Protein Family IF01158
Metagenome
Metatranscriptome
Isolate
199
Members
68
Samples
183
Scaffolds
136.76
Avg Length
Representative Sequence
- ID
- 3300005071|Ga0068302_10159726|Ga0068302_101597263
- Length
- 135 aa
- Sequence
- MKHRRGFNPLERMPNHRKAMLRNMATSLFKYERIVTTRAKALAVRSYAEDSVHNRRLVSARLFSEAMVAKLFMDIGVRMKERAGGYTRVLKLGERYGDGAEMVILELVDYKLDTASIEAKAEKKAKAKEAKAGA*
Sample Types
Isolate
8.0%
Metagenome
90.5%
MAG
0.0%
Metatranscriptome
1.5%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
40.0%
Unclassified
27.7%
Kalotermitidae
20.0%
Termopsidae
6.2%
Rhinotermitidae
4.6%
Hodotermitidae
1.5%
Taxonomy
Archaea
0
Bacteria
182
Eukaryota
0
Viruses
0
Unclassified
17
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 2 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 3 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 4 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 5 | 3300022815 | Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA | Metatranscriptome | Termitidae |
| 6 | 2781125663 | Treponema sp. Emb289P3bin135 | Isolate | Unclassified |
| 7 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 8 | 2781125686 | Treponema sp. Lab288P4bin22 | Isolate | Unclassified |
| 9 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 10 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 11 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 12 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 13 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 14 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 15 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 16 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 17 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 18 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 19 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 20 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 21 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 22 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 23 | 2781125633 | Treponema sp. Co191P1bin38 | Isolate | Unclassified |
| 24 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 25 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 26 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 27 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 28 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 29 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 30 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 31 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 32 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 33 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 34 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 35 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 36 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 37 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 38 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 39 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 40 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 41 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 42 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 43 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 44 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 45 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 46 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 47 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 48 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 49 | 2781125642 | Treponema sp. Co191P1bin35 | Isolate | Unclassified |
| 50 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 51 | 2819990093 | Unclassified Spirochaetes Cu122P1bin9 | Isolate | Unclassified |
