300042606 Bacteria 9146
70 JGI24705J35276_12237687 3300002504 Unclassified 12550
71 JGI24705J35276_12237973 3300002504 Bacteria 14618
72 Ga0068305_10001970 3300005083 Bacteria 23230
73 Ga0466711_036637 3300042615 Bacteria 5511
74 Ga0466715_193888 3300042616 Bacteria 87863
75 Ga0466715_242200 3300042616 Bacteria 1972
76 Ga0466726_400151 3300042619 Bacteria 2898
77 Ga0466730_096368 3300042625 Bacteria 1017
78 Ga0466704_062557 3300042643 Bacteria 13240
79 Ga0466704_233934 3300042643 Bacteria 27297
80 Ga0466704_345357 3300042643 Bacteria 5171
81 Ga0466709_170961 3300042648 Bacteria 6157
82 Ga0466708_091330 3300042652 Bacteria 7322
83 Ga0466708_321892 3300042652 Bacteria 7928
84 Ga0466708_367106 3300042652 Bacteria 72455
85 Ga0466727_057671 3300042655 Bacteria 13388
86 Ga0466727_206637 3300042655 Bacteria 9393
87 Ga0466727_225109 3300042655 Bacteria 4025
88 Ga0265387_1017970 3300024582 Bacteria 1030
89 Ga0466656_279686 3300042550 Bacteria 1374
90 Ga0466693_044959 3300042592 Bacteria 4448
91 Ga0466696_117970 3300042596 Bacteria 23257
92 Ga0466713_070366 3300042602 Bacteria 55899
93 2227447479 2225789004 Bacteria 5436
94 2227447485 2225789004 Bacteria 5434
95 2227448865 2225789004 Bacteria 1016
96 JGI24702J35022_10040511 3300002462 Bacteria 2484
97 JGI24699J35502_11128872 3300002509 Bacteria 4530
98 Ga0068305_10031167 3300005083 Bacteria 9795
99 Ga0466729_220506 3300042621 Bacteria 4187
100 Ga0466704_059129 3300042643 Bacteria 3860
101 Ga0466704_137344 3300042643 Bacteria 13243
102 Ga0466704_151669 3300042643 Bacteria 5189
103 Ga0466704_225577 3300042643 Unclassified 3860
104 Ga0466708_014247 3300042652 Bacteria 21773
105 Ga0466697_200936 3300042611 Bacteria 1241
106 Ga0466705_100030 3300042612 Bacteria 8932
107 Ga0466705_174208 3300042612 Bacteria 28798
108 Ga0123356_10116060 3300010049 Bacteria 2595
109 Ga0466707_022637 3300042601 Bacteria 11587
110 Ga0466716_351854 3300042605 Bacteria 31697
111 Ga0466719_384395 3300042606 Bacteria 3864
112 Ga0068302_10227441 3300005071 Bacteria 1269
113 Ga0466711_141599 3300042615 Bacteria 2377
114 Ga0466715_074368 3300042616 Bacteria 24181
115 Ga0466715_542955 3300042616 Bacteria 2039
116 Ga0466735_017994 3300042624 Bacteria 3022
117 Ga0466703_182428 3300042636 Bacteria 6795
118 Ga0466703_233285 3300042636 Bacteria 5534
119 Ga0466704_116828 3300042643 Bacteria 10950
120 Ga0466692_003914 3300042591 Bacteria 8447
121 Ga0466692_179942 3300042591 Bacteria 100786
122 Ga0466691_063180 3300042593 Bacteria 3023
123 Ga0466696_243960 3300042596 Bacteria 5564
124 Ga0466705_156547 3300042612 Bacteria 6617
125 Ga0123354_10096549 3300010882 Bacteria 4036
126 Ga0466716_177329 3300042605 Bacteria 13283
127 Ga0466719_051334 3300042606 Bacteria 11558
128 Ga0466722_221984 3300042609 Bacteria 2709
129 Ga0068305_10688425 3300005083 Bacteria 1561
130 Ga0072941_1384427 3300005201 Bacteria 2385
131 Ga0466715_083069 3300042616 Bacteria 26157
132 Ga0466715_128636 3300042616 Bacteria 28523
133 Ga0466715_482123 3300042616 Bacteria 15683
134 Ga0466715_560722 3300042616 Bacteria 1492
135 Ga0466715_643424 3300042616 Bacteria 2303
136 Ga0466704_491253 3300042643 Bacteria 4056
137 Ga0415639_225543 3300038395 Bacteria 1321
138 Ga0415639_231635 3300038395 Bacteria 1565
