Protein Family IF01175
Metagenome
Isolate
134
Members
65
Samples
109
Scaffolds
128.5
Avg Length
Representative Sequence
- ID
- 3300005083|Ga0068305_10007593|Ga0068305_1000759342
- Length
- 140 aa
- Sequence
- VLQRRAKISPNFSMASMTDVIFLLLIFFMITSTVVSPNAIKVLLPQGKQQTSAKPLTRVIIDKDLNFYAAFGNDKEQAISLEDLTPFLQSCATKEPEMYVALYADESVPYREIVKVLNIANENKFKMVLATRPPEGKGK*
Sample Types
Isolate
18.7%
Metagenome
81.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
34.4%
Termitidae
23.4%
Kalotermitidae
20.3%
Unclassified
7.8%
Rhinotermitidae
6.2%
Termopsidae
4.7%
Passalidae
1.6%
Hodotermitidae
1.6%
Taxonomy
Archaea
0
Bacteria
131
Eukaryota
0
Viruses
0
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 2 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 3 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 4 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 5 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 6 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 7 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 8 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 9 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 10 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 11 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 12 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 13 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 14 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 15 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 16 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 17 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 18 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 19 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 20 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 21 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 22 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 23 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 24 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 25 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 26 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 27 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 28 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 29 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 30 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 31 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 32 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 33 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 34 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 35 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 36 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 37 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 38 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 39 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 40 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 41 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 42 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 43 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 44 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 45 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 46 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 47 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 48 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 49 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 