Protein Family IF01192

Metagenome Isolate
122 Members
42 Samples
117 Scaffolds
499.59 Avg Length

🧬 Representative Sequence

ID
3300005083|Ga0068305_10065751|Ga0068305_100657512
Length
582 aa
Sequence
MGIGMFGLVVYDAGRKECEMSLMKGFCSKKFFVFNLVLLGAMFGFALSFLSFSCANPGKTGVKAQGFTDTPGSPAAFNVSPPMDALAVAEGLQNAFRFVADKAQPSVVEIKTETVQRRTIPNLDGIPWEFFFGPRDRSDSTPRSKEREFRSQGLGSGIIVRQKNGAYYALTNNHVVDGVDKDKIIVVSSAGKEYQAELVGQDDRKDLAMISFRTKDEFPLAELGDSDAVRAGDWAIAVGSPLGFMSSVTMGIVSAVGRTGGPGGNINDFIQTDAAINQGNSGGALVNIMGEVIGINTWIASNNGGSSIGLGFAIPINNAKRSIDDFIDKGKTSYGWLGVSLIDADKDLAQALGLEGKRGALTVNAFLGSPGDKGGIRAGDFITHVNGREARDRNQVTLMVGDLKPGEKAEFTVIRDGVEQKFRVTIDPRDDKVASDYKKLWPGVIVAPVTGSLRKVLELGDSAEGLAAVQVEAGSPAAVVGLQRGDIITAINETPVKDAAAFYKALREKTSKELWFGFVRGGTELESLKYKRXPIGKRAQPVLRRYGARLVKNRQRPVTAKSAFHFLQSTFSPCRGPGRPV*

📊 Sample Types

Isolate 4.1%
Metagenome 95.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 34.1%
Termitidae 31.7%
Unclassified 19.5%
Termopsidae 7.3%
Rhinotermitidae 7.3%

