Protein Family IF00989
Metagenome
Isolate
251
Members
213
Samples
79
Scaffolds
535.09
Avg Length
Representative Sequence
- ID
- 3300002932|CVPL010L_1000013|CVPL010L_100001325
- Length
- 615 aa
- Sequence
- MPRLHVRGNEKNRLFLWTGLFYLFSAGNNWIINRFCLEWAEIITQRDDALRINSPVQKDAFSGMNRRRFLKSSMAVAAVCGTSGVASLFSQAAFAEDAGIADGQTRRFDYAVLQAMAHDLARQPWGGAPRDLPPTLANLTPQAYNSIQYDANHSLWNNIEERKLDIQFFHVGMGFRRRVRMFSLDASTQQAREIHFRPELFKYNDAGVDTRQLEGQSDLGFAGFRVFKAPELARRDIVAFLGASYFRAVDSTYQYGLSARGLAVDTFTDTPEEFPDFTSFWFETVKGDATVFTVYALLDSPSITGAYKFTIHCQDTQVIMDVENHLYARKDIKQLGIAPMTSMFSCGNNERRMCDTIHPQIHDSDRLSMWLGNGEWVCRPLNNPQKLQFNAFQDKNPRGFGLLQLDRDFSHYQDVMGWYNKRPSLWVEPRNQWGKGAVSLMEIPTTGETLDNIVCFWQPEKAVKAGDELDFRYRLYWSAEPPVSTPLARVLATRTGMGGFPEGWAPGEHYPDKWARRFAIDFVGGDLKAAAPRGIEPVITLSSGEAKQIEILYVEPFDGYRILFDWYPTTDSTDPVEMRLFLRCQGEAISETWLYQYFPPAADKRNYVDDRIMK*
Sample Types
Isolate
68.5%
Metagenome
31.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Drosophilidae
24.9%
Apidae
18.5%
Unclassified
12.7%
Muscidae
5.9%
Culicidae
4.4%
Anthocoridae
3.9%
Curculionidae
3.9%
Armadillidiidae
3.4%
Tenebrionidae
3.4%
Termitidae
3.4%
Calliphoridae
2.9%
Tephritidae
2.4%
Pentatomidae
1.0%
Plutellidae
1.0%
Sarcophagidae
1.0%
Kalotermitidae
1.0%
Formicidae
1.0%
Cerambycidae
1.0%
Nymphalidae
0.5%
Rhopalidae
0.5%
Carabidae
0.5%
Thripidae
0.5%
Anthomyiidae
0.5%
Passalidae
0.5%
Crambidae
0.5%
Aphididae
0.5%
Elmidae
0.5%
Taxonomy
Archaea
0
Bacteria
234
Eukaryota
0
Viruses
0
Unclassified
17
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2588253732 | Klebsiella pneumoniae pneumoniae KP5-1 | Isolate | Pentatomidae |
| 2 | 2597490292 | Acetobacter malorum DmCS_005 | Isolate | Drosophilidae |
| 3 | 2775507278 | Commensalibacter papalotli (ex Servin-Garciduenas et al. 2014) MX-MONARCH01 | Isolate | Nymphalidae |
| 4 | 2824588292 | Yokenella regensburgei WCD67 | Isolate | Rhopalidae |
| 5 | 2834143536 | Parasaccharibacter apium AS1 | Isolate | Apidae |
| 6 | 2834160066 | Parasaccharibacter apium B8 | Isolate | Apidae |
| 7 | 2841175817 | Komagataeibacter saccharivorans JH1 | Isolate | Unclassified |
| 8 | 2856068565 | Cronobacter sakazakii MOD1-Md35s | Isolate | Muscidae |
| 9 | 2885058212 | Erwinia sp. OLTSP20 | Isolate | Anthocoridae |
| 10 | 2899194184 | Bombella sp. ESL0378 | Isolate | Apidae |
| 11 | 2901296437 | Erwinia dacicola Oroville | Isolate | Tephritidae |
| 12 | 2920413932 | Bombella sp. ESL0380 | Isolate | Apidae |
| 13 | 2967924226 | Cronobacter malonaticus MOD1-Md25g | Isolate | Muscidae |
| 14 | 2970322301 | Cronobacter sakazakii MOD1-Md33g | Isolate | Muscidae |
| 15 | 3001462594 | Tatumella sp. JGM91 | Isolate | Drosophilidae |
| 16 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 17 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 18 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 19 | 3300035363 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut | Metagenome | Plutellidae |
| 20 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 21 | 8067594896 | Gluconobacter kondonii Dm-18 | Isolate | Drosophilidae |
| 22 | 8071343737 | Escherichia coli PN119 | Isolate | Calliphoridae |
| 23 | 8074288691 | Tatumella sp. JGM82 | Isolate | Drosophilidae |
| 24 | 8074745029 | Commensalibacter melissae M0407 | Isolate | Apidae |