| 52 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 53 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 54 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 55 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 56 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 57 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 58 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 59 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 60 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 61 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 62 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 63 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 64 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 65 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 66 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 67 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 68 | 3300021244 | Termite gut microbial communities from nest from French Guiana - 12-6 mRNA SA | Metatranscriptome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0415639_066219 | 3300038395 | Bacteria | 3540 |
| 2 | Ga0415639_072405 | 3300038395 | Bacteria | 3019 |
| 3 | Ga0466693_293912 | 3300042592 | Bacteria | 55262 |
| 4 | Ga0466694_134044 | 3300042594 | Bacteria | 24486 |
| 5 | Ga0466694_187078 | 3300042594 | Bacteria | 1316 |
| 6 | Ga0466696_151398 | 3300042596 | Bacteria | 77060 |
| 7 | Ga0466699_423839 | 3300042597 | Bacteria | 1896 |
| 8 | Ga0466719_082274 | 3300042606 | Bacteria | 4812 |
| 9 | Ga0123356_10581011 | 3300010049 | Bacteria | 1284 |
| 10 | Ga0466712_025519 | 3300042614 | Bacteria | 11282 |
| 11 | Ga0466712_104709 | 3300042614 | Unclassified | 1817 |
| 12 | Ga0466712_153482 | 3300042614 | Bacteria | 28564 |
| 13 | Ga0466715_198936 | 3300042616 | Bacteria | 13089 |
| 14 | Ga0466726_218613 | 3300042619 | Bacteria | 1806 |
| 15 | Ga0466726_468403 | 3300042619 | Bacteria | 2419 |
| 16 | Ga0466702_272269 | 3300042635 | Bacteria | 1406 |
| 17 | JGI24698J34947_10032099 | 3300002449 | Bacteria | 2759 |
| 18 | JGI24698J34947_10040390 | 3300002449 | Unclassified | 2409 |
| 19 | JGI24698J34947_10081432 | 3300002449 | Unclassified | 1517 |
| 20 | JGI24695J34938_10000139 | 3300002450 | Bacteria | 65941 |
| 21 | JGI24695J34938_10000729 | 3300002450 | Bacteria | 30993 |
| 22 | JGI24702J35022_10000367 | 3300002462 | Bacteria | 26825 |
| 23 | JGI24699J35502_11120356 | 3300002509 | Unclassified | 3245 |
| 24 | Ga0068302_10159726 | 3300005071 | Bacteria | 1220 |
| 25 | Ga0072941_1004548 | 3300005201 | Bacteria | 11815 |
| 26 | Ga0072941_1018715 | 3300005201 | Bacteria | 4916 |
| 27 | Ga0072941_1022161 | 3300005201 | Bacteria | 12667 |
| 28 | Ga0072941_1067895 | 3300005201 | Unclassified | 1766 |
| 29 | Ga0466691_005104 | 3300042593 | Bacteria | 30173 |
| 30 | Ga0466696_304127 | 3300042596 | Bacteria | 15419 |
| 31 | Ga0466699_070966 | 3300042597 | Unclassified | 2787 |
| 32 | Ga0466713_111845 | 3300042602 | Bacteria | 4269 |
| 33 | Ga0466722_034783 | 3300042609 | Bacteria | 6504 |
| 34 | Ga0123356_10636219 | 3300010049 | Bacteria | 1233 |
| 35 | Ga0123354_10039544 | 3300010882 | Bacteria | 7308 |
| 36 | Ga0466712_061301 | 3300042614 | Bacteria | 1197 |
| 37 | Ga0466718_125018 | 3300042617 | Bacteria | 8216 |
| 38 | Ga0466735_044290 | 3300042624 | Bacteria | 3424 |
| 39 | Ga0466703_367488 | 3300042636 | Bacteria | 27459 |
| 40 | Ga0466704_249189 | 3300042643 | Bacteria | 5460 |
| 41 | JGI24698J34947_10176308 | 3300002449 | Bacteria | 859 |
| 42 | JGI24695J34938_10000044 | 3300002450 | Bacteria | 93214 |
| 43 | JGI24695J34938_10000189 | 3300002450 | Bacteria | 57805 |
| 44 | JGI24695J34938_10001239 | 3300002450 | Bacteria | 22470 |
| 45 | JGI24695J34938_10005520 | 3300002450 | Bacteria | 7858 |
| 46 | JGI24695J34938_10018574 | 3300002450 | Bacteria | 3470 |
| 47 | JGI24699J35502_10959422 | 3300002509 | Bacteria | 1199 |
