Protein Family IF01182

Metagenome Isolate
112 Members
53 Samples
109 Scaffolds
406.1 Avg Length

🧬 Representative Sequence

ID
3300005083|Ga0068305_10018912|Ga0068305_100189123
Length
442 aa
Sequence
MFDIDRWIEIWATITRNKVRSFLTCLGVFWGILMLVLLLGSGGGLKNGLLGNFEGFATNSVFVFTDRTSEPYKGFNKGRYWNMRNRDIESIRNNVPEADIVSGFLSGSRSEKNVVYGQLTGTYYVEGAFPEQFRILIPTLIYGRLLNEIDIAEKRKVCVIGSDINKTLFRNENSCGKYIRVNGIYYQIVGVVAPKTSNVNINGRTEEKVVLPFTTMQQSLNQGDIVHSLCITGRKGHTIRAMIDGVTAVLKSQNEISPTDPQAVRVINIAEQFETFGKLFTGIDILVWLVGMGTLLAGIIGISNIMMVTVKERTKEIGVRRALGAKPFNIISQVMSESLVLTALAGLLGLSLGVFILDMVDKILTAQQAAASGNTFFEHPSVSIQTAAAATVVLLISGLAAGLIPAWRAMQAHHLIGIGGNSGTQYVLLPVEESAAGDNRL*

📊 Sample Types

Isolate 2.7%
Metagenome 97.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 37.7%
Kalotermitidae 24.5%
Unclassified 9.4%
Termopsidae 7.5%
Formicidae 5.7%
Rhinotermitidae 5.7%
Passalidae 5.7%
Hodotermitidae 1.9%
Blattidae 1.9%

