Protein Family IF01198
Metagenome
Isolate
188
Members
69
Samples
167
Scaffolds
240.62
Avg Length
Representative Sequence
- ID
- 3300005083|Ga0068305_10097552|Ga0068305_100975526
- Length
- 271 aa
- Sequence
- MIPTKIRLLKNKKRNRTLEYKPIFYVIEPEMNALITGGTKGIGFSVAKCLGAAGYDLLLSYNSDTLTAQKSCGELEKSLNISAIALKADSADPKSIDIIARHIENRDMQLDVIVFNAGLTCRDSFETMKRDDWERVFFANVHFPTFLLQRLLKRINEGGSIVFTGSLMGILPHAMSLSYGVSKSAVHALVKNLAKFLAPYKIRVNAVAPGFVDTEWQKNKPSEIRQSIESKIALGRFCEPDELAEVYKLLIQNPYINSEIIVVDGGYSYK*
Sample Types
Isolate
11.2%
Metagenome
88.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
29.9%
Blattidae
28.4%
Kalotermitidae
20.9%
Unclassified
7.5%
Termopsidae
6.0%
Rhinotermitidae
4.5%
Passalidae
3.0%
Taxonomy
Archaea
0
Bacteria
184
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 2 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 3 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 4 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 5 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 6 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 7 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 8 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 9 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 10 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 11 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 12 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 13 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 14 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 15 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 16 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 17 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 18 | 2820751898 | Unclassified Bacteroidetes Nc150P4bin22 | Isolate | Unclassified |
| 19 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 20 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 21 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 22 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 23 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 24 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 25 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 26 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 27 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 28 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 29 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 30 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 31 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 32 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 33 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 34 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 35 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 36 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 37 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 38 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 39 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 40 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 41 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 42 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 43 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 44 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 45 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 46 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 47 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 48 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 49 