| 48 | Ga0255786_1018689 | 3300022815 | Bacteria | 750 |
| 49 | Ga0466691_014479 | 3300042593 | Bacteria | 4772 |
| 50 | Ga0466699_012769 | 3300042597 | Bacteria | 5163 |
| 51 | Ga0466698_498568 | 3300042610 | Bacteria | 1206 |
| 52 | Ga0123356_11148280 | 3300010049 | Bacteria | 944 |
| 53 | Ga0123356_11689085 | 3300010049 | Bacteria | 785 |
| 54 | Ga0466715_168443 | 3300042616 | Bacteria | 14843 |
| 55 | Ga0466718_009197 | 3300042617 | Bacteria | 7481 |
| 56 | Ga0466718_067005 | 3300042617 | Bacteria | 11879 |
| 57 | Ga0466702_193250 | 3300042635 | Bacteria | 15234 |
| 58 | Ga0466708_224466 | 3300042652 | Bacteria | 28495 |
| 59 | AustNasuHG_c1031586 | 3300000089 | Bacteria | 1492 |
| 60 | FAAS_10815495 | 3300001880 | Bacteria | 530 |
| 61 | JGI24698J34947_10005807 | 3300002449 | Bacteria | 6767 |
| 62 | JGI24698J34947_10066986 | 3300002449 | Bacteria | 1744 |
| 63 | JGI24698J34947_10134624 | 3300002449 | Unclassified | 1051 |
| 64 | JGI24695J34938_10015334 | 3300002450 | Bacteria | 3935 |
| 65 | JGI24702J35022_10034842 | 3300002462 | Bacteria | 2693 |
| 66 | JGI24702J35022_10647648 | 3300002462 | Bacteria | 655 |
| 67 | Ga0072941_1072649 | 3300005201 | Bacteria | 1127 |
| 68 | Ga0466705_101049 | 3300042612 | Bacteria | 3262 |
| 69 | Ga0264413_115888 | 3300024493 | Bacteria | 5159 |
| 70 | Ga0466690_313579 | 3300042590 | Bacteria | 41778 |
| 71 | Ga0466694_242600 | 3300042594 | Unclassified | 1166 |
| 72 | Ga0466716_149333 | 3300042605 | Bacteria | 2262 |
| 73 | Ga0466719_545558 | 3300042606 | Bacteria | 1469 |
| 74 | Ga0466722_055706 | 3300042609 | Bacteria | 2962 |
| 75 | Ga0123356_10000598 | 3300010049 | Bacteria | 40012 |
| 76 | Ga0123356_10270822 | 3300010049 | Unclassified | 1788 |
| 77 | Ga0123356_10484847 | 3300010049 | Bacteria | 1390 |
| 78 | Ga0466718_061254 | 3300042617 | Bacteria | 1224 |
| 79 | Ga0466723_087757 | 3300042618 | Bacteria | 22109 |
| 80 | Ga0466726_332186 | 3300042619 | Bacteria | 2014 |
| 81 | Ga0466703_194995 | 3300042636 | Bacteria | 1244 |
| 82 | Ga0466704_129378 | 3300042643 | Bacteria | 14615 |
| 83 | JGI24695J34938_10131965 | 3300002450 | Bacteria | 1018 |
| 84 | Ga0072941_1034044 | 3300005201 | Bacteria | 17433 |
| 85 | Ga0466705_055159 | 3300042612 | Bacteria | 1994 |
| 86 | Ga0264413_115887 | 3300024493 | Bacteria | 8607 |
| 87 | Ga0466699_233252 | 3300042597 | Bacteria | 3670 |
| 88 | Ga0466700_131218 | 3300042600 | Bacteria | 1231 |
| 89 | Ga0466716_385801 | 3300042605 | Bacteria | 19366 |
| 90 | Ga0466720_202772 | 3300042607 | Unclassified | 3510 |
| 91 | Ga0123356_10003877 | 3300010049 | Bacteria | 15570 |
| 92 | Ga0123356_10640734 | 3300010049 | Bacteria | 1229 |
| 93 | Ga0123353_10871884 | 3300010167 | Bacteria | 1230 |
| 94 | Ga0123353_11327730 | 3300010167 | Bacteria | 931 |
| 95 | Ga0466711_178432 | 3300042615 | Bacteria | 1626 |
| 96 | Ga0466711_271074 | 3300042615 | Bacteria | 51068 |
| 97 | Ga0466702_210115 | 3300042635 | Bacteria | 1447 |
| 98 | Ga0466703_001555 | 3300042636 | Bacteria | 31320 |
| 99 | Ga0466708_349712 | 3300042652 | Bacteria | 7282 |
| 100 | JGI24698J34947_10006410 | 3300002449 | Bacteria | 6458 |
| 101 | JGI24698J34947_10025462 | 3300002449 | Bacteria | 3149 |
| 102 | JGI24698J34947_10038894 | 3300002449 | Bacteria | 2466 |
| 103 | JGI24698J34947_10275112 | 3300002449 | Unclassified | 618 |
| 104 | Ga0072941_1016767 | 3300005201 | Bacteria | 5981 |
| 105 | Ga0072941_1060314 | 3300005201 | Bacteria | 1049 |
| 106 | Ga0415639_018647 | 3300038395 | Bacteria | 5195 |
| 107 | Ga0466692_170482 | 3300042591 | Bacteria | 1385 |
| 108 | Ga0466692_191986 | 3300042591 | Bacteria | 42335 |
| 109 | Ga0466694_302098 | 3300042594 | Bacteria | 1612 |
| 110 | Ga0466699_027605 | 3300042597 | Bacteria | 6548 |
| 111 | Ga0466699_049670 | 3300042597 | Unclassified | 4164 |