| 25 | 8074748739 | Commensalibacter sp. W8133 | Isolate | Apidae |
| 26 | 8100531325 | Gluconobacter sp. Dm-73 | Isolate | Drosophilidae |
| 27 | 2513020017 | Shimwellia blattae DSM 4481 | Isolate | Unclassified |
| 28 | 2756170209 | Commensalibacter sp. ESL0284 | Isolate | Unclassified |
| 29 | 2791354941 | Bombella intestini R-52487 | Isolate | Unclassified |
| 30 | 2834038347 | Gluconobacter sp. DsW_058 | Isolate | Drosophilidae |
| 31 | 2836714267 | Shimwellia blattae NCTC10965 | Isolate | |
| 32 | 2846386538 | Rahnella sp. AN3-3W3 | Isolate | Pentatomidae |
| 33 | 2858084324 | Acetobacter sp. DsW_54 | Isolate | Drosophilidae |
| 34 | 2858119979 | Acetobacter malorum DsW_057 | Isolate | Drosophilidae |
| 35 | 2891690481 | Commensalibacter melissae ESL0390 | Isolate | Apidae |
| 36 | 2937387794 | Cronobacter turicensis MOD1-Sh41g | Isolate | Sarcophagidae |
| 37 | 2938192669 | Citrobacter sp. TSA-1 | Isolate | Unclassified |
| 38 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 39 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 40 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 41 | 8021546568 | Klebsiella sp. Kps | Isolate | Tephritidae |
| 42 | 8065462725 | Tatumella sp. JGM100 | Isolate | Drosophilidae |
| 43 | 8065466226 | Tatumella sp. JGM130 | Isolate | Drosophilidae |
| 44 | 8065469765 | Tatumella sp. JGM16 | Isolate | Drosophilidae |
| 45 | 8067604290 | Gluconobacter wancherniae Dm-19 | Isolate | Drosophilidae |
| 46 | 8067607133 | Gluconobacter wancherniae Dm-15 | Isolate | Drosophilidae |
| 47 | 8071322446 | Escherichia coli PN122 | Isolate | Calliphoridae |
| 48 | 8074746876 | Commensalibacter sp. W6292M3 | Isolate | Apidae |
| 49 | 8074750600 | Commensalibacter sp. W8163 | Isolate | Apidae |
| 50 | 8103002986 | Erwinia sp. S38 | Isolate | Curculionidae |
| 51 | 8103008710 | Erwinia sp. S43 | Isolate | Curculionidae |
| 52 | 2547132185 | Enterobacter cancerogenus YZ1 | Isolate | Tenebrionidae |
| 53 | 2617271320 | Acetobacter pomorum DmCS_004 | Isolate | Drosophilidae |
| 54 | 2619619082 | Pantoea agglomerans SL1_M5 | Isolate | Unclassified |
| 55 | 2778261152 | Escherichia coli MOD1-EC284 | Isolate | Unclassified |
| 56 | 2822856742 | Enterobacter cancerogenus CR-Eb1 | Isolate | Unclassified |
| 57 | 2839192570 | Gluconobacter sp. DsW_056 | Isolate | Drosophilidae |
| 58 | 2854518031 | Acetobacter indonesiensis DmW_046 | Isolate | Drosophilidae |
| 59 | 2874880541 | Enterobacter hormaechei E3442 | Isolate | Unclassified |
| 60 | 2891675627 | Commensalibacter melissae ESL0366 | Isolate | Apidae |
| 61 | 2898975184 | Erwinia dacicola IL | Isolate | Tephritidae |
| 62 | 2964846109 | Cronobacter sakazakii MOD1-Md5g | Isolate | Muscidae |
| 63 | 2964859436 | Cronobacter sakazakii MOD1-Md40g | Isolate | Muscidae |
| 64 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 65 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 66 | 3004364956 | Cronobacter sakazakii MOD1-Md5s | Isolate | Muscidae |
| 67 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 68 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 69 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 70 | 3300035364 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - adult gut | Metagenome | Plutellidae |