50 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 51 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 52 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 53 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 54 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 55 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 56 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 57 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 58 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 59 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 60 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 61 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 62 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 63 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 64 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 65 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_11130469 | 3300010049 | Bacteria | 951 |
| 2 | Ga0123356_11865421 | 3300010049 | Bacteria | 748 |
| 3 | Ga0123353_10478045 | 3300010167 | Bacteria | 1824 |
| 4 | Ga0466692_038856 | 3300042591 | Bacteria | 66664 |
| 5 | Ga0466696_016009 | 3300042596 | Bacteria | 8497 |
| 6 | Ga0466711_203198 | 3300042615 | Bacteria | 14642 |
| 7 | Ga0466701_028239 | 3300042598 | Bacteria | 3468 |
| 8 | Ga0466706_144964 | 3300042599 | Bacteria | 38907 |
| 9 | Ga0466716_345265 | 3300042605 | Bacteria | 9860 |
| 10 | Ga0466735_210592 | 3300042624 | Bacteria | 2076 |
| 11 | Ga0466703_005062 | 3300042636 | Bacteria | 5633 |
| 12 | Ga0466727_169454 | 3300042655 | Bacteria | 8118 |
| 13 | IMNBL1DRAFT_c0002121 | 3300000062 | Bacteria | 14121 |
| 14 | Ga0068305_10180264 | 3300005083 | Bacteria | 1637 |
| 15 | Ga0068305_10394913 | 3300005083 | Bacteria | 1460 |
| 16 | Ga0123357_10047594 | 3300009784 | Bacteria | 5811 |
| 17 | Ga0123356_10433612 | 3300010049 | Bacteria | 1459 |
| 18 | Ga0466711_069500 | 3300042615 | Bacteria | 1238 |
| 19 | Ga0466715_218422 | 3300042616 | Bacteria | 20789 |
| 20 | Ga0466728_270400 | 3300042620 | Bacteria | 35265 |
| 21 | Ga0466706_016093 | 3300042599 | Bacteria | 1622 |
| 22 | Ga0466706_031709 | 3300042599 | Bacteria | 16740 |
| 23 | Ga0466706_060433 | 3300042599 | Bacteria | 6838 |
| 24 | Ga0466707_104585 | 3300042601 | Bacteria | 1560 |
| 25 | Ga0466713_034758 | 3300042602 | Bacteria | 23612 |
| 26 | Ga0466713_070449 | 3300042602 | Bacteria | 62168 |
| 27 | Ga0466714_022616 | 3300042603 | Bacteria | 55137 |
| 28 | Ga0466722_249159 | 3300042609 | Bacteria | 79748 |
| 29 | Ga0466735_173583 | 3300042624 | Bacteria | 1861 |
| 30 | Ga0466708_071605 | 3300042652 | Bacteria | 10063 |
| 31 | Ga0466727_221985 | 3300042655 | Bacteria | 7289 |
| 32 | IMNBL1DRAFT_c0178692 | 3300000062 | Bacteria | 537 |
| 33 | Ga0123353_10196582 | 3300010167 | Bacteria | 3178 |
| 34 | Ga0123354_10181355 | 3300010882 | Bacteria | 2402 |
| 35 | Ga0466696_308767 | 3300042596 | Bacteria | 1986 |
| 36 | Ga0466697_080461 | 3300042611 | Bacteria | 2150 |
| 37 | Ga0466726_250312 | 3300042619 | Bacteria | 3092 |
| 38 | Ga0466729_038665 | 3300042621 | Bacteria | 15259 |
| 39 | Ga0466706_049476 | 3300042599 | Bacteria | 1598 |
| 40 | Ga0466707_382634 | 3300042601 | Bacteria | 1438 |
| 41 | Ga0466713_124643 | 3300042602 | Bacteria | 27149 |
| 42 | Ga0466714_019235 | 3300042603 | Bacteria | 13134 |
| 43 | Ga0466703_106609 | 3300042636 | Bacteria | 26708 |