| 112 | Ga0466699_084437 | 3300042597 | Unclassified | 1592 |
| 113 | Ga0466699_217997 | 3300042597 | Bacteria | 2289 |
| 114 | Ga0466699_348703 | 3300042597 | Unclassified | 1013 |
| 115 | Ga0466706_148078 | 3300042599 | Bacteria | 2988 |
| 116 | Ga0466717_118952 | 3300042604 | Bacteria | 1241 |
| 117 | Ga0466722_026349 | 3300042609 | Bacteria | 26042 |
| 118 | Ga0466698_150079 | 3300042610 | Bacteria | 1146 |
| 119 | Ga0123356_10000431 | 3300010049 | Bacteria | 47938 |
| 120 | Ga0123356_10005497 | 3300010049 | Bacteria | 12899 |
| 121 | Ga0123353_11687698 | 3300010167 | Bacteria | 794 |
| 122 | Ga0466728_423289 | 3300042620 | Bacteria | 4053 |
| 123 | Ga0466735_016471 | 3300042624 | Bacteria | 1370 |
| 124 | Ga0466702_215276 | 3300042635 | Bacteria | 2454 |
| 125 | Ga0466702_326266 | 3300042635 | Bacteria | 2908 |
| 126 | Ga0466727_031929 | 3300042655 | Bacteria | 1526 |
| 127 | AustNasuHG_c1044790 | 3300000089 | Unclassified | 1020 |
| 128 | JGI24698J34947_10005036 | 3300002449 | Bacteria | 7240 |
| 129 | JGI24698J34947_10019029 | 3300002449 | Bacteria | 3707 |
| 130 | JGI24695J34938_10000152 | 3300002450 | Bacteria | 63361 |
| 131 | JGI24702J35022_10002899 | 3300002462 | Bacteria | 10387 |
| 132 | Ga0466733_073452 | 3300042659 | Bacteria | 4405 |
| 133 | Ga0255786_1018583 | 3300022815 | Bacteria | 649 |
| 134 | Ga0466691_079109 | 3300042593 | Bacteria | 25486 |
| 135 | Ga0466694_110781 | 3300042594 | Unclassified | 1222 |
| 136 | Ga0466696_190308 | 3300042596 | Bacteria | 6698 |
| 137 | Ga0466699_252720 | 3300042597 | Bacteria | 3665 |
| 138 | Ga0466716_008812 | 3300042605 | Bacteria | 1153 |
| 139 | Ga0466719_083200 | 3300042606 | Bacteria | 7262 |
| 140 | Ga0466722_179700 | 3300042609 | Bacteria | 29939 |
| 141 | Ga0123357_10406677 | 3300009784 | Bacteria | 1232 |
| 142 | Ga0123356_10000433 | 3300010049 | Bacteria | 47783 |
| 143 | Ga0123356_10012391 | 3300010049 | Bacteria | 8275 |
| 144 | Ga0123356_10036397 | 3300010049 | Bacteria | 4597 |
| 145 | Ga0123356_10081064 | 3300010049 | Bacteria | 3069 |
| 146 | Ga0123356_11786073 | 3300010049 | Bacteria | 764 |
| 147 | Ga0123356_12415240 | 3300010049 | Bacteria | 658 |
| 148 | Ga0466712_004033 | 3300042614 | Bacteria | 1783 |
| 149 | Ga0466715_485929 | 3300042616 | Bacteria | 9421 |
| 150 | Ga0466718_049318 | 3300042617 | Bacteria | 63032 |
| 151 | Ga0466731_120251 | 3300042622 | Bacteria | 7300 |
| 152 | JGI24698J34947_10023929 | 3300002449 | Bacteria | 3264 |
| 153 | JGI24698J34947_10045683 | 3300002449 | Bacteria | 2233 |
| 154 | JGI24695J34938_10031241 | 3300002450 | Bacteria | 2473 |
| 155 | JGI24695J34938_10046777 | 3300002450 | Bacteria | 1914 |
| 156 | JGI24702J35022_10099750 | 3300002462 | Bacteria | 1588 |
| 157 | Ga0072940_1041905 | 3300005200 | Bacteria | 2038 |
| 158 | Ga0223686_1015745 | 3300021244 | Bacteria | 843 |
| 159 | Ga0415639_006637 | 3300038395 | Bacteria | 20001 |
| 160 | Ga0415639_087842 | 3300038395 | Bacteria | 5042 |
| 161 | Ga0466696_436012 | 3300042596 | Bacteria | 28892 |
| 162 | Ga0466699_404303 | 3300042597 | Bacteria | 11008 |
| 163 | Ga0466721_313097 | 3300042608 | Bacteria | 2304 |
| 164 | Ga0466698_410970 | 3300042610 | Bacteria | 1129 |
| 165 | Ga0123356_10000368 | 3300010049 | Bacteria | 51439 |
| 166 | Ga0123356_10647665 | 3300010049 | Bacteria | 1224 |
| 167 | Ga0123353_10168009 | 3300010167 | Bacteria | 3485 |
| 168 | Ga0466712_142798 | 3300042614 | Bacteria | 15420 |
| 169 | Ga0466718_111800 | 3300042617 | Bacteria | 40150 |
| 170 | Ga0466728_068799 | 3300042620 | Bacteria | 5853 |
| 171 | Ga0466729_226006 | 3300042621 | Bacteria | 2074 |
| 172 | Ga0466731_056567 | 3300042622 | Bacteria | 1285 |
| 173 | Ga0466727_204225 | 3300042655 | Bacteria | 2449 |
| 174 | FAAS_10081740 | 3300001880 | Bacteria | 528 |
| 175 | JGI24698J34947_10095047 | 3300002449 | Unclassified | 1356 |