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 50 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 51 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 52 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 53 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 54 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 55 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 56 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 57 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 58 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 59 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 60 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 61 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 62 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 63 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 64 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 65 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 66 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 67 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 68 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 69 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_10099046 | 3300010049 | Bacteria | 2793 |
| 2 | Ga0123356_10556391 | 3300010049 | Bacteria | 1309 |
| 3 | Ga0466713_139558 | 3300042602 | Bacteria | 11141 |
| 4 | Ga0466717_161012 | 3300042604 | Bacteria | 1367 |
| 5 | Ga0466717_173354 | 3300042604 | Bacteria | 1158 |
| 6 | Ga0466719_427840 | 3300042606 | Bacteria | 1159 |
| 7 | AustNasuHG_c1009398 | 3300000089 | Bacteria | 3432 |
| 8 | JGI24702J35022_10000173 | 3300002462 | Bacteria | 33823 |
| 9 | JGI24702J35022_10022894 | 3300002462 | Bacteria | 3379 |
| 10 | Ga0068305_10097552 | 3300005083 | Bacteria | 14521 |
| 11 | Ga0466711_075194 | 3300042615 | Bacteria | 13386 |
| 12 | Ga0466711_243201 | 3300042615 | Bacteria | 2377 |
| 13 | Ga0466715_063927 | 3300042616 | Bacteria | 20242 |
| 14 | Ga0466715_286957 | 3300042616 | Bacteria | 6283 |
| 15 | Ga0466723_049242 | 3300042618 | Bacteria | 72461 |
| 16 | Ga0466723_194485 | 3300042618 | Bacteria | 2797 |
| 17 | Ga0466728_016383 | 3300042620 | Bacteria | 48703 |
| 18 | Ga0466728_420477 | 3300042620 | Bacteria | 25205 |
| 19 | Ga0466735_049790 | 3300042624 | Bacteria | 1808 |
| 20 | Ga0466703_148815 | 3300042636 | Bacteria | 16579 |
| 21 | Ga0466703_163918 | 3300042636 | Bacteria | 9786 |
| 22 | Ga0466704_094066 | 3300042643 | Bacteria | 24442 |
| 23 | Ga0466709_004107 | 3300042648 | Bacteria | 9539 |
| 24 | Ga0466709_260764 | 3300042648 | Bacteria | 7385 |
| 25 | Ga0466727_242964 | 3300042655 | Bacteria | 3328 |
| 26 | Ga0466727_316724 | 3300042655 | Bacteria | 6701 |
| 27 | Ga0466657_041687 | 3300042582 | Bacteria | 1071 |
| 28 | Ga0466693_249105 | 3300042592 | Bacteria | 3102 |
| 29 | Ga0123356_11345304 | 3300010049 | Bacteria | 876 |
| 30 | Ga0466713_131527 | 3300042602 | Bacteria | 55397 |
| 31 | Ga0466716_340066 | 3300042605 | Bacteria | 22650 |
| 32 | Ga0466711_009294 | 3300042615 | Bacteria | 6431 |
| 33 | Ga0466723_238552 | 3300042618 | Bacteria | 7344 |
| 34 | Ga0466723_347886 | 3300042618 | Bacteria | 4748 |
| 35 | Ga0466728_306930 | 3300042620 | Bacteria | 116996 |
| 36 | Ga0466728_313391 | 3300042620 | Bacteria | 9508 |
| 37 | Ga0466735_036328 | 3300042624 | Bacteria | 5654 |
| 38 | Ga0466703_004639 | 3300042636 | Bacteria | 9442 |
| 39 | Ga0466727_202107 | 3300042655 | Bacteria | 7371 |
| 40 | Ga0466692_143028 | 3300042591 | Bacteria | 24568 |
| 41 | Ga0466696_059060 | 3300042596 | Bacteria | 8993 |