139 Ga0466690_113175 3300042590 Bacteria 17999
140 Ga0466690_185291 3300042590 Bacteria 4002
141 Ga0466690_245129 3300042590 Bacteria 16092
142 Ga0466690_396116 3300042590 Bacteria 22996
143 Ga0466691_017347 3300042593 Bacteria 27633
144 Ga0466691_220558 3300042593 Bacteria 2643
145 Ga0466696_015606 3300042596 Bacteria 14692
146 Ga0466696_217627 3300042596 Bacteria 13048
147 Ga0466696_341247 3300042596 Bacteria 22034
148 Ga0466705_170838 3300042612 Bacteria 23934
149 Ga0123357_10052654 3300009784 Unclassified 5496
150 Ga0123353_10058070 3300010167 Bacteria 6199
151 Ga0123353_10398633 3300010167 Unclassified 2049
152 Ga0466713_010003 3300042602 Bacteria 49152
153 Ga0466713_072265 3300042602 Bacteria 40264
154 Ga0466716_151716 3300042605 Bacteria 6578
155 Ga0466716_406042 3300042605 Bacteria 10247
156 2227479082 2225789004 Bacteria 4510
157 IMNBL1DRAFT_c0000298 3300000062 Bacteria 42272
158 IMNBL1DRAFT_c0002286 3300000062 Bacteria 13486
159 IMNBL1DRAFT_c0067204 3300000062 Bacteria 1049
160 JGI24702J35022_10003307 3300002462 Bacteria 9734
161 Ga0466715_546218 3300042616 Bacteria 6555
162 Ga0466723_200935 3300042618 Bacteria 15193
163 Ga0466735_025453 3300042624 Bacteria 25354
164 Ga0466704_195693 3300042643 Bacteria 31218
165 Ga0466704_209026 3300042643 Bacteria 44176
166 Ga0466709_265193 3300042648 Bacteria 3862
167 Ga0466725_035263 3300042654 Bacteria 13140

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300038395 Ga0415639_231635 Ga0415639_231635_15_638 207
2 3300038395 Ga0415639_225543 Ga0415639_225543_428_1066 212
3 3300042618 Ga0466723_200935 Ga0466723_200935_12585_13241 218
4 3300005083 Ga0068305_10688425 Ga0068305_106884252 225
5 3300042620 Ga0466728_306930 Ga0466728_306930_42711_43388 225
6 2225789004 2227527402 2228036458 227
7 3300000062 IMNBL1DRAFT_c0000298 IMNBL1DRAFT_000029832 227
8 3300010882 Ga0123354_10096549 Ga0123354_100965492 228
9 3300042616 Ga0466715_643424 Ga0466715_643424_1564_2262 232
10 3300042618 Ga0466723_347886 Ga0466723_347886_1624_2322 232
11 3300042652 Ga0466708_091330 Ga0466708_091330_5184_5882 232
12 3300042652 Ga0466708_211570 Ga0466708_211570_3943_4641 232
13 3300042652 Ga0466708_321892 Ga0466708_321892_4834_5532 232
14 3300000089 AustNasuHG_c1009398 AustNasuHG_10093984 233
15 3300005200 Ga0072940_1066815 Ga0072940_10668153 233
16 3300042609 Ga0466722_221984 Ga0466722_221984_72_803 233
17 3300042593 Ga0466691_063180 Ga0466691_063180_909_1616 235
18 3300042593 Ga0466691_093973 Ga0466691_093973_11017_11745 235
19 3300042616 Ga0466715_560722 Ga0466715_560722_115_822 235
20 3300042594 Ga0466694_101256 Ga0466694_101256_4200_4910 236
21 3300042604 Ga0466717_161012 Ga0466717_161012_447_1157 236
22 3300010049 Ga0123356_10099046 Ga0123356_100990462 237
23 3300010049 Ga0123356_10123608 Ga0123356_101236082 237
24 3300010049 Ga0123356_10319720 Ga0123356_103197202 237
25 3300010049 Ga0123356_10556391 Ga0123356_105563912 237
26 3300010049 Ga0123356_11345304 Ga0123356_113453042 237
27 3300010167 Ga0123353_10398633 Ga0123353_103986333 237
28 3300042591 Ga0466692_143028 Ga0466692_143028_22116_22835 239
29 3300042612 Ga0466705_156547 Ga0466705_156547_3750_4469 239
30 3300009784 Ga0123357_10052654 Ga0123357_100526543 240
31 3300010167 Ga0123353_10058070 Ga0123353_100580703 240