| 44 | Ga0466704_005654 | 3300042643 | Bacteria | 10865 |
| 45 | JGI24699J35502_11129693 | 3300002509 | Bacteria | 4801 |
| 46 | Ga0123356_10099710 | 3300010049 | Bacteria | 2785 |
| 47 | Ga0466657_075840 | 3300042582 | Bacteria | 1500 |
| 48 | Ga0466696_279300 | 3300042596 | Bacteria | 7394 |
| 49 | Ga0466711_123869 | 3300042615 | Bacteria | 4016 |
| 50 | Ga0466711_283591 | 3300042615 | Bacteria | 3600 |
| 51 | Ga0466715_215776 | 3300042616 | Bacteria | 39785 |
| 52 | Ga0466706_004348 | 3300042599 | Bacteria | 1249 |
| 53 | Ga0466706_065713 | 3300042599 | Bacteria | 2116 |
| 54 | Ga0466706_094705 | 3300042599 | Bacteria | 26280 |
| 55 | Ga0466706_103812 | 3300042599 | Bacteria | 57157 |
| 56 | Ga0466706_128935 | 3300042599 | Bacteria | 12762 |
| 57 | Ga0466706_223958 | 3300042599 | Bacteria | 16784 |
| 58 | Ga0466700_275474 | 3300042600 | Bacteria | 4734 |
| 59 | Ga0466713_074382 | 3300042602 | Bacteria | 12079 |
| 60 | Ga0466722_141208 | 3300042609 | Bacteria | 7802 |
| 61 | Ga0466703_404590 | 3300042636 | Bacteria | 4602 |
| 62 | Ga0466725_344831 | 3300042654 | Bacteria | 5331 |
| 63 | Ga0068305_10072648 | 3300005083 | Bacteria | 7795 |
| 64 | Ga0123354_10227703 | 3300010882 | Bacteria | 1959 |
| 65 | Ga0466690_038157 | 3300042590 | Bacteria | 30366 |
| 66 | Ga0466723_051189 | 3300042618 | Unclassified | 6414 |
| 67 | Ga0466713_009840 | 3300042602 | Unclassified | 6976 |
| 68 | Ga0466722_064137 | 3300042609 | Bacteria | 4217 |
| 69 | Ga0466735_054840 | 3300042624 | Bacteria | 1890 |
| 70 | Ga0466735_208566 | 3300042624 | Bacteria | 1077 |
| 71 | Ga0466708_050839 | 3300042652 | Bacteria | 8235 |
| 72 | Ga0123354_10000740 | 3300010882 | Bacteria | 35242 |
| 73 | Ga0415639_187098 | 3300038395 | Bacteria | 1590 |
| 74 | Ga0466715_256668 | 3300042616 | Bacteria | 4911 |
| 75 | Ga0466701_029695 | 3300042598 | Bacteria | 16457 |
| 76 | Ga0466716_089579 | 3300042605 | Bacteria | 21981 |
| 77 | Ga0466716_383677 | 3300042605 | Bacteria | 4060 |
| 78 | Ga0466735_030183 | 3300042624 | Bacteria | 11567 |
| 79 | Ga0466703_019883 | 3300042636 | Bacteria | 23097 |
| 80 | Ga0466703_097689 | 3300042636 | Bacteria | 37276 |
| 81 | Ga0466704_192304 | 3300042643 | Bacteria | 4511 |
| 82 | JGI24702J35022_10433701 | 3300002462 | Bacteria | 798 |
| 83 | JGI24699J35502_10982398 | 3300002509 | Bacteria | 1277 |
| 84 | JGI24699J35502_11133694 | 3300002509 | Bacteria | 13722 |
| 85 | Ga0068305_10177511 | 3300005083 | Bacteria | 10537 |
| 86 | Ga0068305_11009815 | 3300005083 | Bacteria | 630 |
| 87 | Ga0123357_10083087 | 3300009784 | Unclassified | 4204 |
| 88 | Ga0265387_1001732 | 3300024582 | Bacteria | 3131 |
| 89 | Ga0466690_034048 | 3300042590 | Bacteria | 5383 |
| 90 | Ga0466691_070237 | 3300042593 | Bacteria | 13056 |
| 91 | Ga0466711_225462 | 3300042615 | Bacteria | 1236 |
| 92 | Ga0466715_079603 | 3300042616 | Bacteria | 222305 |
| 93 | Ga0466700_402810 | 3300042600 | Bacteria | 14043 |
| 94 | Ga0466704_058087 | 3300042643 | Bacteria | 24952 |
| 95 | Ga0466733_038286 | 3300042659 | Bacteria | 266317 |
| 96 | IMNBL1DRAFT_c0011393 | 3300000062 | Bacteria | 4155 |
| 97 | Ga0068305_10007593 | 3300005083 | Bacteria | 80483 |
| 98 | Ga0123356_10707948 | 3300010049 | Bacteria | 1176 |
| 99 | Ga0123354_10247805 | 3300010882 | Bacteria | 1813 |
| 100 | Ga0466694_244296 | 3300042594 | Bacteria | 1601 |
| 101 | Ga0466696_008322 | 3300042596 | Bacteria | 7084 |