| 176 | JGI24695J34938_10000285 | 3300002450 | Bacteria | 49928 |
| 177 | JGI24695J34938_10005381 | 3300002450 | Bacteria | 7995 |
| 178 | JGI24695J34938_10006923 | 3300002450 | Bacteria | 6730 |
| 179 | JGI24695J34938_10023542 | 3300002450 | Bacteria | 2968 |
| 180 | JGI24695J34938_10179170 | 3300002450 | Bacteria | 876 |
| 181 | JGI24695J34938_10441575 | 3300002450 | Bacteria | 586 |
| 182 | Ga0068305_10001806 | 3300005083 | Bacteria | 20416 |
| 183 | Ga0072941_1018748 | 3300005201 | Bacteria | 6009 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300002449 | JGI24698J34947_10134624 | JGI24698J34947_101346243 | 130 |
| 2 | 3300002450 | JGI24695J34938_10000044 | JGI24695J34938_1000004476 | 130 |
| 3 | 3300002450 | JGI24695J34938_10131965 | JGI24695J34938_101319651 | 130 |
| 4 | 3300002462 | JGI24702J35022_10099750 | JGI24702J35022_100997502 | 130 |
| 5 | 3300005201 | Ga0072941_1034044 | Ga0072941_103404423 | 130 |
| 6 | 3300005201 | Ga0072941_1072649 | Ga0072941_10726493 | 130 |
| 7 | 3300010049 | Ga0123356_10000433 | Ga0123356_1000043334 | 130 |
| 8 | 3300010049 | Ga0123356_10081064 | Ga0123356_100810645 | 130 |
| 9 | 3300010049 | Ga0123356_10640734 | Ga0123356_106407343 | 130 |
| 10 | 3300022815 | Ga0255786_1018689 | Ga0255786_10186892 | 130 |
| 11 | 3300042593 | Ga0466691_005104 | Ga0466691_005104_29044_29436 | 130 |
| 12 | 3300042593 | Ga0466691_014479 | Ga0466691_014479_4135_4629 | 130 |
| 13 | 3300042594 | Ga0466694_110781 | Ga0466694_110781_90_524 | 130 |
| 14 | 3300042597 | Ga0466699_049670 | Ga0466699_049670_3141_3605 | 130 |
| 15 | 3300042597 | Ga0466699_084437 | Ga0466699_084437_32_493 | 130 |
| 16 | 3300042597 | Ga0466699_404303 | Ga0466699_404303_3803_4255 | 130 |
| 17 | 3300042606 | Ga0466719_083200 | Ga0466719_083200_2599_3063 | 130 |
| 18 | 3300042610 | Ga0466698_410970 | Ga0466698_410970_481_906 | 130 |
| 19 | 3300042616 | Ga0466715_198936 | Ga0466715_198936_3994_4482 | 130 |
| 20 | 3300042617 | Ga0466718_009197 | Ga0466718_009197_5579_6001 | 130 |
| 21 | 3300042635 | Ga0466702_210115 | Ga0466702_210115_358_792 | 130 |
| 22 | 3300000089 | AustNasuHG_c1044790 | AustNasuHG_10447902 | 131 |
| 23 | 3300002449 | JGI24698J34947_10005036 | JGI24698J34947_100050366 | 131 |
| 24 | 3300002449 | JGI24698J34947_10019029 | JGI24698J34947_100190292 | 131 |
| 25 | 3300002450 | JGI24695J34938_10000139 | JGI24695J34938_1000013947 | 131 |
| 26 | 3300002450 | JGI24695J34938_10001239 | JGI24695J34938_100012395 | 131 |
| 27 | 3300002450 | JGI24695J34938_10005381 | JGI24695J34938_100053817 | 131 |
| 28 | 3300002450 | JGI24695J34938_10018574 | JGI24695J34938_100185744 | 131 |
| 29 | 3300002450 | JGI24695J34938_10441575 | JGI24695J34938_104415751 | 131 |
| 30 | 3300002462 | JGI24702J35022_10002899 | JGI24702J35022_100028994 | 131 |
| 31 | 3300002462 | JGI24702J35022_10034842 | JGI24702J35022_100348423 | 131 |
| 32 | 3300002509 | JGI24699J35502_11120356 | JGI24699J35502_111203564 | 131 |
| 33 | 3300010049 | Ga0123356_11148280 | Ga0123356_111482801 | 131 |
| 34 | 3300010167 | Ga0123353_11687698 | Ga0123353_116876982 | 131 |
| 35 | 3300021244 | Ga0223686_1015745 | Ga0223686_10157452 | 131 |
| 36 | 3300024493 | Ga0264413_115887 | Ga0264413_1158872 | 131 |
| 37 | 3300042597 | Ga0466699_348703 | Ga0466699_348703_504_968 | 131 |
| 38 | 3300042602 | Ga0466713_111845 | Ga0466713_111845_3499_4092 | 131 |
| 39 | 3300042605 | Ga0466716_008812 | Ga0466716_008812_445_939 | 131 |
| 40 | 3300042620 | Ga0466728_068799 | Ga0466728_068799_1943_2374 | 131 |
| 41 | 3300042622 | Ga0466731_056567 | Ga0466731_056567_411_884 | 131 |
| 42 | 3300042635 | Ga0466702_272269 | Ga0466702_272269_868_1296 | 131 |
| 43 | 3300042655 | Ga0466727_204225 | Ga0466727_204225_329_835 | 131 |
| 44 | 3300002449 | JGI24698J34947_10176308 | JGI24698J34947_101763082 | 132 |