32 3300042601 Ga0466707_022637 Ga0466707_022637_4751_5473 240
33 3300042601 Ga0466707_085837 Ga0466707_085837_1185_1907 240
34 3300042601 Ga0466707_358349 Ga0466707_358349_786_1508 240
35 3300042602 Ga0466713_072265 Ga0466713_072265_20336_21058 240
36 3300042606 Ga0466719_384395 Ga0466719_384395_1498_2220 240
37 3300042606 Ga0466719_427840 Ga0466719_427840_244_966 240
38 3300042606 Ga0466719_431712 Ga0466719_431712_199_921 240
39 3300042616 Ga0466715_074368 Ga0466715_074368_12015_12737 240
40 3300042616 Ga0466715_276082 Ga0466715_276082_3763_4485 240
41 3300042616 Ga0466715_286957 Ga0466715_286957_2388_3110 240
42 3300042619 Ga0466726_400151 Ga0466726_400151_390_1112 240
43 3300042625 Ga0466730_096368 Ga0466730_096368_207_929 240
44 iso_pr_bacteria 2820751898 2820752398 240
45 3300002509 JGI24699J35502_10982977 JGI24699J35502_109829772 241
46 3300002509 JGI24699J35502_11128872 JGI24699J35502_111288723 241
47 3300005071 Ga0068302_10227441 Ga0068302_102274411 241
48 3300042596 Ga0466696_059060 Ga0466696_059060_2100_2825 241
49 3300042618 Ga0466723_238552 Ga0466723_238552_4060_4785 241
50 3300042636 Ga0466703_163918 Ga0466703_163918_7757_8482 241
51 3300042654 Ga0466725_035263 Ga0466725_035263_6546_7271 241
52 2225789004 2227447479 2227885040 242
53 2225789004 2227447485 2227885080 242
54 2225789004 2227448865 2227886176 242
55 2225789004 2227479082 2227935095 242
56 3300009826 Ga0123355_10110697 Ga0123355_101106974 242
57 3300024582 Ga0265387_1017970 Ga0265387_10179702 242
58 3300042582 Ga0466657_041687 Ga0466657_041687_192_920 242
59 3300042590 Ga0466690_072790 Ga0466690_072790_2293_3021 242
60 3300042590 Ga0466690_113175 Ga0466690_113175_854_1582 242
61 3300042590 Ga0466690_122210 Ga0466690_122210_2779_3507 242
62 3300042590 Ga0466690_245129 Ga0466690_245129_8429_9157 242
63 3300042590 Ga0466690_375807 Ga0466690_375807_10751_11479 242
64 3300042590 Ga0466690_396116 Ga0466690_396116_16656_17384 242
65 3300042591 Ga0466692_003914 Ga0466692_003914_4206_4934 242
66 3300042591 Ga0466692_179942 Ga0466692_179942_98300_99028 242
67 3300042592 Ga0466693_044959 Ga0466693_044959_2116_2844 242
68 3300042592 Ga0466693_249105 Ga0466693_249105_694_1422 242
69 3300042593 Ga0466691_017347 Ga0466691_017347_16478_17206 242
70 3300042596 Ga0466696_015606 Ga0466696_015606_2520_3248 242
71 3300042596 Ga0466696_197138 Ga0466696_197138_3726_4454 242
72 3300042596 Ga0466696_217627 Ga0466696_217627_10555_11283 242
73 3300042596 Ga0466696_243960 Ga0466696_243960_1295_2023 242
74 3300042596 Ga0466696_287535 Ga0466696_287535_40481_41209 242
75 3300042596 Ga0466696_341247 Ga0466696_341247_10836_11564 242
76 3300042601 Ga0466707_030267 Ga0466707_030267_917_1645 242
77 3300042602 Ga0466713_010003 Ga0466713_010003_23055_23783 242
78 3300042602 Ga0466713_070366 Ga0466713_070366_35430_36158 242
79 3300042602 Ga0466713_131527 Ga0466713_131527_6434_7162 242
80 3300042604 Ga0466717_173354 Ga0466717_173354_370_1098 242
81 3300042605 Ga0466716_151716 Ga0466716_151716_5068_5796 242
82 3300042605 Ga0466716_177329 Ga0466716_177329_8718_9446 242
83 3300042605 Ga0466716_351854 Ga0466716_351854_19107_19835 242
84 3300042605 Ga0466716_406042 Ga0466716_406042_2490_3218 242