| 102 | Ga0466711_089277 | 3300042615 | Bacteria | 5866 |
| 103 | Ga0466728_282666 | 3300042620 | Bacteria | 52404 |
| 104 | Ga0466706_105640 | 3300042599 | Bacteria | 39915 |
| 105 | Ga0466714_070885 | 3300042603 | Bacteria | 12201 |
| 106 | Ga0466716_065855 | 3300042605 | Bacteria | 1039 |
| 107 | Ga0466716_260158 | 3300042605 | Bacteria | 8439 |
| 108 | Ga0466719_223626 | 3300042606 | Bacteria | 7314 |
| 109 | Ga0466709_083357 | 3300042648 | Bacteria | 39489 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042611 | Ga0466697_080461 | Ga0466697_080461_1161_1565 | 118 |
| 2 | 3300042598 | Ga0466701_028239 | Ga0466701_028239_1508_1912 | 120 |
| 3 | 3300042602 | Ga0466713_034758 | Ga0466713_034758_3506_3913 | 120 |
| 4 | 3300042606 | Ga0466719_223626 | Ga0466719_223626_1004_1414 | 120 |
| 5 | 3300042636 | Ga0466703_106609 | Ga0466703_106609_7482_7892 | 120 |
| 6 | 3300042596 | Ga0466696_016009 | Ga0466696_016009_3367_3732 | 121 |
| 7 | 3300042602 | Ga0466713_074382 | Ga0466713_074382_854_1219 | 121 |
| 8 | 3300042605 | Ga0466716_260158 | Ga0466716_260158_6965_7372 | 121 |
| 9 | 3300042609 | Ga0466722_064137 | Ga0466722_064137_3765_4172 | 121 |
| 10 | 3300042615 | Ga0466711_283591 | Ga0466711_283591_807_1217 | 121 |
| 11 | 3300042616 | Ga0466715_256668 | Ga0466715_256668_3150_3557 | 121 |
| 12 | 3300042621 | Ga0466729_038665 | Ga0466729_038665_13377_13787 | 121 |
| 13 | 3300042624 | Ga0466735_054840 | Ga0466735_054840_1250_1660 | 121 |
| 14 | 3300042624 | Ga0466735_173583 | Ga0466735_173583_136_501 | 121 |
| 15 | 3300042636 | Ga0466703_005062 | Ga0466703_005062_3093_3500 | 121 |
| 16 | 3300042643 | Ga0466704_058087 | Ga0466704_058087_3270_3680 | 121 |
| 17 | 3300000062 | IMNBL1DRAFT_c0178692 | IMNBL1DRAFT_01786921 | 122 |
| 18 | 3300002462 | JGI24702J35022_10433701 | JGI24702J35022_104337012 | 122 |
| 19 | 3300002509 | JGI24699J35502_10982398 | JGI24699J35502_109823982 | 122 |
| 20 | 3300002509 | JGI24699J35502_11129693 | JGI24699J35502_111296935 | 122 |
| 21 | 3300002509 | JGI24699J35502_11133694 | JGI24699J35502_1113369416 | 122 |
| 22 | 3300010049 | Ga0123356_10433612 | Ga0123356_104336122 | 122 |
| 23 | 3300010167 | Ga0123353_10196582 | Ga0123353_101965823 | 122 |
| 24 | 3300010167 | Ga0123353_10478045 | Ga0123353_104780453 | 122 |
| 25 | 3300024582 | Ga0265387_1001732 | Ga0265387_10017322 | 122 |
| 26 | 3300038395 | Ga0415639_187098 | Ga0415639_187098_35_403 | 122 |
| 27 | 3300042590 | Ga0466690_034048 | Ga0466690_034048_3085_3495 | 122 |
| 28 | 3300042593 | Ga0466691_070237 | Ga0466691_070237_6335_6703 | 122 |
| 29 | 3300042601 | Ga0466707_104585 | Ga0466707_104585_473_883 | 122 |
| 30 | 3300042602 | Ga0466713_070449 | Ga0466713_070449_20474_20881 | 122 |
| 31 | 3300042615 | Ga0466711_069500 | Ga0466711_069500_21_431 | 122 |
| 32 | 3300042615 | Ga0466711_089277 | Ga0466711_089277_5386_5796 | 122 |
| 33 | 3300042616 | Ga0466715_215776 | Ga0466715_215776_22172_22540 | 122 |
| 34 | 3300042620 | Ga0466728_282666 | Ga0466728_282666_39494_39862 | 122 |
| 35 | 3300042636 | Ga0466703_097689 | Ga0466703_097689_6345_6713 | 122 |
| 36 | 3300042643 | Ga0466704_192304 | Ga0466704_192304_2718_3086 | 122 |
| 37 | 3300042659 | Ga0466733_038286 | Ga0466733_038286_3024_3434 | 122 |
| 38 | 3300000062 | IMNBL1DRAFT_c0002121 | IMNBL1DRAFT_00021216 | 123 |
| 39 | 3300005083 | Ga0068305_10394913 | Ga0068305_103949133 | 123 |