| 45 | 3300002450 | JGI24695J34938_10023542 | JGI24695J34938_100235421 | 132 |
| 46 | 3300002450 | JGI24695J34938_10031241 | JGI24695J34938_100312413 | 132 |
| 47 | 3300005201 | Ga0072941_1018715 | Ga0072941_10187155 | 132 |
| 48 | 3300009784 | Ga0123357_10406677 | Ga0123357_104066772 | 132 |
| 49 | 3300010167 | Ga0123353_11327730 | Ga0123353_113277302 | 132 |
| 50 | 3300042591 | Ga0466692_191986 | Ga0466692_191986_24488_24949 | 132 |
| 51 | 3300042594 | Ga0466694_242600 | Ga0466694_242600_350_748 | 132 |
| 52 | 3300042594 | Ga0466694_302098 | Ga0466694_302098_400_837 | 132 |
| 53 | 3300042597 | Ga0466699_070966 | Ga0466699_070966_508_972 | 132 |
| 54 | 3300042597 | Ga0466699_423839 | Ga0466699_423839_32_496 | 132 |
| 55 | 3300042614 | Ga0466712_025519 | Ga0466712_025519_263_721 | 132 |
| 56 | 3300042614 | Ga0466712_061301 | Ga0466712_061301_50_505 | 132 |
| 57 | 3300042614 | Ga0466712_104709 | Ga0466712_104709_1163_1594 | 132 |
| 58 | 3300042616 | Ga0466715_485929 | Ga0466715_485929_7828_8322 | 132 |
| 59 | 3300042619 | Ga0466726_332186 | Ga0466726_332186_29_451 | 132 |
| 60 | 3300042636 | Ga0466703_367488 | Ga0466703_367488_691_1188 | 132 |
| 61 | 3300042655 | Ga0466727_031929 | Ga0466727_031929_698_1198 | 132 |
| 62 | 3300002449 | JGI24698J34947_10040390 | JGI24698J34947_100403906 | 133 |
| 63 | 3300002450 | JGI24695J34938_10005520 | JGI24695J34938_100055202 | 133 |
| 64 | 3300005201 | Ga0072941_1004548 | Ga0072941_100454813 | 133 |
| 65 | 3300005201 | Ga0072941_1018748 | Ga0072941_10187486 | 133 |
| 66 | 3300005201 | Ga0072941_1067895 | Ga0072941_10678951 | 133 |
| 67 | 3300038395 | Ga0415639_066219 | Ga0415639_066219_1458_1892 | 133 |
| 68 | 3300038395 | Ga0415639_072405 | Ga0415639_072405_859_1341 | 133 |
| 69 | 3300038395 | Ga0415639_087842 | Ga0415639_087842_3015_3461 | 133 |
| 70 | 3300042594 | Ga0466694_134044 | Ga0466694_134044_7728_8165 | 133 |
| 71 | 3300042597 | Ga0466699_217997 | Ga0466699_217997_735_1199 | 133 |
| 72 | 3300042597 | Ga0466699_252720 | Ga0466699_252720_2924_3388 | 133 |
| 73 | 3300042600 | Ga0466700_131218 | Ga0466700_131218_693_1139 | 133 |
| 74 | 3300042609 | Ga0466722_179700 | Ga0466722_179700_21445_21978 | 133 |
| 75 | 3300042612 | Ga0466705_055159 | Ga0466705_055159_452_946 | 133 |
| 76 | 3300042614 | Ga0466712_004033 | Ga0466712_004033_70_528 | 133 |
| 77 | 3300042614 | Ga0466712_153482 | Ga0466712_153482_17828_18256 | 133 |
| 78 | 3300042615 | Ga0466711_271074 | Ga0466711_271074_26061_26462 | 133 |
| 79 | 3300002449 | JGI24698J34947_10006410 | JGI24698J34947_100064105 | 134 |
| 80 | 3300002450 | JGI24695J34938_10015334 | JGI24695J34938_100153342 | 134 |
| 81 | 3300005201 | Ga0072941_1016767 | Ga0072941_10167676 | 134 |
| 82 | 3300005201 | Ga0072941_1060314 | Ga0072941_10603143 | 134 |
| 83 | 3300010049 | Ga0123356_10000368 | Ga0123356_1000036811 | 134 |
| 84 | 3300010049 | Ga0123356_10000598 | Ga0123356_1000059816 | 134 |
| 85 | 3300010049 | Ga0123356_10012391 | Ga0123356_100123915 | 134 |
| 86 | 3300010049 | Ga0123356_10036397 | Ga0123356_100363973 | 134 |
| 87 | 3300010049 | Ga0123356_10581011 | Ga0123356_105810112 | 134 |
| 88 | 3300010167 | Ga0123353_10168009 | Ga0123353_101680093 | 134 |
| 89 | 3300038395 | Ga0415639_006637 | Ga0415639_006637_2199_2603 | 134 |
| 90 | 3300038395 | Ga0415639_018647 | Ga0415639_018647_1944_2399 | 134 |
| 91 | 3300042592 | Ga0466693_293912 | Ga0466693_293912_5941_6360 | 134 |
| 92 | 3300042597 | Ga0466699_012769 | Ga0466699_012769_1745_2209 | 134 |
| 93 | 3300042617 | Ga0466718_067005 | Ga0466718_067005_1824_2309 | 134 |
| 94 | 3300042619 | Ga0466726_218613 | Ga0466726_218613_830_1273 | 134 |
| 95 | 3300002462 | JGI24702J35022_10647648 | JGI24702J35022_106476481 | 135 |
| 96 | 3300005071 | Ga0068302_10159726 | Ga0068302_101597263 | 135 |