🌳 Taxonomy

Archaea 0
Bacteria 109
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
2 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
3 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
4 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
5 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
6 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
7 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
8 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
9 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
10 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
11 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
12 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
13 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
14 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
15 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
16 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
17 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
18 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
19 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
20 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
21 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
22 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
23 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
24 2820755292 Unclassified Bacteroidetes Nc150P3bin3 Isolate Unclassified
25 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
26 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
27 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
28 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
29 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
30 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
31 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
32 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
33 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
34 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
35 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
36 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
37 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
38 3004667792 Bacteroides sp. 519 Isolate Blattidae
39 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
40 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
41 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
42 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
43 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
44 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
45 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
46 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
47 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
48 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
49 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
50 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
51 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
52 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
53 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466697_281283 3300042611 Bacteria 1372
2 Ga0466705_221960 3300042612 Bacteria 7432
3 Ga0123356_10030655 3300010049 Bacteria 5033
4 Ga0466717_096457 3300042604 Bacteria 1447
5 Ga0466716_527992 3300042605 Bacteria 9605
6 Ga0466722_137495 3300042609 Bacteria 11651
7 Ga0466657_121324 3300042582 Bacteria 2340
8 Ga0466692_179176 3300042591 Bacteria 7920
9 Ga0466704_352277 3300042643 Bacteria 13970
10 Ga0466727_297477 3300042655 Bacteria 7302
11 Ga0466733_216481 3300042659 Bacteria 14138
12 Ga0466715_109794 3300042616 Bacteria 37807
13 Ga0466723_046709 3300042618 Bacteria 21444
14 Ga0466729_114703 3300042621 Bacteria 8889
15 Ga0123354_10001134 3300010882 Bacteria 31081
16 Ga0466707_018939 3300042601 Bacteria 18217
17 Ga0466707_218377 3300042601 Bacteria 11249
18 Ga0466707_233004 3300042601 Bacteria 2896
19 Ga0466713_009199 3300042602 Bacteria 8653
20 Ga0068305_10018912 3300005083 Bacteria 5676
21 Ga0466691_040271 3300042593 Bacteria 19293
22 Ga0466695_235673 3300042595 Bacteria 18098
23 Ga0466696_489056 3300042596 Bacteria 3534
24 Ga0466734_122869 3300042623 Bacteria 1605
25 Ga0466730_090432 3300042625 Bacteria 7143
26 Ga0466704_461185 3300042643 Bacteria 28981
27 Ga0466708_024546 3300042652 Bacteria 37398
28 Ga0466708_098063 3300042652 Bacteria 8204
29 Ga0466727_102556 3300042655 Bacteria 5299
30 Ga0466697_193799 3300042611 Bacteria 2854
31 Ga0466710_347193 3300042613 Bacteria 2004
32 Ga0466715_100521 3300042616 Unclassified 6564
33 Ga0466723_116763 3300042618 Bacteria 15819
34 Ga0123356_10139330 3300010049 Bacteria 2391
35 Ga0123354_10000656 3300010882 Bacteria 36511
36 Ga0466719_035543 3300042606 Bacteria 10370
37 JGI24702J35022_10000672 3300002462 Bacteria 20792
38 Ga0068305_10122819 3300005083 Unclassified 5206
39 Ga0102735_1000287 3300007080 Bacteria 11856
40 Ga0466656_347727 3300042550 Bacteria 1607
41 Ga0466690_095011 3300042590 Bacteria 9755
42 Ga0466692_022740 3300042591 Bacteria 15073
43 Ga0466727_325984 3300042655 Bacteria 1465
44 Ga0466723_146714 3300042618 Bacteria 10011
45 Ga0466726_027894 3300042619 Bacteria 10594
46 Ga0123357_10192844 3300009784 Bacteria 2342
47 Ga0123353_10229005 3300010167 Bacteria 2900
48 Ga0466716_128873 3300042605 Bacteria 20808
49 Ga0466719_175438 3300042606 Bacteria 4108
50 Ga0466719_527260 3300042606 Bacteria 1910
51 IMNBL1DRAFT_c0000778 3300000062 Bacteria 25187
52 Ga0068302_10053968 3300005071 Bacteria 9357
53 Ga0466735_125231 3300042624 Bacteria 6413
54 Ga0466735_229760 3300042624 Bacteria 2518
55 Ga0466704_040778 3300042643 Bacteria 10718
56 Ga0466711_261641 3300042615 Bacteria 27442
57 Ga0466715_024418 3300042616 Bacteria 13353
58 Ga0466726_352291 3300042619 Bacteria 2527
59 Ga0466706_006892 3300042599 Bacteria 6984
60 Ga0466700_159036 3300042600 Bacteria 10259
61 Ga0466700_387454 3300042600 Bacteria 47059
62 Ga0466716_092661 3300042605 Bacteria 34549
63 Ga0466722_151805 3300042609 Bacteria 2309
64 Ga0466698_267600 3300042610 Bacteria 4455
65 2227111371 2225789004 Bacteria 9422
66 2227303000 2225789004 Bacteria 29649
67 IMNBL1DRAFT_c0003993 3300000062 Bacteria 9090
68 CVPL010W_10001643 3300002931 Bacteria 26841
69 Ga0102734_1000180 3300007129 Bacteria 20172
70 Ga0466704_402295 3300042643 Bacteria 7618
71 Ga0466723_010238 3300042618 Bacteria 11206
72 Ga0466726_061036 3300042619 Bacteria 14397
73 Ga0466728_034392 3300042620 Bacteria 3371
74 Ga0123354_10007896 3300010882 Bacteria 16123
75 Ga0466700_184482 3300042600 Bacteria 7877
76 Ga0466707_100729 3300042601 Bacteria 10660
77 Ga0466714_091992 3300042603 Bacteria 3238
78 Ga0466697_001263 3300042611 Bacteria 1405
79 2227247463 2225789004 Bacteria 31431
80 IMNBL1DRAFT_c0001430 3300000062 Bacteria 17865
81 Ga0466656_209194 3300042550 Bacteria 12543
82 Ga0466690_108802 3300042590 Bacteria 9746
83 Ga0466691_167761 3300042593 Bacteria 11914
84 Ga0466729_207095 3300042621 Bacteria 1874
85 Ga0466703_012244 3300042636 Bacteria 10258
86 Ga0466732_056943 3300042656 Bacteria 10693
87 Ga0466732_250889 3300042656 Bacteria 1734
88 Ga0466711_094074 3300042615 Bacteria 13061
89 Ga0466711_149988 3300042615 Bacteria 5322
90 Ga0466711_204610 3300042615 Bacteria 10109
91 Ga0466718_099392 3300042617 Bacteria 1496
92 Ga0123353_10002312 3300010167 Bacteria 23671
93 Ga0466713_081971 3300042602 Bacteria 2379
94 Ga0466714_060946 3300042603 Bacteria 3371
95 Ga0466714_102935 3300042603 Bacteria 3219
96 2227521581 2225789004 Bacteria 3330
97 Ga0466690_236448 3300042590 Bacteria 4896
98 Ga0466704_382218 3300042643 Bacteria 2361
99 Ga0466715_161567 3300042616 Bacteria 22971
100 Ga0466707_049391 3300042601 Bacteria 4924
101 Ga0466707_212369 3300042601 Bacteria 1297
102 Ga0466713_023619 3300042602 Bacteria 28576
103 Ga0466698_299199 3300042610 Unclassified 3137
104 2227008134 2225789003 Bacteria 27277
105 2227197484 2225789004 Bacteria 7797
106 IMNBL1DRAFT_c0002743 3300000062 Bacteria 11983
107 IMNBL1DRAFT_c0003150 3300000062 Bacteria 10845
108 JGI24705J35276_12228521 3300002504 Bacteria 3201
109 Ga0068302_10070490 3300005071 Bacteria 5993