| 42 | Ga0466733_051930 | 3300042659 | Bacteria | 8553 |
| 43 | Ga0123356_10319720 | 3300010049 | Bacteria | 1665 |
| 44 | Ga0466707_030267 | 3300042601 | Bacteria | 2404 |
| 45 | Ga0466719_158873 | 3300042606 | Bacteria | 5768 |
| 46 | 2227527402 | 2225789004 | Bacteria | 16682 |
| 47 | IMNBL1DRAFT_c0001124 | 3300000062 | Bacteria | 20490 |
| 48 | IMNBL1DRAFT_c0003741 | 3300000062 | Bacteria | 9531 |
| 49 | JGI24702J35022_10105539 | 3300002462 | Bacteria | 1546 |
| 50 | JGI24699J35502_10982977 | 3300002509 | Bacteria | 1279 |
| 51 | Ga0072940_1066815 | 3300005200 | Bacteria | 2280 |
| 52 | Ga0466711_133490 | 3300042615 | Bacteria | 1509 |
| 53 | Ga0466715_276082 | 3300042616 | Bacteria | 11278 |
| 54 | Ga0466708_211570 | 3300042652 | Bacteria | 26487 |
| 55 | Ga0466725_276656 | 3300042654 | Bacteria | 14850 |
| 56 | Ga0466690_072790 | 3300042590 | Bacteria | 21646 |
| 57 | Ga0466690_122210 | 3300042590 | Bacteria | 13871 |
| 58 | Ga0466690_375807 | 3300042590 | Bacteria | 12353 |
| 59 | Ga0466691_012716 | 3300042593 | Bacteria | 19248 |
| 60 | Ga0466691_093973 | 3300042593 | Bacteria | 13680 |
| 61 | Ga0466694_101256 | 3300042594 | Bacteria | 10822 |
| 62 | Ga0466696_197138 | 3300042596 | Bacteria | 5747 |
| 63 | Ga0466696_287535 | 3300042596 | Bacteria | 43348 |
| 64 | Ga0123355_10110697 | 3300009826 | Bacteria | 4292 |
| 65 | Ga0123356_10123608 | 3300010049 | Bacteria | 2522 |
| 66 | Ga0466707_085837 | 3300042601 | Bacteria | 6920 |
| 67 | Ga0466707_358349 | 3300042601 | Bacteria | 18807 |
| 68 | Ga0466719_229549 | 3300042606 | Bacteria | 20920 |
| 69 | Ga0466719_431712 | 3300042606 | Bacteria | 9146 |
| 70 | JGI24705J35276_12237687 | 3300002504 | Unclassified | 12550 |
| 71 | JGI24705J35276_12237973 | 3300002504 | Bacteria | 14618 |
| 72 | Ga0068305_10001970 | 3300005083 | Bacteria | 23230 |
| 73 | Ga0466711_036637 | 3300042615 | Bacteria | 5511 |
| 74 | Ga0466715_193888 | 3300042616 | Bacteria | 87863 |
| 75 | Ga0466715_242200 | 3300042616 | Bacteria | 1972 |
| 76 | Ga0466726_400151 | 3300042619 | Bacteria | 2898 |
| 77 | Ga0466730_096368 | 3300042625 | Bacteria | 1017 |
| 78 | Ga0466704_062557 | 3300042643 | Bacteria | 13240 |
| 79 | Ga0466704_233934 | 3300042643 | Bacteria | 27297 |
| 80 | Ga0466704_345357 | 3300042643 | Bacteria | 5171 |
| 81 | Ga0466709_170961 | 3300042648 | Bacteria | 6157 |
| 82 | Ga0466708_091330 | 3300042652 | Bacteria | 7322 |
| 83 | Ga0466708_321892 | 3300042652 | Bacteria | 7928 |
| 84 | Ga0466708_367106 | 3300042652 | Bacteria | 72455 |
| 85 | Ga0466727_057671 | 3300042655 | Bacteria | 13388 |
| 86 | Ga0466727_206637 | 3300042655 | Bacteria | 9393 |
| 87 | Ga0466727_225109 | 3300042655 | Bacteria | 4025 |
| 88 | Ga0265387_1017970 | 3300024582 | Bacteria | 1030 |
| 89 | Ga0466656_279686 | 3300042550 | Bacteria | 1374 |
| 90 | Ga0466693_044959 | 3300042592 | Bacteria | 4448 |
| 91 | Ga0466696_117970 | 3300042596 | Bacteria | 23257 |
| 92 | Ga0466713_070366 | 3300042602 | Bacteria | 55899 |
| 93 | 2227447479 | 2225789004 | Bacteria | 5436 |
| 94 | 2227447485 | 2225789004 | Bacteria | 5434 |
| 95 | 2227448865 | 2225789004 | Bacteria | 1016 |
| 96 | JGI24702J35022_10040511 | 3300002462 | Bacteria | 2484 |
| 97 | JGI24699J35502_11128872 | 3300002509 | Bacteria | 4530 |
| 98 | Ga0068305_10031167 | 3300005083 | Bacteria | 9795 |
| 99 | Ga0466729_220506 | 3300042621 | Bacteria | 4187 |
| 100 | Ga0466704_059129 | 3300042643 | Bacteria | 3860 |
| 101 | Ga0466704_137344 | 3300042643 | Bacteria | 13243 |