| 97 | 3300010049 | Ga0123356_10270822 | Ga0123356_102708223 | 135 |
| 98 | 3300010049 | Ga0123356_10647665 | Ga0123356_106476653 | 135 |
| 99 | 3300042597 | Ga0466699_233252 | Ga0466699_233252_3137_3601 | 135 |
| 100 | 3300042605 | Ga0466716_149333 | Ga0466716_149333_1195_1683 | 135 |
| 101 | 3300042617 | Ga0466718_049318 | Ga0466718_049318_32404_32811 | 135 |
| 102 | 3300042617 | Ga0466718_061254 | Ga0466718_061254_476_883 | 135 |
| 103 | 3300042617 | Ga0466718_111800 | Ga0466718_111800_17258_17665 | 135 |
| 104 | 3300042618 | Ga0466723_087757 | Ga0466723_087757_5116_5547 | 135 |
| 105 | 3300000089 | AustNasuHG_c1031586 | AustNasuHG_10315863 | 136 |
| 106 | 3300002450 | JGI24695J34938_10000285 | JGI24695J34938_1000028514 | 136 |
| 107 | 3300002450 | JGI24695J34938_10179170 | JGI24695J34938_101791703 | 136 |
| 108 | 3300005083 | Ga0068305_10001806 | Ga0068305_1000180617 | 136 |
| 109 | 3300042610 | Ga0466698_498568 | Ga0466698_498568_512_949 | 136 |
| 110 | 3300042636 | Ga0466703_194995 | Ga0466703_194995_624_1094 | 136 |
| 111 | 3300042659 | Ga0466733_073452 | Ga0466733_073452_3824_4306 | 136 |
| 112 | 3300001880 | FAAS_10815495 | FAAS_108154952 | 137 |
| 113 | 3300002450 | JGI24695J34938_10000729 | JGI24695J34938_1000072935 | 137 |
| 114 | 3300010049 | Ga0123356_11786073 | Ga0123356_117860732 | 137 |
| 115 | 3300042594 | Ga0466694_187078 | Ga0466694_187078_548_961 | 137 |
| 116 | 3300002462 | JGI24702J35022_10000367 | JGI24702J35022_100003677 | 138 |
| 117 | 3300010049 | Ga0123356_10005497 | Ga0123356_100054977 | 138 |
| 118 | 3300042609 | Ga0466722_026349 | Ga0466722_026349_10568_10984 | 138 |
| 119 | 3300042616 | Ga0466715_168443 | Ga0466715_168443_7068_7556 | 138 |
| 120 | 3300042622 | Ga0466731_120251 | Ga0466731_120251_6264_6680 | 138 |
| 121 | 3300042635 | Ga0466702_193250 | Ga0466702_193250_1892_2332 | 138 |
| 122 | 3300042643 | Ga0466704_249189 | Ga0466704_249189_3058_3501 | 138 |
| 123 | 3300002450 | JGI24695J34938_10046777 | JGI24695J34938_100467773 | 139 |
| 124 | 3300022815 | Ga0255786_1018583 | Ga0255786_10185832 | 139 |
| 125 | 3300042590 | Ga0466690_313579 | Ga0466690_313579_23811_24230 | 139 |
| 126 | 3300042593 | Ga0466691_079109 | Ga0466691_079109_4471_4890 | 139 |
| 127 | 3300042596 | Ga0466696_436012 | Ga0466696_436012_7671_8090 | 139 |
| 128 | 3300042597 | Ga0466699_027605 | Ga0466699_027605_3790_4233 | 139 |
| 129 | 3300042606 | Ga0466719_082274 | Ga0466719_082274_481_900 | 139 |
| 130 | 3300042609 | Ga0466722_055706 | Ga0466722_055706_153_572 | 139 |
| 131 | 3300042614 | Ga0466712_142798 | Ga0466712_142798_5342_5761 | 139 |
| 132 | 3300002449 | JGI24698J34947_10005807 | JGI24698J34947_100058072 | 140 |
| 133 | 3300002449 | JGI24698J34947_10023929 | JGI24698J34947_100239292 | 140 |
| 134 | 3300002449 | JGI24698J34947_10032099 | JGI24698J34947_100320992 | 140 |
| 135 | 3300002449 | JGI24698J34947_10038894 | JGI24698J34947_100388942 | 140 |
| 136 | 3300002449 | JGI24698J34947_10045683 | JGI24698J34947_100456832 | 140 |
| 137 | 3300002449 | JGI24698J34947_10066986 | JGI24698J34947_100669863 | 140 |
| 138 | 3300002449 | JGI24698J34947_10081432 | JGI24698J34947_100814322 | 140 |
| 139 | 3300002449 | JGI24698J34947_10095047 | JGI24698J34947_100950471 | 140 |
| 140 | 3300002449 | JGI24698J34947_10275112 | JGI24698J34947_102751121 | 140 |
| 141 | 3300002509 | JGI24699J35502_10959422 | JGI24699J35502_109594223 | 140 |
| 142 | 3300010049 | Ga0123356_10484847 | Ga0123356_104848472 | 140 |
| 143 | 3300042596 | Ga0466696_304127 | Ga0466696_304127_13237_13833 | 140 |
| 144 | 3300042604 | Ga0466717_118952 | Ga0466717_118952_442_864 | 140 |
| 145 | 3300042607 | Ga0466720_202772 | Ga0466720_202772_281_751 | 140 |
| 146 | 3300042615 | Ga0466711_178432 | Ga0466711_178432_888_1310 | 140 |
| 147 | 3300042624 | Ga0466735_016471 | Ga0466735_016471_410_832 | 140 |