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042601 Ga0466707_212369 Ga0466707_212369_262_1281 339
2 3300042603 Ga0466714_102935 Ga0466714_102935_347_1612 362
3 3300042604 Ga0466717_096457 Ga0466717_096457_304_1395 363
4 3300042624 Ga0466735_229760 Ga0466735_229760_1378_2487 369
5 3300042616 Ga0466715_100521 Ga0466715_100521_714_1955 374
6 3300042656 Ga0466732_056943 Ga0466732_056943_8315_9565 374
7 3300042609 Ga0466722_137495 Ga0466722_137495_10282_11541 376
8 3300042603 Ga0466714_060946 Ga0466714_060946_51_1316 379
9 3300042655 Ga0466727_325984 Ga0466727_325984_27_1166 379
10 3300042593 Ga0466691_167761 Ga0466691_167761_6842_8107 380
11 3300042618 Ga0466723_046709 Ga0466723_046709_15329_16594 380
12 3300042618 Ga0466723_146714 Ga0466723_146714_3831_5096 380
13 3300042619 Ga0466726_027894 Ga0466726_027894_2355_3617 380
14 3300005071 Ga0068302_10070490 Ga0068302_100704903 381
15 3300042605 Ga0466716_128873 Ga0466716_128873_9700_10965 381
16 3300042591 Ga0466692_179176 Ga0466692_179176_3371_4630 382
17 3300042605 Ga0466716_527992 Ga0466716_527992_3938_5092 384
18 3300042613 Ga0466710_347193 Ga0466710_347193_48_1205 385
19 3300042618 Ga0466723_116763 Ga0466723_116763_12219_13376 385
20 3300042643 Ga0466704_382218 Ga0466704_382218_682_1839 385
21 3300042603 Ga0466714_091992 Ga0466714_091992_1518_2768 386
22 3300042652 Ga0466708_098063 Ga0466708_098063_2883_4148 386
23 3300042655 Ga0466727_102556 Ga0466727_102556_1212_2372 386
24 3300042601 Ga0466707_100729 Ga0466707_100729_2980_4233 387
25 3300042620 Ga0466728_034392 Ga0466728_034392_69_1331 390
26 3300042600 Ga0466700_387454 Ga0466700_387454_6117_7364 391
27 3300042601 Ga0466707_049391 Ga0466707_049391_705_1970 391
28 3300042610 Ga0466698_267600 Ga0466698_267600_2400_3638 391
29 3300042621 Ga0466729_114703 Ga0466729_114703_3647_4915 391
30 3300000062 IMNBL1DRAFT_c0003150 IMNBL1DRAFT_00031505 392
31 3300042601 Ga0466707_218377 Ga0466707_218377_6219_7445 392
32 3300000062 IMNBL1DRAFT_c0001430 IMNBL1DRAFT_00014309 395
33 3300000062 IMNBL1DRAFT_c0003993 IMNBL1DRAFT_00039938 396
34 3300042617 Ga0466718_099392 Ga0466718_099392_31_1269 399
35 3300042590 Ga0466690_236448 Ga0466690_236448_721_1986 400
36 3300042652 Ga0466708_024546 Ga0466708_024546_26578_27780 400
37 3300042602 Ga0466713_009199 Ga0466713_009199_4118_5383 401
38 3300042615 Ga0466711_149988 Ga0466711_149988_1300_2565 401
39 3300042616 Ga0466715_109794 Ga0466715_109794_19630_20898 401
40 3300009784 Ga0123357_10192844 Ga0123357_101928442 402
41 3300007129 Ga0102734_1000180 Ga0102734_10001808 403
42 3300042582 Ga0466657_121324 Ga0466657_121324_974_2218 404
43 3300042606 Ga0466719_175438 Ga0466719_175438_2308_3564 405
44 3300042619 Ga0466726_352291 Ga0466726_352291_732_1997 406
45 3300042643 Ga0466704_402295 Ga0466704_402295_2008_3261 406
46 3300005071 Ga0068302_10053968 Ga0068302_100539688 407
47 3300042624 Ga0466735_125231 Ga0466735_125231_2784_4037 408
48 iso_pr_bacteria 2820755292 2820756635 412
49 3300007080 Ga0102735_1000287 Ga0102735_10002875 413
50 3300042609 Ga0466722_151805 Ga0466722_151805_701_1942 413
51 3300042656 Ga0466732_250889 Ga0466732_250889_158_1399 413
52 3300002931 CVPL010W_10001643 CVPL010W_100016434 414
53 3300042550 Ga0466656_209194 Ga0466656_209194_7086_8330 414
54 3300042550 Ga0466656_347727 Ga0466656_347727_60_1304 414
55 3300042595 Ga0466695_235673 Ga0466695_235673_13022_14266 414
56 3300042599 Ga0466706_006892 Ga0466706_006892_5588_6832 414
57 3300042659 Ga0466733_216481 Ga0466733_216481_7215_8459 414
58 3300010167 Ga0123353_10002312 Ga0123353_1000231225 415