| 102 | Ga0466704_151669 | 3300042643 | Bacteria | 5189 |
| 103 | Ga0466704_225577 | 3300042643 | Unclassified | 3860 |
| 104 | Ga0466708_014247 | 3300042652 | Bacteria | 21773 |
| 105 | Ga0466697_200936 | 3300042611 | Bacteria | 1241 |
| 106 | Ga0466705_100030 | 3300042612 | Bacteria | 8932 |
| 107 | Ga0466705_174208 | 3300042612 | Bacteria | 28798 |
| 108 | Ga0123356_10116060 | 3300010049 | Bacteria | 2595 |
| 109 | Ga0466707_022637 | 3300042601 | Bacteria | 11587 |
| 110 | Ga0466716_351854 | 3300042605 | Bacteria | 31697 |
| 111 | Ga0466719_384395 | 3300042606 | Bacteria | 3864 |
| 112 | Ga0068302_10227441 | 3300005071 | Bacteria | 1269 |
| 113 | Ga0466711_141599 | 3300042615 | Bacteria | 2377 |
| 114 | Ga0466715_074368 | 3300042616 | Bacteria | 24181 |
| 115 | Ga0466715_542955 | 3300042616 | Bacteria | 2039 |
| 116 | Ga0466735_017994 | 3300042624 | Bacteria | 3022 |
| 117 | Ga0466703_182428 | 3300042636 | Bacteria | 6795 |
| 118 | Ga0466703_233285 | 3300042636 | Bacteria | 5534 |
| 119 | Ga0466704_116828 | 3300042643 | Bacteria | 10950 |
| 120 | Ga0466692_003914 | 3300042591 | Bacteria | 8447 |
| 121 | Ga0466692_179942 | 3300042591 | Bacteria | 100786 |
| 122 | Ga0466691_063180 | 3300042593 | Bacteria | 3023 |
| 123 | Ga0466696_243960 | 3300042596 | Bacteria | 5564 |
| 124 | Ga0466705_156547 | 3300042612 | Bacteria | 6617 |
| 125 | Ga0123354_10096549 | 3300010882 | Bacteria | 4036 |
| 126 | Ga0466716_177329 | 3300042605 | Bacteria | 13283 |
| 127 | Ga0466719_051334 | 3300042606 | Bacteria | 11558 |
| 128 | Ga0466722_221984 | 3300042609 | Bacteria | 2709 |
| 129 | Ga0068305_10688425 | 3300005083 | Bacteria | 1561 |
| 130 | Ga0072941_1384427 | 3300005201 | Bacteria | 2385 |
| 131 | Ga0466715_083069 | 3300042616 | Bacteria | 26157 |
| 132 | Ga0466715_128636 | 3300042616 | Bacteria | 28523 |
| 133 | Ga0466715_482123 | 3300042616 | Bacteria | 15683 |
| 134 | Ga0466715_560722 | 3300042616 | Bacteria | 1492 |
| 135 | Ga0466715_643424 | 3300042616 | Bacteria | 2303 |
| 136 | Ga0466704_491253 | 3300042643 | Bacteria | 4056 |
| 137 | Ga0415639_225543 | 3300038395 | Bacteria | 1321 |
| 138 | Ga0415639_231635 | 3300038395 | Bacteria | 1565 |
| 139 | Ga0466690_113175 | 3300042590 | Bacteria | 17999 |
| 140 | Ga0466690_185291 | 3300042590 | Bacteria | 4002 |
| 141 | Ga0466690_245129 | 3300042590 | Bacteria | 16092 |
| 142 | Ga0466690_396116 | 3300042590 | Bacteria | 22996 |
| 143 | Ga0466691_017347 | 3300042593 | Bacteria | 27633 |
| 144 | Ga0466691_220558 | 3300042593 | Bacteria | 2643 |
| 145 | Ga0466696_015606 | 3300042596 | Bacteria | 14692 |
| 146 | Ga0466696_217627 | 3300042596 | Bacteria | 13048 |
| 147 | Ga0466696_341247 | 3300042596 | Bacteria | 22034 |
| 148 | Ga0466705_170838 | 3300042612 | Bacteria | 23934 |
| 149 | Ga0123357_10052654 | 3300009784 | Unclassified | 5496 |
| 150 | Ga0123353_10058070 | 3300010167 | Bacteria | 6199 |
| 151 | Ga0123353_10398633 | 3300010167 | Unclassified | 2049 |
| 152 | Ga0466713_010003 | 3300042602 | Bacteria | 49152 |
| 153 | Ga0466713_072265 | 3300042602 | Bacteria | 40264 |
| 154 | Ga0466716_151716 | 3300042605 | Bacteria | 6578 |
| 155 | Ga0466716_406042 | 3300042605 | Bacteria | 10247 |
| 156 | 2227479082 | 2225789004 | Bacteria | 4510 |
| 157 | IMNBL1DRAFT_c0000298 | 3300000062 | Bacteria | 42272 |
| 158 | IMNBL1DRAFT_c0002286 | 3300000062 | Bacteria | 13486 |
| 159 | IMNBL1DRAFT_c0067204 | 3300000062 | Bacteria | 1049 |
| 160 | JGI24702J35022_10003307 | 3300002462 | Bacteria | 9734 |