🌳 Taxonomy

Archaea 0
Bacteria 118
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
2 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
3 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
4 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
5 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
6 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
7 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
8 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
9 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
10 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
11 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
12 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
13 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
14 2781125691 Treponema sp. Th196P3bin73 Isolate Unclassified
15 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
16 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
17 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
18 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
19 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
20 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
21 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
22 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
23 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
24 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
25 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
26 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
27 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
28 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
29 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
30 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
31 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
32 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
33 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
34 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
35 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
36 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
37 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
38 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
39 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
40 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
41 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
42 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123356_10036988 3300010049 Bacteria 4556
2 Ga0466718_084863 3300042617 Bacteria 20109
3 Ga0466726_121611 3300042619 Bacteria 11809
4 Ga0466692_001030 3300042591 Bacteria 7363
5 Ga0466713_026171 3300042602 Bacteria 44886
6 Ga0466716_031431 3300042605 Bacteria 13180
7 Ga0466719_205580 3300042606 Bacteria 17203
8 Ga0466719_273074 3300042606 Bacteria 8121
9 Ga0466704_517718 3300042643 Unclassified 2631
10 Ga0466708_139336 3300042652 Bacteria 48639
11 JGI24698J34947_10022424 3300002449 Bacteria 3386
12 Ga0466705_048053 3300042612 Bacteria 8422
13 Ga0123356_10000125 3300010049 Bacteria 84722
14 Ga0466711_195788 3300042615 Bacteria 43179
15 Ga0466715_016086 3300042616 Bacteria 18465
16 Ga0466715_067483 3300042616 Bacteria 42347
17 Ga0466723_077836 3300042618 Bacteria 6912
18 Ga0466723_322133 3300042618 Bacteria 5773
19 Ga0456237_0001925 3300041968 Bacteria 3348
20 Ga0466692_118198 3300042591 Bacteria 4855
21 Ga0466691_118944 3300042593 Bacteria 3566
22 Ga0466719_548975 3300042606 Bacteria 13562
23 Ga0466735_013676 3300042624 Bacteria 7918
24 Ga0466703_307847 3300042636 Bacteria 10141
25 Ga0466704_072607 3300042643 Bacteria 5997
26 Ga0466708_033753 3300042652 Bacteria 12237
27 Ga0466705_279687 3300042612 Bacteria 10621
28 Ga0466705_445603 3300042612 Bacteria 24455
29 Ga0466718_091517 3300042617 Bacteria 3704
30 Ga0466690_020265 3300042590 Bacteria 3866
31 Ga0466699_165217 3300042597 Bacteria 13505
32 Ga0466719_375641 3300042606 Bacteria 9026
33 Ga0466709_294029 3300042648 Bacteria 18142