| 40 | 3300010049 | Ga0123356_10707948 | Ga0123356_107079482 | 123 |
| 41 | 3300010049 | Ga0123356_11130469 | Ga0123356_111304692 | 123 |
| 42 | 3300042599 | Ga0466706_060433 | Ga0466706_060433_3722_4093 | 123 |
| 43 | 3300042599 | Ga0466706_105640 | Ga0466706_105640_32812_33183 | 123 |
| 44 | 3300042615 | Ga0466711_123869 | Ga0466711_123869_1945_2355 | 123 |
| 45 | 3300042615 | Ga0466711_203198 | Ga0466711_203198_2229_2639 | 123 |
| 46 | 3300042616 | Ga0466715_079603 | Ga0466715_079603_204775_205185 | 123 |
| 47 | 3300042636 | Ga0466703_019883 | Ga0466703_019883_19628_19999 | 123 |
| 48 | 3300042643 | Ga0466704_005654 | Ga0466704_005654_2111_2521 | 123 |
| 49 | 3300000062 | IMNBL1DRAFT_c0011393 | IMNBL1DRAFT_00113932 | 124 |
| 50 | 3300005083 | Ga0068305_10180264 | Ga0068305_101802642 | 124 |
| 51 | 3300042591 | Ga0466692_038856 | Ga0466692_038856_48546_48956 | 124 |
| 52 | 3300042594 | Ga0466694_244296 | Ga0466694_244296_1049_1456 | 124 |
| 53 | 3300042599 | Ga0466706_016093 | Ga0466706_016093_1216_1590 | 124 |
| 54 | 3300042599 | Ga0466706_049476 | Ga0466706_049476_62_436 | 124 |
| 55 | 3300042599 | Ga0466706_094705 | Ga0466706_094705_9168_9542 | 124 |
| 56 | 3300042599 | Ga0466706_103812 | Ga0466706_103812_46985_47359 | 124 |
| 57 | 3300042599 | Ga0466706_128935 | Ga0466706_128935_9793_10167 | 124 |
| 58 | 3300042599 | Ga0466706_144964 | Ga0466706_144964_21097_21471 | 124 |
| 59 | 3300042600 | Ga0466700_275474 | Ga0466700_275474_2736_3143 | 124 |
| 60 | 3300042602 | Ga0466713_009840 | Ga0466713_009840_3522_3929 | 124 |
| 61 | 3300042605 | Ga0466716_383677 | Ga0466716_383677_3005_3379 | 124 |
| 62 | 3300042616 | Ga0466715_218422 | Ga0466715_218422_7359_7733 | 124 |
| 63 | 3300042636 | Ga0466703_404590 | Ga0466703_404590_3295_3714 | 124 |
| 64 | 3300042652 | Ga0466708_071605 | Ga0466708_071605_2728_3147 | 124 |
| 65 | 3300005083 | Ga0068305_10177511 | Ga0068305_1017751111 | 125 |
| 66 | 3300009784 | Ga0123357_10047594 | Ga0123357_100475946 | 125 |
| 67 | 3300010882 | Ga0123354_10227703 | Ga0123354_102277033 | 125 |
| 68 | 3300042590 | Ga0466690_038157 | Ga0466690_038157_3987_4364 | 125 |
| 69 | 3300042599 | Ga0466706_004348 | Ga0466706_004348_48_425 | 125 |
| 70 | 3300042648 | Ga0466709_083357 | Ga0466709_083357_33817_34194 | 125 |
| 71 | 3300042652 | Ga0466708_050839 | Ga0466708_050839_6479_6856 | 125 |
| 72 | 3300010882 | Ga0123354_10000740 | Ga0123354_1000074032 | 126 |
| 73 | 3300042599 | Ga0466706_031709 | Ga0466706_031709_3390_3770 | 126 |
| 74 | 3300042624 | Ga0466735_210592 | Ga0466735_210592_176_586 | 126 |
| 75 | 3300005083 | Ga0068305_11009815 | Ga0068305_110098152 | 127 |
| 76 | 3300042596 | Ga0466696_308767 | Ga0466696_308767_31_414 | 127 |
| 77 | 3300010049 | Ga0123356_10099710 | Ga0123356_100997103 | 129 |
| 78 | 3300010049 | Ga0123356_11865421 | Ga0123356_118654212 | 131 |
| 79 | 3300042655 | Ga0466727_169454 | Ga0466727_169454_2176_2595 | 132 |
| 80 | 3300042596 | Ga0466696_008322 | Ga0466696_008322_3075_3491 | 133 |
| 81 | 3300042618 | Ga0466723_051189 | Ga0466723_051189_3740_4144 | 134 |
| 82 | 3300042582 | Ga0466657_075840 | Ga0466657_075840_304_711 | 135 |
| 83 | 3300042596 | Ga0466696_279300 | Ga0466696_279300_4954_5361 | 135 |
| 84 | 3300042600 | Ga0466700_402810 | Ga0466700_402810_12537_12944 | 135 |
| 85 | 3300042601 | Ga0466707_382634 | Ga0466707_382634_425_832 | 135 |
| 86 | 3300042615 | Ga0466711_225462 | Ga0466711_225462_129_536 | 135 |