| 161 | Ga0466715_546218 | 3300042616 | Bacteria | 6555 |
| 162 | Ga0466723_200935 | 3300042618 | Bacteria | 15193 |
| 163 | Ga0466735_025453 | 3300042624 | Bacteria | 25354 |
| 164 | Ga0466704_195693 | 3300042643 | Bacteria | 31218 |
| 165 | Ga0466704_209026 | 3300042643 | Bacteria | 44176 |
| 166 | Ga0466709_265193 | 3300042648 | Bacteria | 3862 |
| 167 | Ga0466725_035263 | 3300042654 | Bacteria | 13140 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300038395 | Ga0415639_231635 | Ga0415639_231635_15_638 | 207 |
| 2 | 3300038395 | Ga0415639_225543 | Ga0415639_225543_428_1066 | 212 |
| 3 | 3300042618 | Ga0466723_200935 | Ga0466723_200935_12585_13241 | 218 |
| 4 | 3300005083 | Ga0068305_10688425 | Ga0068305_106884252 | 225 |
| 5 | 3300042620 | Ga0466728_306930 | Ga0466728_306930_42711_43388 | 225 |
| 6 | 2225789004 | 2227527402 | 2228036458 | 227 |
| 7 | 3300000062 | IMNBL1DRAFT_c0000298 | IMNBL1DRAFT_000029832 | 227 |
| 8 | 3300010882 | Ga0123354_10096549 | Ga0123354_100965492 | 228 |
| 9 | 3300042616 | Ga0466715_643424 | Ga0466715_643424_1564_2262 | 232 |
| 10 | 3300042618 | Ga0466723_347886 | Ga0466723_347886_1624_2322 | 232 |
| 11 | 3300042652 | Ga0466708_091330 | Ga0466708_091330_5184_5882 | 232 |
| 12 | 3300042652 | Ga0466708_211570 | Ga0466708_211570_3943_4641 | 232 |
| 13 | 3300042652 | Ga0466708_321892 | Ga0466708_321892_4834_5532 | 232 |
| 14 | 3300000089 | AustNasuHG_c1009398 | AustNasuHG_10093984 | 233 |
| 15 | 3300005200 | Ga0072940_1066815 | Ga0072940_10668153 | 233 |
| 16 | 3300042609 | Ga0466722_221984 | Ga0466722_221984_72_803 | 233 |
| 17 | 3300042593 | Ga0466691_063180 | Ga0466691_063180_909_1616 | 235 |
| 18 | 3300042593 | Ga0466691_093973 | Ga0466691_093973_11017_11745 | 235 |
| 19 | 3300042616 | Ga0466715_560722 | Ga0466715_560722_115_822 | 235 |
| 20 | 3300042594 | Ga0466694_101256 | Ga0466694_101256_4200_4910 | 236 |
| 21 | 3300042604 | Ga0466717_161012 | Ga0466717_161012_447_1157 | 236 |
| 22 | 3300010049 | Ga0123356_10099046 | Ga0123356_100990462 | 237 |
| 23 | 3300010049 | Ga0123356_10123608 | Ga0123356_101236082 | 237 |
| 24 | 3300010049 | Ga0123356_10319720 | Ga0123356_103197202 | 237 |
| 25 | 3300010049 | Ga0123356_10556391 | Ga0123356_105563912 | 237 |
| 26 | 3300010049 | Ga0123356_11345304 | Ga0123356_113453042 | 237 |
| 27 | 3300010167 | Ga0123353_10398633 | Ga0123353_103986333 | 237 |
| 28 | 3300042591 | Ga0466692_143028 | Ga0466692_143028_22116_22835 | 239 |
| 29 | 3300042612 | Ga0466705_156547 | Ga0466705_156547_3750_4469 | 239 |
| 30 | 3300009784 | Ga0123357_10052654 | Ga0123357_100526543 | 240 |
| 31 | 3300010167 | Ga0123353_10058070 | Ga0123353_100580703 | 240 |
| 32 | 3300042601 | Ga0466707_022637 | Ga0466707_022637_4751_5473 | 240 |
| 33 | 3300042601 | Ga0466707_085837 | Ga0466707_085837_1185_1907 | 240 |
| 34 | 3300042601 | Ga0466707_358349 | Ga0466707_358349_786_1508 | 240 |
| 35 | 3300042602 | Ga0466713_072265 | Ga0466713_072265_20336_21058 | 240 |
| 36 | 3300042606 | Ga0466719_384395 | Ga0466719_384395_1498_2220 | 240 |
| 37 | 3300042606 | Ga0466719_427840 | Ga0466719_427840_244_966 | 240 |
| 38 | 3300042606 | Ga0466719_431712 | Ga0466719_431712_199_921 | 240 |
| 39 | 3300042616 | Ga0466715_074368 | Ga0466715_074368_12015_12737 | 240 |
| 40 | 3300042616 | Ga0466715_276082 | Ga0466715_276082_3763_4485 | 240 |
| 41 | 3300042616 | Ga0466715_286957 | Ga0466715_286957_2388_3110 | 240 |
| 42 | 3300042619 | Ga0466726_400151 | Ga0466726_400151_390_1112 | 240 |
| 43 | 3300042625 | Ga0466730_096368 | Ga0466730_096368_207_929 | 240 |