85 3300042606 Ga0466719_051334 Ga0466719_051334_2779_3507 242
86 3300042606 Ga0466719_158873 Ga0466719_158873_2510_3238 242
87 3300042606 Ga0466719_229549 Ga0466719_229549_16501_17229 242
88 3300042612 Ga0466705_100030 Ga0466705_100030_5507_6235 242
89 3300042612 Ga0466705_170838 Ga0466705_170838_11436_12164 242
90 3300042615 Ga0466711_009294 Ga0466711_009294_2709_3437 242
91 3300042615 Ga0466711_036637 Ga0466711_036637_553_1281 242
92 3300042615 Ga0466711_075194 Ga0466711_075194_8382_9110 242
93 3300042615 Ga0466711_133490 Ga0466711_133490_157_885 242
94 3300042615 Ga0466711_141599 Ga0466711_141599_400_1128 242
95 3300042615 Ga0466711_243201 Ga0466711_243201_400_1128 242
96 3300042616 Ga0466715_083069 Ga0466715_083069_15901_16629 242
97 3300042616 Ga0466715_128636 Ga0466715_128636_8635_9363 242
98 3300042616 Ga0466715_193888 Ga0466715_193888_81261_81989 242
99 3300042616 Ga0466715_242200 Ga0466715_242200_769_1497 242
100 3300042616 Ga0466715_482123 Ga0466715_482123_2964_3692 242
101 3300042616 Ga0466715_542955 Ga0466715_542955_276_1004 242
102 3300042616 Ga0466715_546218 Ga0466715_546218_5526_6254 242
103 3300042618 Ga0466723_049242 Ga0466723_049242_52054_52782 242
104 3300042618 Ga0466723_194485 Ga0466723_194485_1423_2151 242
105 3300042620 Ga0466728_016383 Ga0466728_016383_36742_37470 242
106 3300042620 Ga0466728_313391 Ga0466728_313391_6871_7599 242
107 3300042620 Ga0466728_420477 Ga0466728_420477_5435_6163 242
108 3300042624 Ga0466735_025453 Ga0466735_025453_6081_6809 242
109 3300042624 Ga0466735_036328 Ga0466735_036328_4051_4779 242
110 3300042624 Ga0466735_049790 Ga0466735_049790_458_1186 242
111 3300042636 Ga0466703_148815 Ga0466703_148815_5306_6034 242
112 3300042643 Ga0466704_059129 Ga0466704_059129_435_1163 242
113 3300042643 Ga0466704_062557 Ga0466704_062557_2171_2899 242
114 3300042643 Ga0466704_094066 Ga0466704_094066_5111_5839 242
115 3300042643 Ga0466704_116828 Ga0466704_116828_4311_5039 242
116 3300042643 Ga0466704_137344 Ga0466704_137344_8247_8975 242
117 3300042643 Ga0466704_151669 Ga0466704_151669_4309_5037 242
118 3300042643 Ga0466704_195693 Ga0466704_195693_28306_29034 242
119 3300042643 Ga0466704_209026 Ga0466704_209026_16823_17551 242
120 3300042643 Ga0466704_225577 Ga0466704_225577_435_1163 242
121 3300042643 Ga0466704_233934 Ga0466704_233934_15851_16579 242
122 3300042643 Ga0466704_345357 Ga0466704_345357_3298_4026 242
123 3300042643 Ga0466704_491253 Ga0466704_491253_2367_3095 242
124 3300042648 Ga0466709_004107 Ga0466709_004107_4492_5220 242
125 3300042648 Ga0466709_170961 Ga0466709_170961_3639_4367 242
126 3300042648 Ga0466709_260764 Ga0466709_260764_952_1680 242
127 3300042648 Ga0466709_265193 Ga0466709_265193_1255_1983 242
128 3300042652 Ga0466708_014247 Ga0466708_014247_11274_12002 242
129 3300042652 Ga0466708_367106 Ga0466708_367106_12993_13721 242
130 3300042654 Ga0466725_276656 Ga0466725_276656_10053_10781 242
131 3300042655 Ga0466727_057671 Ga0466727_057671_3218_3946 242
132 3300042655 Ga0466727_202107 Ga0466727_202107_6293_7021 242
133 3300042655 Ga0466727_206637 Ga0466727_206637_8115_8843 242
134 3300042655 Ga0466727_225109 Ga0466727_225109_709_1437 242
135 3300042659 Ga0466733_051930 Ga0466733_051930_571_1299 242
136 iso_pr_bacteria 2923982719 2923984263 242