| 87 | iso_pr_bacteria | 2820759988 | 2820760795 | 135 |
| 88 | iso_pr_bacteria | 2940205530 | 2940209072 | 135 |
| 89 | iso_pr_bacteria | 2940212447 | 2940215987 | 135 |
| 90 | iso_pr_bacteria | 2940298504 | 2940302040 | 135 |
| 91 | iso_pr_bacteria | 2940302308 | 2940305854 | 135 |
| 92 | iso_pr_bacteria | 2940306115 | 2940308725 | 135 |
| 93 | iso_pr_bacteria | 2940309933 | 2940312563 | 135 |
| 94 | iso_pr_bacteria | 2940313741 | 2940316376 | 135 |
| 95 | iso_pr_bacteria | 2940317558 | 2940320110 | 135 |
| 96 | iso_pr_bacteria | 2940321370 | 2940323865 | 135 |
| 97 | iso_pr_bacteria | 2940325180 | 2940328713 | 135 |
| 98 | iso_pr_bacteria | 2940328985 | 2940332522 | 135 |
| 99 | iso_pr_bacteria | 2940332795 | 2940335346 | 135 |
| 100 | 3300009784 | Ga0123357_10083087 | Ga0123357_100830874 | 136 |
| 101 | 3300010882 | Ga0123354_10181355 | Ga0123354_101813551 | 136 |
| 102 | 3300042598 | Ga0466701_029695 | Ga0466701_029695_14932_15342 | 136 |
| 103 | 3300042603 | Ga0466714_019235 | Ga0466714_019235_6080_6490 | 136 |
| 104 | 3300042603 | Ga0466714_070885 | Ga0466714_070885_7184_7594 | 136 |
| 105 | 3300042605 | Ga0466716_065855 | Ga0466716_065855_299_709 | 136 |
| 106 | 3300042605 | Ga0466716_089579 | Ga0466716_089579_4680_5090 | 136 |
| 107 | 3300042605 | Ga0466716_345265 | Ga0466716_345265_6363_6773 | 136 |
| 108 | 3300042609 | Ga0466722_141208 | Ga0466722_141208_6282_6692 | 136 |
| 109 | 3300042609 | Ga0466722_249159 | Ga0466722_249159_48269_48679 | 136 |
| 110 | 3300042619 | Ga0466726_250312 | Ga0466726_250312_1245_1655 | 136 |
| 111 | 3300042620 | Ga0466728_270400 | Ga0466728_270400_5723_6133 | 136 |
| 112 | 3300042654 | Ga0466725_344831 | Ga0466725_344831_1061_1471 | 136 |
| 113 | 3300042655 | Ga0466727_221985 | Ga0466727_221985_6146_6556 | 136 |
| 114 | iso_pr_bacteria | 2923982719 | 2923985047 | 136 |
| 115 | iso_pr_bacteria | 2940199050 | 2940199998 | 136 |
| 116 | iso_pr_bacteria | 2940202316 | 2940204459 | 136 |
| 117 | iso_pr_bacteria | 2940209341 | 2940210112 | 136 |
| 118 | iso_pr_bacteria | 2940346213 | 2940346677 | 136 |
| 119 | iso_pr_bacteria | 2940371297 | 2940372233 | 136 |
| 120 | 3300042599 | Ga0466706_065713 | Ga0466706_065713_1001_1414 | 137 |
| 121 | 3300042624 | Ga0466735_030183 | Ga0466735_030183_6382_6795 | 137 |
| 122 | 3300042624 | Ga0466735_208566 | Ga0466735_208566_109_522 | 137 |
| 123 | iso_pr_bacteria | 3004667792 | 3004671711 | 137 |
| 124 | iso_pr_bacteria | 3004677695 | 3004678916 | 137 |
| 125 | 3300042602 | Ga0466713_124643 | Ga0466713_124643_24614_25030 | 138 |
| 126 | 3300042603 | Ga0466714_022616 | Ga0466714_022616_36414_36830 | 138 |
| 127 | iso_pr_bacteria | 3004672520 | 3004676809 | 138 |
| 128 | 3300005083 | Ga0068305_10072648 | Ga0068305_100726488 | 139 |
| 129 | iso_pr_bacteria | 2609459943 | 2610740163 | 139 |
| 130 | iso_pr_bacteria | 2830041218 | 2830041555 | 139 |
| 131 | iso_pr_bacteria | 2922326829 | 2922328942 | 139 |
| 132 | 3300005083 | Ga0068305_10007593 | Ga0068305_1000759342 | 140 |
| 133 | 3300010882 | Ga0123354_10247805 | Ga0123354_102478052 | 140 |
| 134 | 3300042599 | Ga0466706_223958 | Ga0466706_223958_11335_11757 | 140 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02472 | ExbD | Biopolymer transport protein ExbD/TolR | 10 | 132 | 0.9 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.54 | 0.77 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.