| 71 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 72 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 73 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 74 | 8021540981 | Klebsiella sp. Kpp | Isolate | Tephritidae |
| 75 | 8028002147 | Enterobacter sp. 10-1 | Isolate | Cerambycidae |
| 76 | 8074832014 | Commensalibacter melissae M0391 | Isolate | Apidae |
| 77 | 8074875073 | Commensalibacter sp. M0265 | Isolate | Apidae |
| 78 | 8074878724 | Commensalibacter sp. M0267 | Isolate | Apidae |
| 79 | 8074880551 | Commensalibacter sp. M0268 | Isolate | Apidae |
| 80 | 8099192374 | Erwinia typographi IC4 | Isolate | Curculionidae |
| 81 | 2507262057 | Enterobacteriaceae bacterium FGI 57 | Isolate | Unclassified |
| 82 | 2513237393 | Gluconobacter morbifer G707 | Isolate | Drosophilidae |
| 83 | 2551306516 | Enterobacter hormaechei YT3 | Isolate | Tenebrionidae |
| 84 | 2833052049 | Commensalibacter melissae AMU001 | Isolate | Apidae |
| 85 | 2835008077 | Commensalibacter intestini DmL_052 | Isolate | Drosophilidae |
| 86 | 2854548700 | Acetobacter persici DmL_053 | Isolate | Drosophilidae |
| 87 | 2868683769 | Acetobacter sp. DmW_043 | Isolate | Drosophilidae |
| 88 | 2871760914 | Pantoea ananatis PANS 01-2 | Isolate | Thripidae |
| 89 | 2921816052 | Cronobacter sakazakii MOD1-Anth48g | Isolate | Anthomyiidae |
| 90 | 2937427229 | Cronobacter malonaticus MOD1-Md99g | Isolate | Muscidae |
| 91 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 92 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 93 | 3001459110 | Tatumella sp. JGM118 | Isolate | Drosophilidae |
| 94 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 95 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 96 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 97 | 651324086 | Plautia crossota stali symbiont | Isolate | Unclassified |
| 98 | 8062647588 | Nissabacter archeti JGM97 | Isolate | Drosophilidae |
| 99 | 8071333649 | Escherichia coli PN108 | Isolate | Calliphoridae |
| 100 | 8071338694 | Escherichia coli PN87 | Isolate | Calliphoridae |
| 101 | 8074810961 | Bombella apis SME1 | Isolate | Apidae |
| 102 | 8074871419 | Commensalibacter sp. M0133 | Isolate | Apidae |
| 103 | 8074884171 | Commensalibacter sp. M0355 | Isolate | Apidae |
| 104 | 8100534375 | Gluconobacter sp. Dm-74 | Isolate | Drosophilidae |
| 105 | 8102982778 | Erwinia sp. S63 | Isolate | Curculionidae |
| 106 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 107 | 2548876789 | Xanthomonas sacchari NCPPB 4393 | Isolate | |
| 108 | 2551306531 | Enterobacter hormaechei YT2 | Isolate | Tenebrionidae |
| 109 | 2786546124 | Acetobacter sp. JWB | Isolate | Drosophilidae |
| 110 | 2833053935 | Buttiauxella sp. 3AFRM03 | Isolate | Cerambycidae |
| 111 | 2837516909 | Rahnella bruchi DSM 27398 | Isolate | Unclassified |
| 112 | 2854520951 | Acetobacter pasteurianus AD | Isolate | Unclassified |
| 113 | 2854536247 | Acetobacter senegalensis DmL_050 | Isolate | Drosophilidae |
| 114 | 2858102877 | Acetobacter orientalis DmW_048 | Isolate | Drosophilidae |
| 115 | 2858129007 | Acetobacter orientalis DmW_045 | Isolate | Drosophilidae |