137 iso_pr_bacteria 2940195863 2940198930 242
138 iso_pr_bacteria 2940199050 2940199198 242
139 iso_pr_bacteria 2940202316 2940204239 242
140 iso_pr_bacteria 2940205530 2940207628 242
141 iso_pr_bacteria 2940209341 2940210387 242
142 iso_pr_bacteria 2940212447 2940214543 242
143 iso_pr_bacteria 2940298504 2940300597 242
144 iso_pr_bacteria 2940302308 2940304398 242
145 iso_pr_bacteria 2940306115 2940307962 242
146 iso_pr_bacteria 2940309933 2940311775 242
147 iso_pr_bacteria 2940313741 2940315614 242
148 iso_pr_bacteria 2940317558 2940319429 242
149 iso_pr_bacteria 2940321370 2940323674 242
150 iso_pr_bacteria 2940325180 2940327271 242
151 iso_pr_bacteria 2940328985 2940331074 242
152 iso_pr_bacteria 2940332795 2940334666 242
153 iso_pr_bacteria 2940346213 2940346257 242
154 iso_pr_bacteria 2940371297 2940371938 242
155 iso_pr_bacteria 2967483437 2967483846 242
156 3300000062 IMNBL1DRAFT_c0001124 IMNBL1DRAFT_000112412 243
157 3300000062 IMNBL1DRAFT_c0002286 IMNBL1DRAFT_00022866 243
158 3300000062 IMNBL1DRAFT_c0003741 IMNBL1DRAFT_00037413 243
159 3300000062 IMNBL1DRAFT_c0067204 IMNBL1DRAFT_00672042 243
160 3300002462 JGI24702J35022_10000173 JGI24702J35022_1000017313 243
161 3300002462 JGI24702J35022_10003307 JGI24702J35022_100033077 243
162 3300002462 JGI24702J35022_10022894 JGI24702J35022_100228943 243
163 3300002462 JGI24702J35022_10040511 JGI24702J35022_100405111 243
164 3300002462 JGI24702J35022_10105539 JGI24702J35022_101055392 243
165 3300002504 JGI24705J35276_12237687 JGI24705J35276_122376878 243
166 3300002504 JGI24705J35276_12237973 JGI24705J35276_1223797311 243
167 3300005083 Ga0068305_10001970 Ga0068305_1000197017 243
168 3300005083 Ga0068305_10031167 Ga0068305_100311675 243
169 3300005201 Ga0072941_1384427 Ga0072941_13844273 243
170 3300010049 Ga0123356_10116060 Ga0123356_101160602 243
171 3300042550 Ga0466656_279686 Ga0466656_279686_99_830 243
172 3300042590 Ga0466690_185291 Ga0466690_185291_1070_1801 243
173 3300042593 Ga0466691_012716 Ga0466691_012716_9564_10295 243
174 3300042593 Ga0466691_220558 Ga0466691_220558_1645_2376 243
175 3300042605 Ga0466716_340066 Ga0466716_340066_5546_6277 243
176 3300042611 Ga0466697_200936 Ga0466697_200936_136_867 243
177 3300042616 Ga0466715_063927 Ga0466715_063927_12547_13278 243
178 3300042636 Ga0466703_182428 Ga0466703_182428_3408_4139 243
179 3300042636 Ga0466703_233285 Ga0466703_233285_2851_3582 243
180 3300042655 Ga0466727_242964 Ga0466727_242964_1571_2302 243
181 3300042655 Ga0466727_316724 Ga0466727_316724_1405_2136 243
182 3300042596 Ga0466696_117970 Ga0466696_117970_7907_8641 244
183 3300042621 Ga0466729_220506 Ga0466729_220506_251_991 246
184 3300042624 Ga0466735_017994 Ga0466735_017994_105_845 246
185 3300042612 Ga0466705_174208 Ga0466705_174208_2184_2933 249
186 3300042636 Ga0466703_004639 Ga0466703_004639_2062_2814 250
187 3300042602 Ga0466713_139558 Ga0466713_139558_9430_10188 252
188 3300005083 Ga0068305_10097552 Ga0068305_100975526 271

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 40 268 0.96
PF00106 adh_short short chain dehydrogenase 33 222 0.95
PF08659 KR KR domain 34 192 0.89

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.89 0.93 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.