| 44 | iso_pr_bacteria | 2820751898 | 2820752398 | 240 |
| 45 | 3300002509 | JGI24699J35502_10982977 | JGI24699J35502_109829772 | 241 |
| 46 | 3300002509 | JGI24699J35502_11128872 | JGI24699J35502_111288723 | 241 |
| 47 | 3300005071 | Ga0068302_10227441 | Ga0068302_102274411 | 241 |
| 48 | 3300042596 | Ga0466696_059060 | Ga0466696_059060_2100_2825 | 241 |
| 49 | 3300042618 | Ga0466723_238552 | Ga0466723_238552_4060_4785 | 241 |
| 50 | 3300042636 | Ga0466703_163918 | Ga0466703_163918_7757_8482 | 241 |
| 51 | 3300042654 | Ga0466725_035263 | Ga0466725_035263_6546_7271 | 241 |
| 52 | 2225789004 | 2227447479 | 2227885040 | 242 |
| 53 | 2225789004 | 2227447485 | 2227885080 | 242 |
| 54 | 2225789004 | 2227448865 | 2227886176 | 242 |
| 55 | 2225789004 | 2227479082 | 2227935095 | 242 |
| 56 | 3300009826 | Ga0123355_10110697 | Ga0123355_101106974 | 242 |
| 57 | 3300024582 | Ga0265387_1017970 | Ga0265387_10179702 | 242 |
| 58 | 3300042582 | Ga0466657_041687 | Ga0466657_041687_192_920 | 242 |
| 59 | 3300042590 | Ga0466690_072790 | Ga0466690_072790_2293_3021 | 242 |
| 60 | 3300042590 | Ga0466690_113175 | Ga0466690_113175_854_1582 | 242 |
| 61 | 3300042590 | Ga0466690_122210 | Ga0466690_122210_2779_3507 | 242 |
| 62 | 3300042590 | Ga0466690_245129 | Ga0466690_245129_8429_9157 | 242 |
| 63 | 3300042590 | Ga0466690_375807 | Ga0466690_375807_10751_11479 | 242 |
| 64 | 3300042590 | Ga0466690_396116 | Ga0466690_396116_16656_17384 | 242 |
| 65 | 3300042591 | Ga0466692_003914 | Ga0466692_003914_4206_4934 | 242 |
| 66 | 3300042591 | Ga0466692_179942 | Ga0466692_179942_98300_99028 | 242 |
| 67 | 3300042592 | Ga0466693_044959 | Ga0466693_044959_2116_2844 | 242 |
| 68 | 3300042592 | Ga0466693_249105 | Ga0466693_249105_694_1422 | 242 |
| 69 | 3300042593 | Ga0466691_017347 | Ga0466691_017347_16478_17206 | 242 |
| 70 | 3300042596 | Ga0466696_015606 | Ga0466696_015606_2520_3248 | 242 |
| 71 | 3300042596 | Ga0466696_197138 | Ga0466696_197138_3726_4454 | 242 |
| 72 | 3300042596 | Ga0466696_217627 | Ga0466696_217627_10555_11283 | 242 |
| 73 | 3300042596 | Ga0466696_243960 | Ga0466696_243960_1295_2023 | 242 |
| 74 | 3300042596 | Ga0466696_287535 | Ga0466696_287535_40481_41209 | 242 |
| 75 | 3300042596 | Ga0466696_341247 | Ga0466696_341247_10836_11564 | 242 |
| 76 | 3300042601 | Ga0466707_030267 | Ga0466707_030267_917_1645 | 242 |
| 77 | 3300042602 | Ga0466713_010003 | Ga0466713_010003_23055_23783 | 242 |
| 78 | 3300042602 | Ga0466713_070366 | Ga0466713_070366_35430_36158 | 242 |
| 79 | 3300042602 | Ga0466713_131527 | Ga0466713_131527_6434_7162 | 242 |
| 80 | 3300042604 | Ga0466717_173354 | Ga0466717_173354_370_1098 | 242 |
| 81 | 3300042605 | Ga0466716_151716 | Ga0466716_151716_5068_5796 | 242 |
| 82 | 3300042605 | Ga0466716_177329 | Ga0466716_177329_8718_9446 | 242 |
| 83 | 3300042605 | Ga0466716_351854 | Ga0466716_351854_19107_19835 | 242 |
| 84 | 3300042605 | Ga0466716_406042 | Ga0466716_406042_2490_3218 | 242 |
| 85 | 3300042606 | Ga0466719_051334 | Ga0466719_051334_2779_3507 | 242 |
| 86 | 3300042606 | Ga0466719_158873 | Ga0466719_158873_2510_3238 | 242 |
| 87 | 3300042606 | Ga0466719_229549 | Ga0466719_229549_16501_17229 | 242 |
| 88 | 3300042612 | Ga0466705_100030 | Ga0466705_100030_5507_6235 | 242 |
| 89 | 3300042612 | Ga0466705_170838 | Ga0466705_170838_11436_12164 | 242 |
| 90 | 3300042615 | Ga0466711_009294 | Ga0466711_009294_2709_3437 | 242 |
| 91 | 3300042615 | Ga0466711_036637 | Ga0466711_036637_553_1281 | 242 |
| 92 | 3300042615 | Ga0466711_075194 | Ga0466711_075194_8382_9110 | 242 |