| 116 | 2885043073 | Erwinia sp. OLSSP12 | Isolate | Anthocoridae |
| 117 | 2970335472 | Cronobacter muytjensii MOD1-Md1s | Isolate | Muscidae |
| 118 | 2977727922 | Cronobacter sakazakii MOD1-Md33s | Isolate | Muscidae |
| 119 | 3007994558 | Escherichia alba B35 | Isolate | Tenebrionidae |
| 120 | 3300007224 | Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut | Metagenome | Unclassified |
| 121 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 122 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 123 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 124 | 8067591850 | Gluconobacter kondonii Dm-47 | Isolate | Drosophilidae |
| 125 | 8074737057 | Commensalibacter sp. M0357 | Isolate | Apidae |
| 126 | 8074867669 | Commensalibacter sp. B14384M2 | Isolate | Apidae |
| 127 | 8074869529 | Commensalibacter sp. B14384M3 | Isolate | Apidae |
| 128 | 8074873247 | Commensalibacter sp. M0134 | Isolate | Apidae |
| 129 | 8074876897 | Commensalibacter sp. M0266 | Isolate | Apidae |
| 130 | 8100181737 | Kosakonia sp. S58 | Isolate | Curculionidae |
| 131 | 8100528075 | Gluconobacter sp. Dm-44 | Isolate | Drosophilidae |
| 132 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 133 | 2531839602 | Shimwellia blattae NBRC 105725 | Isolate | Unclassified |
| 134 | 2765235945 | Kosakonia cowanii Esp_Z | Isolate | Culicidae |
| 135 | 2834165886 | Saccharibacter sp. M18 | Isolate | Apidae |
| 136 | 2854576727 | Acetobacter okinawensis DsW_060 | Isolate | Drosophilidae |
| 137 | 2858089842 | Acetobacter tropicalis DmW_042 | Isolate | Drosophilidae |
| 138 | 2858110640 | Acetobacter indonesiensis DmL_051 | Isolate | Drosophilidae |
| 139 | 2901819457 | Bombella sp. ESL0385 | Isolate | Apidae |
| 140 | 2977691992 | Cronobacter malonaticus MOD1-Md27g | Isolate | Muscidae |
| 141 | 2977745872 | Cronobacter sakazakii MOD1-Md1g | Isolate | Muscidae |
| 142 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 143 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 144 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 145 | 8067579126 | Gluconobacter kondonii Dm-16 | Isolate | Drosophilidae |
| 146 | 8067581993 | Gluconobacter kondonii Dm-54 | Isolate | Drosophilidae |
| 147 | 8067598439 | Gluconobacter wancherniae Dm-17 | Isolate | Drosophilidae |
| 148 | 8074882376 | Commensalibacter sp. M0270 | Isolate | Apidae |
| 149 | 8100176769 | Kosakonia sp. S57 | Isolate | Curculionidae |
| 150 | 2508501067 | Opitutaceae bacterium TAV1 | Isolate | Unclassified |
| 151 | 2513237339 | Commensalibacter intestini A911 | Isolate | Drosophilidae |
| 152 | 2645727860 | Winslowiella iniecta B120 | Isolate | Aphididae |
| 153 | 2651870110 | Izhakiella capsodis N6PO6 | Isolate | Unclassified |
| 154 | 2816332478 | Acetobacter tropicalis BDGP1 | Isolate | Drosophilidae |
| 155 | 2843864159 | Acetobacter pomorum SH | Isolate | Drosophilidae |
| 156 | 2864761044 | Stenotrophomonas rhizophilia S00008 | Isolate | Elmidae |
| 157 | 2868677537 | Acetobacter orientalis DsW_061 | Isolate | Drosophilidae |
| 158 | 2871771314 | Pantoea sp. Ae16 | Isolate | Culicidae |
| 159 | 2884203697 | Commensalibacter melissae ESL0284 | Isolate | Apidae |