| 148 | iso_pr_bacteria | 2781125636 | 2781279747 | 140 |
| 149 | 3300005201 | Ga0072941_1022161 | Ga0072941_102216117 | 141 |
| 150 | 3300042591 | Ga0466692_170482 | Ga0466692_170482_927_1352 | 141 |
| 151 | 3300042599 | Ga0466706_148078 | Ga0466706_148078_1123_1707 | 141 |
| 152 | 3300042617 | Ga0466718_125018 | Ga0466718_125018_1400_1894 | 141 |
| 153 | 3300042635 | Ga0466702_326266 | Ga0466702_326266_629_1054 | 141 |
| 154 | 3300042652 | Ga0466708_349712 | Ga0466708_349712_815_1240 | 141 |
| 155 | iso_pr_bacteria | 2781125665 | 2781341717 | 141 |
| 156 | 3300002450 | JGI24695J34938_10000152 | JGI24695J34938_1000015231 | 142 |
| 157 | 3300002450 | JGI24695J34938_10000189 | JGI24695J34938_1000018910 | 142 |
| 158 | 3300002450 | JGI24695J34938_10006923 | JGI24695J34938_100069234 | 142 |
| 159 | 3300010049 | Ga0123356_10000431 | Ga0123356_1000043134 | 142 |
| 160 | 3300010049 | Ga0123356_12415240 | Ga0123356_124152402 | 142 |
| 161 | 3300042596 | Ga0466696_190308 | Ga0466696_190308_3207_3635 | 142 |
| 162 | 3300042619 | Ga0466726_468403 | Ga0466726_468403_847_1275 | 142 |
| 163 | 3300042621 | Ga0466729_226006 | Ga0466729_226006_1173_1601 | 142 |
| 164 | 3300042635 | Ga0466702_215276 | Ga0466702_215276_719_1147 | 142 |
| 165 | 3300042636 | Ga0466703_001555 | Ga0466703_001555_21484_21990 | 142 |
| 166 | iso_pr_bacteria | 2781125657 | 2781323473 | 142 |
| 167 | 3300002449 | JGI24698J34947_10025462 | JGI24698J34947_100254623 | 143 |
| 168 | 3300010167 | Ga0123353_10871884 | Ga0123353_108718842 | 143 |
| 169 | 3300042605 | Ga0466716_385801 | Ga0466716_385801_16259_16690 | 143 |
| 170 | 3300042609 | Ga0466722_034783 | Ga0466722_034783_4335_4766 | 143 |
| 171 | 3300042610 | Ga0466698_150079 | Ga0466698_150079_177_608 | 143 |
| 172 | 3300042612 | Ga0466705_101049 | Ga0466705_101049_768_1199 | 143 |
| 173 | 3300042643 | Ga0466704_129378 | Ga0466704_129378_452_883 | 143 |
| 174 | 3300042652 | Ga0466708_224466 | Ga0466708_224466_3995_4426 | 143 |
| 175 | iso_pr_bacteria | 2819992462 | 2819994226 | 143 |
| 176 | iso_pr_bacteria | 2820020240 | 2820020878 | 143 |
| 177 | 3300001880 | FAAS_10081740 | FAAS_100817401 | 144 |
| 178 | 3300005200 | Ga0072940_1041905 | Ga0072940_10419053 | 144 |
| 179 | 3300024493 | Ga0264413_115888 | Ga0264413_1158883 | 144 |
| 180 | 3300042620 | Ga0466728_423289 | Ga0466728_423289_1913_2347 | 144 |
| 181 | 3300042624 | Ga0466735_044290 | Ga0466735_044290_829_1278 | 144 |
| 182 | iso_pr_bacteria | 2781125663 | 2781338073 | 144 |
| 183 | iso_pr_bacteria | 2781125686 | 2781419360 | 144 |
| 184 | 3300010049 | Ga0123356_10003877 | Ga0123356_1000387728 | 145 |
| 185 | 3300042606 | Ga0466719_545558 | Ga0466719_545558_478_915 | 145 |
| 186 | iso_pr_bacteria | 2781125634 | 2781273827 | 145 |
| 187 | 3300042608 | Ga0466721_313097 | Ga0466721_313097_521_961 | 146 |
| 188 | iso_pr_bacteria | 2781125642 | 2781292851 | 146 |
| 189 | iso_pr_bacteria | 2781125633 | 2781273133 | 147 |
| 190 | 3300010049 | Ga0123356_10636219 | Ga0123356_106362192 | 148 |
| 191 | 3300010049 | Ga0123356_11689085 | Ga0123356_116890851 | 148 |
| 192 | 3300042596 | Ga0466696_151398 | Ga0466696_151398_41052_41597 | 148 |
| 193 | iso_pr_bacteria | 2781125660 | 2781331429 | 148 |
| 194 | iso_pr_bacteria | 2781125664 | 2781339927 | 149 |
| 195 | iso_pr_bacteria | 2781125659 | 2781327442 | 150 |
| 196 | iso_pr_bacteria | 2781125661 | 2781332679 | 152 |
| 197 | iso_pr_bacteria | 2819990093 | 2819990137 | 154 |
| 198 | 3300010882 | Ga0123354_10039544 | Ga0123354_100395445 | 156 |
| 199 | iso_pr_bacteria | 2781125687 | 2781420220 | 162 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01196 | Ribosomal_L17 | Ribosomal protein L17 | 20 | 108 | 0.97 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.67 | 0.77 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.