34 JGI24698J34947_10001592 3300002449 Bacteria 12046
35 JGI24695J34938_10003990 3300002450 Bacteria 9944
36 JGI24696J40584_12941566 3300002834 Bacteria 1713
37 Ga0072941_1002310 3300005201 Bacteria 31707
38 Ga0466711_143524 3300042615 Bacteria 1828
39 Ga0466718_024305 3300042617 Bacteria 24673
40 Ga0466723_163120 3300042618 Bacteria 30495
41 Ga0466726_058122 3300042619 Bacteria 1975
42 Ga0466696_294403 3300042596 Bacteria 3659
43 Ga0466707_014831 3300042601 Bacteria 2390
44 Ga0466713_067507 3300042602 Unclassified 2145
45 Ga0466720_179737 3300042607 Bacteria 2787
46 Ga0466704_093405 3300042643 Unclassified 3370
47 Ga0466704_494829 3300042643 Bacteria 21929
48 Ga0466727_050276 3300042655 Bacteria 17589
49 Ga0466727_277270 3300042655 Bacteria 4420
50 JGI24695J34938_10003114 3300002450 Bacteria 11840
51 Ga0068305_10043151 3300005083 Bacteria 8060
52 Ga0466712_214749 3300042614 Unclassified 2462
53 Ga0466715_424072 3300042616 Bacteria 2845
54 Ga0466723_064755 3300042618 Bacteria 6940
55 Ga0466728_000324 3300042620 Bacteria 13884
56 Ga0415639_015890 3300038395 Bacteria 14320
57 Ga0466691_017068 3300042593 Bacteria 13968
58 Ga0466691_113509 3300042593 Bacteria 1860
59 Ga0466694_056800 3300042594 Bacteria 9597
60 Ga0466696_149941 3300042596 Bacteria 7935
61 Ga0466699_004930 3300042597 Bacteria 3023
62 Ga0466702_083541 3300042635 Bacteria 6942
63 Ga0466703_101322 3300042636 Bacteria 2836
64 Ga0466709_304850 3300042648 Bacteria 2538
65 Ga0466709_395836 3300042648 Bacteria 9788
66 Ga0466727_063908 3300042655 Bacteria 9048
67 JGI24695J34938_10000313 3300002450 Bacteria 47889
68 Ga0466705_357238 3300042612 Bacteria 4510
69 Ga0466715_016493 3300042616 Bacteria 28311
70 Ga0466715_171069 3300042616 Bacteria 5846
71 Ga0466715_407725 3300042616 Bacteria 9726
72 Ga0466690_095730 3300042590 Bacteria 3322
73 Ga0466691_215713 3300042593 Bacteria 14019
74 Ga0466694_092760 3300042594 Bacteria 30658
75 Ga0466696_479402 3300042596 Bacteria 6960
76 Ga0466699_425438 3300042597 Bacteria 11460
77 Ga0466719_118876 3300042606 Bacteria 22691
78 Ga0466720_142832 3300042607 Bacteria 4367
79 Ga0466722_173966 3300042609 Bacteria 2769
80 Ga0466735_036339 3300042624 Bacteria 7771
81 Ga0466709_109010 3300042648 Bacteria 2268
82 Ga0072941_1083459 3300005201 Bacteria 5085
83 Ga0466705_049904 3300042612 Bacteria 3429
84 Ga0466733_002260 3300042659 Bacteria 72130
85 Ga0466733_106930 3300042659 Bacteria 27546
86 Ga0466705_428591 3300042612 Bacteria 2054
87 Ga0466711_260505 3300042615 Bacteria 24653
88 Ga0466715_055604 3300042616 Bacteria 10700
89 Ga0466715_305187 3300042616 Bacteria 8379
90 Ga0466690_068194 3300042590 Bacteria 7143
91 Ga0466692_160664 3300042591 Bacteria 21315
92 Ga0466691_016219 3300042593 Bacteria 4957
93 Ga0466691_155711 3300042593 Bacteria 3897
94 Ga0466716_321800 3300042605 Bacteria 2155
95 Ga0466719_251791 3300042606 Bacteria 13678
96 Ga0466719_279512 3300042606 Bacteria 4653
97 Ga0466720_040398 3300042607 Bacteria 4140
98 Ga0466731_219877 3300042622 Bacteria 7389
99 Ga0068305_10065751 3300005083 Bacteria 2166
100 Ga0466705_294116 3300042612 Bacteria 3903
101 Ga0466712_026582 3300042614 Bacteria 12812
102 Ga0466715_080210 3300042616 Bacteria 95686
103 Ga0466715_295665 3300042616 Bacteria 6186
104 Ga0466723_080715 3300042618 Bacteria 10553
105 Ga0466723_287200 3300042618 Bacteria 2076
106 Ga0466691_147803 3300042593 Bacteria 6598
107 Ga0466696_052798 3300042596 Bacteria 9290
108 Ga0466699_420355 3300042597 Bacteria 7481
109 Ga0466720_044223 3300042607 Bacteria 4336
110 Ga0466720_045337 3300042607 Bacteria 10655
111 Ga0466703_275112 3300042636 Bacteria 21637
112 Ga0466704_168324 3300042643 Bacteria 6315
113 Ga0466704_346596 3300042643 Bacteria 27825
114 Ga0466709_100222 3300042648 Bacteria 20265
115 Ga0466709_145958 3300042648 Bacteria 4870
116 Ga0466727_200548 3300042655 Bacteria 1901
117 JGI24695J34938_10002770 3300002450 Bacteria 12863