| 160 | 2885046828 | Erwinia sp. OLCASP19 | Isolate | Anthocoridae |
| 161 | 2885054481 | Erwinia sp. OLMDSP33 | Isolate | Anthocoridae |
| 162 | 2891591111 | Commensalibacter sp. ESL0382 | Isolate | Unclassified |
| 163 | 2891610497 | Commensalibacter melissae ESL0367 | Isolate | Apidae |
| 164 | 2920412021 | Bombella sp. ESL0387 | Isolate | Apidae |
| 165 | 2921842437 | Cronobacter sakazakii MOD1-Lc10s | Isolate | Calliphoridae |
| 166 | 2957730672 | Cronobacter sakazakii MOD1-Md70g | Isolate | Muscidae |
| 167 | 2967491045 | Entomobacter blattae G55GP | Isolate | Unclassified |
| 168 | 2967915117 | Cronobacter sakazakii MOD1-Lc10g | Isolate | Calliphoridae |
| 169 | 2979682021 | Cronobacter turicensis MOD1-Sh41s | Isolate | Sarcophagidae |
| 170 | 3002394112 | Gluconobacter sp. Gdi | Isolate | Drosophilidae |
| 171 | 3004010258 | Citrobacter sp. JGM124 | Isolate | Drosophilidae |
| 172 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 173 | 3300007149 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut | Metagenome | Drosophilidae |
| 174 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 175 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 176 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 177 | 648276708 | Pantoea sp. aB | Isolate | Unclassified |
| 178 | 651324000 | Acetobacter pomorum DM001 | Isolate | Drosophilidae |
| 179 | 8067588748 | Gluconobacter kondonii Dm-42 | Isolate | Drosophilidae |
| 180 | 8073124432 | Escherichia coli MOD1-EC294 | Isolate | Unclassified |
| 181 | 8074292191 | Tatumella sp. JGM94 | Isolate | Drosophilidae |
| 182 | 8074809037 | Bombella apis MRM1 | Isolate | Apidae |
| 183 | 8116947750 | Gluconacetobacter sacchari DSM 12717 | Isolate | Unclassified |
| 184 | 2519899623 | Enterobacter sp. Ag1 | Isolate | Culicidae |
| 185 | 2537561600 | Salmonella enterica enterica sv. Newport CVM 19443 | Isolate | Unclassified |
| 186 | 2588253791 | Yokenella regensburgei F. Haas DC-1, ATCC 49455 | Isolate | Unclassified |
| 187 | 2751185679 | Parasaccharibacter apium G7_7_3c | Isolate | Apidae |
| 188 | 2778261153 | Escherichia coli MOD1-EC286 | Isolate | Unclassified |
| 189 | 2831736028 | Parasaccharibacter apium A29 | Isolate | Apidae |
| 190 | 2834852038 | Acetobacter cibinongensis DsW_47 | Isolate | Drosophilidae |
| 191 | 2835335304 | Rahnella sp. Larv3_ips | Isolate | Curculionidae |
| 192 | 2858105562 | Acetobacter sp. DsW_059 | Isolate | Drosophilidae |
| 193 | 2885050628 | Erwinia sp. OLMTSP26 | Isolate | Anthocoridae |
| 194 | 2885061987 | Erwinia sp. OLFS4 | Isolate | Anthocoridae |
| 195 | 2885065815 | Erwinia sp. OAMSP11 | Isolate | Anthocoridae |
| 196 | 2891605396 | Commensalibacter melissae ESL0392 | Isolate | Apidae |
| 197 | 2891614855 | Commensalibacter melissae ESL0379 | Isolate | Apidae |
| 198 | 2898991528 | Erwinia sp. OLMDLW33 | Isolate | Anthocoridae |
| 199 | 3002401049 | Gluconobacter sp. Dm-62 | Isolate | Drosophilidae |
| 200 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 201 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 202 | 3300007763 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 5 gut | Metagenome | Drosophilidae |