59 3300010167 Ga0123353_10229005 Ga0123353_102290051 415
60 3300042590 Ga0466690_095011 Ga0466690_095011_3454_4707 417
61 3300042596 Ga0466696_489056 Ga0466696_489056_2168_3421 417
62 3300042600 Ga0466700_159036 Ga0466700_159036_8849_10102 417
63 3300042611 Ga0466697_281283 Ga0466697_281283_40_1293 417
64 3300042618 Ga0466723_010238 Ga0466723_010238_2285_3538 417
65 3300042619 Ga0466726_061036 Ga0466726_061036_3459_4712 417
66 3300042623 Ga0466734_122869 Ga0466734_122869_39_1292 417
67 iso_pr_bacteria 3004667792 3004668419 417
68 2225789003 2227008134 2227364988 418
69 2225789004 2227111371 2227500316 418
70 2225789004 2227197484 2227621896 418
71 3300010049 Ga0123356_10139330 Ga0123356_101393302 418
72 3300010882 Ga0123354_10007896 Ga0123354_1000789613 418
73 3300042606 Ga0466719_527260 Ga0466719_527260_52_1308 418
74 3300042612 Ga0466705_221960 Ga0466705_221960_3590_4846 418
75 3300042625 Ga0466730_090432 Ga0466730_090432_2681_3937 418
76 iso_pr_bacteria 2967483437 2967483528 418
77 3300000062 IMNBL1DRAFT_c0002743 IMNBL1DRAFT_00027436 419
78 3300002462 JGI24702J35022_10000672 JGI24702J35022_100006726 419
79 3300042590 Ga0466690_108802 Ga0466690_108802_5563_6822 419
80 3300042602 Ga0466713_081971 Ga0466713_081971_1080_2339 419
81 3300042615 Ga0466711_261641 Ga0466711_261641_4486_5745 419
82 3300042636 Ga0466703_012244 Ga0466703_012244_386_1645 419
83 3300042643 Ga0466704_040778 Ga0466704_040778_7178_8437 419
84 2225789004 2227303000 2227752911 420
85 3300005083 Ga0068305_10122819 Ga0068305_101228194 420
86 3300042601 Ga0466707_233004 Ga0466707_233004_1052_2314 420
87 3300042602 Ga0466713_023619 Ga0466713_023619_24900_26162 420
88 3300042610 Ga0466698_299199 Ga0466698_299199_1165_2427 420
89 3300042616 Ga0466715_161567 Ga0466715_161567_3781_5043 420
90 3300000062 IMNBL1DRAFT_c0000778 IMNBL1DRAFT_000077816 421
91 3300010882 Ga0123354_10000656 Ga0123354_100006565 421
92 3300010882 Ga0123354_10001134 Ga0123354_1000113419 421
93 3300042593 Ga0466691_040271 Ga0466691_040271_2667_3932 421
94 3300042605 Ga0466716_092661 Ga0466716_092661_28493_29758 421
95 3300042606 Ga0466719_035543 Ga0466719_035543_6108_7373 421
96 3300042615 Ga0466711_094074 Ga0466711_094074_2572_3837 421
97 3300042615 Ga0466711_204610 Ga0466711_204610_7640_8905 421
98 3300042643 Ga0466704_352277 Ga0466704_352277_2253_3518 421
99 3300042643 Ga0466704_461185 Ga0466704_461185_18866_20131 421
100 3300042655 Ga0466727_297477 Ga0466727_297477_3315_4580 421
101 3300042600 Ga0466700_184482 Ga0466700_184482_2026_3294 422
102 3300042616 Ga0466715_024418 Ga0466715_024418_3383_4651 422
103 3300042621 Ga0466729_207095 Ga0466729_207095_42_1310 422
104 2225789004 2227521581 2228025300 423
105 3300010049 Ga0123356_10030655 Ga0123356_100306554 423
106 3300042611 Ga0466697_001263 Ga0466697_001263_49_1320 423
107 3300042611 Ga0466697_193799 Ga0466697_193799_560_1831 423
108 3300002504 JGI24705J35276_12228521 JGI24705J35276_122285212 424
109 3300042591 Ga0466692_022740 Ga0466692_022740_10662_11936 424
110 3300042601 Ga0466707_018939 Ga0466707_018939_7219_8499 426
111 2225789004 2227247463 2227689417 427
112 3300005083 Ga0068305_10018912 Ga0068305_100189123 442

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02687 FtsX FtsX-like permease family 290 411 0.94
PF12704 MacB_PCD MacB-like periplasmic core domain 21 246 0.83

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02687 GO:0016020 membrane CC

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.74 0.76 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.