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042593 Ga0466691_113509 Ga0466691_113509_25_1308 427
2 3300042618 Ga0466723_287200 Ga0466723_287200_667_2058 463
3 3300042596 Ga0466696_149941 Ga0466696_149941_6338_7843 474
4 3300042607 Ga0466720_044223 Ga0466720_044223_266_1771 479
5 3300042607 Ga0466720_045337 Ga0466720_045337_5674_7176 479
6 3300042607 Ga0466720_040398 Ga0466720_040398_2548_4050 480
7 3300042605 Ga0466716_321800 Ga0466716_321800_439_1941 485
8 3300042615 Ga0466711_143524 Ga0466711_143524_31_1488 485
9 3300042636 Ga0466703_101322 Ga0466703_101322_747_2246 487
10 3300002834 JGI24696J40584_12941566 JGI24696J40584_129415661 488
11 3300042648 Ga0466709_395836 Ga0466709_395836_3458_4924 488
12 3300042596 Ga0466696_052798 Ga0466696_052798_7399_8904 489
13 3300042617 Ga0466718_084863 Ga0466718_084863_16215_17735 489
14 3300042616 Ga0466715_407725 Ga0466715_407725_1540_3063 490
15 3300042659 Ga0466733_106930 Ga0466733_106930_22888_24423 491
16 3300042614 Ga0466712_214749 Ga0466712_214749_589_2085 493
17 3300042643 Ga0466704_093405 Ga0466704_093405_474_1979 493
18 3300002449 JGI24698J34947_10022424 JGI24698J34947_100224242 494
19 3300042591 Ga0466692_160664 Ga0466692_160664_16991_18508 494
20 3300042616 Ga0466715_080210 Ga0466715_080210_45606_47090 494
21 3300042616 Ga0466715_295665 Ga0466715_295665_3385_4899 494
22 3300042652 Ga0466708_139336 Ga0466708_139336_8686_10170 494
23 3300042593 Ga0466691_155711 Ga0466691_155711_1490_2995 495
24 3300042615 Ga0466711_260505 Ga0466711_260505_18990_20477 495
25 3300042636 Ga0466703_307847 Ga0466703_307847_2417_3922 495
26 3300042606 Ga0466719_273074 Ga0466719_273074_162_1667 496
27 3300042615 Ga0466711_195788 Ga0466711_195788_5527_7017 496
28 3300042659 Ga0466733_002260 Ga0466733_002260_56637_58172 496
29 3300042597 Ga0466699_004930 Ga0466699_004930_692_2203 497
30 3300042606 Ga0466719_205580 Ga0466719_205580_11638_13164 497
31 3300042606 Ga0466719_375641 Ga0466719_375641_5145_6638 497
32 3300042607 Ga0466720_179737 Ga0466720_179737_718_2211 497
33 3300042648 Ga0466709_145958 Ga0466709_145958_627_2120 497
34 3300005201 Ga0072941_1002310 Ga0072941_100231015 498
35 3300042593 Ga0466691_147803 Ga0466691_147803_460_1956 498
36 3300042593 Ga0466691_215713 Ga0466691_215713_7396_8892 498
37 3300042597 Ga0466699_420355 Ga0466699_420355_1411_2907 498
38 3300042605 Ga0466716_031431 Ga0466716_031431_3211_4722 498
39 3300042606 Ga0466719_118876 Ga0466719_118876_2106_3602 498
40 3300042612 Ga0466705_048053 Ga0466705_048053_4549_6045 498
41 3300042612 Ga0466705_279687 Ga0466705_279687_4038_5534 498
42 3300042616 Ga0466715_055604 Ga0466715_055604_4286_5797 498
43 3300042616 Ga0466715_305187 Ga0466715_305187_1403_2899 498
44 3300042618 Ga0466723_077836 Ga0466723_077836_3630_5141 498
45 3300042618 Ga0466723_080715 Ga0466723_080715_5995_7491 498
46 3300042619 Ga0466726_058122 Ga0466726_058122_356_1852 498
47 3300042635 Ga0466702_083541 Ga0466702_083541_1403_2899 498
48 3300042643 Ga0466704_346596 Ga0466704_346596_5895_7391 498
49 3300042643 Ga0466704_494829 Ga0466704_494829_19045_20541 498
50 3300042652 Ga0466708_033753 Ga0466708_033753_7013_8524 498
51 3300042655 Ga0466727_063908 Ga0466727_063908_3335_4831 498
52 3300010049 Ga0123356_10000125 Ga0123356_1000012552 499
53 3300010049 Ga0123356_10036988 Ga0123356_100369884 499
54 3300042590 Ga0466690_095730 Ga0466690_095730_1508_3007 499
55 3300042591 Ga0466692_118198 Ga0466692_118198_483_1982 499
56 3300042593 Ga0466691_017068 Ga0466691_017068_12291_13790 499
57 3300042597 Ga0466699_165217 Ga0466699_165217_1409_2908 499
58 3300042616 Ga0466715_016493 Ga0466715_016493_22455_23954 499
59 3300042616 Ga0466715_067483 Ga0466715_067483_12360_13859 499
60 3300042618 Ga0466723_322133 Ga0466723_322133_2303_3802 499
61 3300042619 Ga0466726_121611 Ga0466726_121611_2333_3832 499
62 3300042648 Ga0466709_100222 Ga0466709_100222_6187_7686 499
63 3300042655 Ga0466727_050276 Ga0466727_050276_6320_7819 499
64 3300002449 JGI24698J34947_10001592 JGI24698J34947_100015929 500