| 93 | 3300042615 | Ga0466711_133490 | Ga0466711_133490_157_885 | 242 |
| 94 | 3300042615 | Ga0466711_141599 | Ga0466711_141599_400_1128 | 242 |
| 95 | 3300042615 | Ga0466711_243201 | Ga0466711_243201_400_1128 | 242 |
| 96 | 3300042616 | Ga0466715_083069 | Ga0466715_083069_15901_16629 | 242 |
| 97 | 3300042616 | Ga0466715_128636 | Ga0466715_128636_8635_9363 | 242 |
| 98 | 3300042616 | Ga0466715_193888 | Ga0466715_193888_81261_81989 | 242 |
| 99 | 3300042616 | Ga0466715_242200 | Ga0466715_242200_769_1497 | 242 |
| 100 | 3300042616 | Ga0466715_482123 | Ga0466715_482123_2964_3692 | 242 |
| 101 | 3300042616 | Ga0466715_542955 | Ga0466715_542955_276_1004 | 242 |
| 102 | 3300042616 | Ga0466715_546218 | Ga0466715_546218_5526_6254 | 242 |
| 103 | 3300042618 | Ga0466723_049242 | Ga0466723_049242_52054_52782 | 242 |
| 104 | 3300042618 | Ga0466723_194485 | Ga0466723_194485_1423_2151 | 242 |
| 105 | 3300042620 | Ga0466728_016383 | Ga0466728_016383_36742_37470 | 242 |
| 106 | 3300042620 | Ga0466728_313391 | Ga0466728_313391_6871_7599 | 242 |
| 107 | 3300042620 | Ga0466728_420477 | Ga0466728_420477_5435_6163 | 242 |
| 108 | 3300042624 | Ga0466735_025453 | Ga0466735_025453_6081_6809 | 242 |
| 109 | 3300042624 | Ga0466735_036328 | Ga0466735_036328_4051_4779 | 242 |
| 110 | 3300042624 | Ga0466735_049790 | Ga0466735_049790_458_1186 | 242 |
| 111 | 3300042636 | Ga0466703_148815 | Ga0466703_148815_5306_6034 | 242 |
| 112 | 3300042643 | Ga0466704_059129 | Ga0466704_059129_435_1163 | 242 |
| 113 | 3300042643 | Ga0466704_062557 | Ga0466704_062557_2171_2899 | 242 |
| 114 | 3300042643 | Ga0466704_094066 | Ga0466704_094066_5111_5839 | 242 |
| 115 | 3300042643 | Ga0466704_116828 | Ga0466704_116828_4311_5039 | 242 |
| 116 | 3300042643 | Ga0466704_137344 | Ga0466704_137344_8247_8975 | 242 |
| 117 | 3300042643 | Ga0466704_151669 | Ga0466704_151669_4309_5037 | 242 |
| 118 | 3300042643 | Ga0466704_195693 | Ga0466704_195693_28306_29034 | 242 |
| 119 | 3300042643 | Ga0466704_209026 | Ga0466704_209026_16823_17551 | 242 |
| 120 | 3300042643 | Ga0466704_225577 | Ga0466704_225577_435_1163 | 242 |
| 121 | 3300042643 | Ga0466704_233934 | Ga0466704_233934_15851_16579 | 242 |
| 122 | 3300042643 | Ga0466704_345357 | Ga0466704_345357_3298_4026 | 242 |
| 123 | 3300042643 | Ga0466704_491253 | Ga0466704_491253_2367_3095 | 242 |
| 124 | 3300042648 | Ga0466709_004107 | Ga0466709_004107_4492_5220 | 242 |
| 125 | 3300042648 | Ga0466709_170961 | Ga0466709_170961_3639_4367 | 242 |
| 126 | 3300042648 | Ga0466709_260764 | Ga0466709_260764_952_1680 | 242 |
| 127 | 3300042648 | Ga0466709_265193 | Ga0466709_265193_1255_1983 | 242 |
| 128 | 3300042652 | Ga0466708_014247 | Ga0466708_014247_11274_12002 | 242 |
| 129 | 3300042652 | Ga0466708_367106 | Ga0466708_367106_12993_13721 | 242 |
| 130 | 3300042654 | Ga0466725_276656 | Ga0466725_276656_10053_10781 | 242 |
| 131 | 3300042655 | Ga0466727_057671 | Ga0466727_057671_3218_3946 | 242 |
| 132 | 3300042655 | Ga0466727_202107 | Ga0466727_202107_6293_7021 | 242 |
| 133 | 3300042655 | Ga0466727_206637 | Ga0466727_206637_8115_8843 | 242 |
| 134 | 3300042655 | Ga0466727_225109 | Ga0466727_225109_709_1437 | 242 |
| 135 | 3300042659 | Ga0466733_051930 | Ga0466733_051930_571_1299 | 242 |
| 136 | iso_pr_bacteria | 2923982719 | 2923984263 | 242 |
| 137 | iso_pr_bacteria | 2940195863 | 2940198930 | 242 |
| 138 | iso_pr_bacteria | 2940199050 | 2940199198 | 242 |
| 139 | iso_pr_bacteria | 2940202316 | 2940204239 | 242 |