65 3300042612 Ga0466705_294116 Ga0466705_294116_1346_2863 500
66 3300042612 Ga0466705_357238 Ga0466705_357238_1392_2894 500
67 3300042617 Ga0466718_091517 Ga0466718_091517_1662_3164 500
68 3300042636 Ga0466703_275112 Ga0466703_275112_13112_14614 500
69 3300042648 Ga0466709_109010 Ga0466709_109010_463_1965 500
70 3300042593 Ga0466691_118944 Ga0466691_118944_358_1863 501
71 3300042594 Ga0466694_092760 Ga0466694_092760_7881_9386 501
72 3300042606 Ga0466719_279512 Ga0466719_279512_2271_3776 501
73 3300042609 Ga0466722_173966 Ga0466722_173966_629_2134 501
74 3300042616 Ga0466715_016086 Ga0466715_016086_2705_4210 501
75 iso_pr_bacteria 2781125660 2781330950 501
76 3300042593 Ga0466691_016219 Ga0466691_016219_2885_4393 502
77 3300042602 Ga0466713_026171 Ga0466713_026171_11381_12889 502
78 3300042648 Ga0466709_294029 Ga0466709_294029_13980_15488 502
79 iso_pr_bacteria 2781125637 2781281987 502
80 iso_pr_bacteria 2781125649 2781306805 502
81 3300002450 JGI24695J34938_10002770 JGI24695J34938_1000277010 503
82 3300002450 JGI24695J34938_10003114 JGI24695J34938_1000311410 503
83 3300042612 Ga0466705_445603 Ga0466705_445603_1631_3142 503
84 3300042624 Ga0466735_036339 Ga0466735_036339_2682_4193 503
85 3300005201 Ga0072941_1083459 Ga0072941_10834593 504
86 3300042590 Ga0466690_020265 Ga0466690_020265_234_1748 504
87 3300042590 Ga0466690_068194 Ga0466690_068194_640_2154 504
88 3300042596 Ga0466696_294403 Ga0466696_294403_269_1783 504
89 3300042596 Ga0466696_479402 Ga0466696_479402_4324_5838 504
90 3300042617 Ga0466718_024305 Ga0466718_024305_1140_2654 504
91 3300042624 Ga0466735_013676 Ga0466735_013676_5525_7039 504
92 3300042643 Ga0466704_168324 Ga0466704_168324_1713_3227 504
93 3300042655 Ga0466727_277270 Ga0466727_277270_2125_3639 504
94 3300002450 JGI24695J34938_10003990 JGI24695J34938_100039905 505
95 3300038395 Ga0415639_015890 Ga0415639_015890_3324_4841 505
96 3300042594 Ga0466694_056800 Ga0466694_056800_5598_7115 505
97 3300042597 Ga0466699_425438 Ga0466699_425438_4874_6391 505
98 3300042606 Ga0466719_251791 Ga0466719_251791_3915_5432 505
99 3300042612 Ga0466705_049904 Ga0466705_049904_1497_3014 505
100 3300042612 Ga0466705_428591 Ga0466705_428591_154_1671 505
101 3300042616 Ga0466715_171069 Ga0466715_171069_1872_3389 505
102 3300042616 Ga0466715_424072 Ga0466715_424072_277_1794 505
103 3300042643 Ga0466704_072607 Ga0466704_072607_1054_2571 505
104 3300042643 Ga0466704_517718 Ga0466704_517718_426_1943 505
105 iso_pr_bacteria 2781125691 2781429033 505
106 3300002450 JGI24695J34938_10000313 JGI24695J34938_1000031336 506
107 3300042607 Ga0466720_142832 Ga0466720_142832_1342_2862 506
108 3300042614 Ga0466712_026582 Ga0466712_026582_4861_6381 506
109 3300042618 Ga0466723_064755 Ga0466723_064755_3795_5318 507
110 3300042620 Ga0466728_000324 Ga0466728_000324_5559_7082 507
111 3300042655 Ga0466727_200548 Ga0466727_200548_181_1704 507
112 3300042591 Ga0466692_001030 Ga0466692_001030_1085_2611 508
113 3300042601 Ga0466707_014831 Ga0466707_014831_786_2315 509
114 3300042648 Ga0466709_304850 Ga0466709_304850_856_2385 509
115 iso_pr_bacteria 2819994798 2819995987 510
116 3300005083 Ga0068305_10043151 Ga0068305_100431514 511
117 3300041968 Ga0456237_0001925 Ga0456237_0001925_1597_3141 514
118 3300042618 Ga0466723_163120 Ga0466723_163120_13983_15530 515
119 3300042606 Ga0466719_548975 Ga0466719_548975_317_1867 516
120 3300042622 Ga0466731_219877 Ga0466731_219877_4606_6183 525
121 3300042602 Ga0466713_067507 Ga0466713_067507_74_1660 528
122 3300005083 Ga0068305_10065751 Ga0068305_100657512 582

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13365 Trypsin_2 Trypsin-like peptidase domain 155 295 0.96
PF13180 PDZ_2 PDZ domain 336 426 0.93
PF17820 PDZ_6 PDZ domain 470 515 0.89
PF00089 Trypsin Trypsin 167 321 0.74

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF13180 GO:0005515 protein binding MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.67 0.81 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.