| 140 | iso_pr_bacteria | 2940205530 | 2940207628 | 242 |
| 141 | iso_pr_bacteria | 2940209341 | 2940210387 | 242 |
| 142 | iso_pr_bacteria | 2940212447 | 2940214543 | 242 |
| 143 | iso_pr_bacteria | 2940298504 | 2940300597 | 242 |
| 144 | iso_pr_bacteria | 2940302308 | 2940304398 | 242 |
| 145 | iso_pr_bacteria | 2940306115 | 2940307962 | 242 |
| 146 | iso_pr_bacteria | 2940309933 | 2940311775 | 242 |
| 147 | iso_pr_bacteria | 2940313741 | 2940315614 | 242 |
| 148 | iso_pr_bacteria | 2940317558 | 2940319429 | 242 |
| 149 | iso_pr_bacteria | 2940321370 | 2940323674 | 242 |
| 150 | iso_pr_bacteria | 2940325180 | 2940327271 | 242 |
| 151 | iso_pr_bacteria | 2940328985 | 2940331074 | 242 |
| 152 | iso_pr_bacteria | 2940332795 | 2940334666 | 242 |
| 153 | iso_pr_bacteria | 2940346213 | 2940346257 | 242 |
| 154 | iso_pr_bacteria | 2940371297 | 2940371938 | 242 |
| 155 | iso_pr_bacteria | 2967483437 | 2967483846 | 242 |
| 156 | 3300000062 | IMNBL1DRAFT_c0001124 | IMNBL1DRAFT_000112412 | 243 |
| 157 | 3300000062 | IMNBL1DRAFT_c0002286 | IMNBL1DRAFT_00022866 | 243 |
| 158 | 3300000062 | IMNBL1DRAFT_c0003741 | IMNBL1DRAFT_00037413 | 243 |
| 159 | 3300000062 | IMNBL1DRAFT_c0067204 | IMNBL1DRAFT_00672042 | 243 |
| 160 | 3300002462 | JGI24702J35022_10000173 | JGI24702J35022_1000017313 | 243 |
| 161 | 3300002462 | JGI24702J35022_10003307 | JGI24702J35022_100033077 | 243 |
| 162 | 3300002462 | JGI24702J35022_10022894 | JGI24702J35022_100228943 | 243 |
| 163 | 3300002462 | JGI24702J35022_10040511 | JGI24702J35022_100405111 | 243 |
| 164 | 3300002462 | JGI24702J35022_10105539 | JGI24702J35022_101055392 | 243 |
| 165 | 3300002504 | JGI24705J35276_12237687 | JGI24705J35276_122376878 | 243 |
| 166 | 3300002504 | JGI24705J35276_12237973 | JGI24705J35276_1223797311 | 243 |
| 167 | 3300005083 | Ga0068305_10001970 | Ga0068305_1000197017 | 243 |
| 168 | 3300005083 | Ga0068305_10031167 | Ga0068305_100311675 | 243 |
| 169 | 3300005201 | Ga0072941_1384427 | Ga0072941_13844273 | 243 |
| 170 | 3300010049 | Ga0123356_10116060 | Ga0123356_101160602 | 243 |
| 171 | 3300042550 | Ga0466656_279686 | Ga0466656_279686_99_830 | 243 |
| 172 | 3300042590 | Ga0466690_185291 | Ga0466690_185291_1070_1801 | 243 |
| 173 | 3300042593 | Ga0466691_012716 | Ga0466691_012716_9564_10295 | 243 |
| 174 | 3300042593 | Ga0466691_220558 | Ga0466691_220558_1645_2376 | 243 |
| 175 | 3300042605 | Ga0466716_340066 | Ga0466716_340066_5546_6277 | 243 |
| 176 | 3300042611 | Ga0466697_200936 | Ga0466697_200936_136_867 | 243 |
| 177 | 3300042616 | Ga0466715_063927 | Ga0466715_063927_12547_13278 | 243 |
| 178 | 3300042636 | Ga0466703_182428 | Ga0466703_182428_3408_4139 | 243 |
| 179 | 3300042636 | Ga0466703_233285 | Ga0466703_233285_2851_3582 | 243 |
| 180 | 3300042655 | Ga0466727_242964 | Ga0466727_242964_1571_2302 | 243 |
| 181 | 3300042655 | Ga0466727_316724 | Ga0466727_316724_1405_2136 | 243 |
| 182 | 3300042596 | Ga0466696_117970 | Ga0466696_117970_7907_8641 | 244 |
| 183 | 3300042621 | Ga0466729_220506 | Ga0466729_220506_251_991 | 246 |
| 184 | 3300042624 | Ga0466735_017994 | Ga0466735_017994_105_845 | 246 |
| 185 | 3300042612 | Ga0466705_174208 | Ga0466705_174208_2184_2933 | 249 |
| 186 | 3300042636 | Ga0466703_004639 | Ga0466703_004639_2062_2814 | 250 |
| 187 | 3300042602 | Ga0466713_139558 | Ga0466713_139558_9430_10188 | 252 |
| 188 | 3300005083 | Ga0068305_10097552 | Ga0068305_100975526 | 271 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.89 | 0.93 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.