| 203 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 204 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 205 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 206 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 207 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 208 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 209 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 210 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 211 | 8067585538 | Gluconobacter kondonii Dm-68 | Isolate | Drosophilidae |
| 212 | 8074743123 | Commensalibacter melissae M0402 | Isolate | Apidae |
| 213 | 8074812948 | Bombella apis MRM1 | Isolate | Apidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0160453_102363 | 3300012814 | Bacteria | 4708 |
| 2 | Ga0160456_100039 | 3300012820 | Bacteria | 204704 |
| 3 | Ga0160469_100037 | 3300012824 | Bacteria | 244618 |
| 4 | Ga0160433_100725 | 3300012846 | Unclassified | 12414 |
| 5 | Ga0123356_10086300 | 3300010049 | Unclassified | 2979 |
| 6 | CVPL010L_1000784 | 3300002932 | Unclassified | 5758 |
| 7 | Ga0562379_0013 | 3300056790 | Bacteria | 1548004 |
| 8 | Ga0562377_0035 | 3300056842 | Bacteria | 679350 |
| 9 | Ga0562375_0981 | 3300056856 | Bacteria | 45408 |
| 10 | Ga0466730_021583 | 3300042625 | Bacteria | 44984 |
| 11 | Ga0160469_100103 | 3300012824 | Bacteria | 132140 |
| 12 | Ga0160441_100066 | 3300012825 | Bacteria | 137558 |
| 13 | Ga0160457_1000197 | 3300012858 | Bacteria | 49498 |
| 14 | Ga0123355_10134298 | 3300009826 | Bacteria | 3804 |
| 15 | Ga0123356_10058254 | 3300010049 | Bacteria | 3601 |
| 16 | FGTW_contig31146 | 2065487013 | Unclassified | 5916 |
| 17 | FGTW_contig32106 | 2065487013 | Bacteria | 2895 |
| 18 | Ga0104147_1065841 | 3300007224 | Unclassified | 20953 |
| 19 | Ga0466733_125118 | 3300042659 | Bacteria | 10081 |
| 20 | Ga0466734_051383 | 3300042623 | Bacteria | 6890 |
| 21 | Ga0466734_061084 | 3300042623 | Bacteria | 10748 |
| 22 | Ga0160472_100534 | 3300012839 | Bacteria | 24135 |
| 23 | Ga0160436_1001128 | 3300012861 | Unclassified | 7707 |
| 24 | CVPL010L_1000007 | 3300002932 | Bacteria | 119115 |
| 25 | Ga0063521_1000564 | 3300003973 | Unclassified | 15855 |
| 26 | Ga0104147_1079616 | 3300007224 | Bacteria | 6005 |
| 27 | Ga0105004_1070531 | 3300007763 | Unclassified | 6269 |
| 28 | Ga0466730_100152 | 3300042625 | Bacteria | 43447 |
| 29 | Ga0160445_100052 | 3300012847 | Unclassified | 137755 |
| 30 | Ga0160443_100215 | 3300012848 | Bacteria | 71273 |
| 31 | Ga0160447_101892 | 3300012849 | Bacteria | 7744 |
| 32 | Ga0466713_014808 | 3300042602 | Bacteria | 349625 |
| 33 | Ga0466730_012692 | 3300042625 | Bacteria | 14706 |
| 34 | Ga0466730_025915 | 3300042625 | Bacteria | 79236 |
| 35 | Ga0160472_100019 | 3300012839 | Bacteria | 338828 |
| 36 | Ga0160472_100272 | 3300012839 | Bacteria | 57602 |
| 37 | Ga0265387_1000087 | 3300024582 | Bacteria | 26512 |
| 38 | Ga0123355_10004152 | 3300009826 | Bacteria | 21018 |
| 39 | Ga0123355_10089402 | 3300009826 | Unclassified | 4888 |
| 40 | Ga0123356_10033362 | 3300010049 | Bacteria | 4814 |
| 41 | Ga0123356_10056049 | 3300010049 | Bacteria | 3671 |
| 42 | Ga0466713_096430 | 3300042602 | Bacteria | 298472 |
| 43 | FGTW_contig30489 | 2065487013 | Unclassified | 22213 |
| 44 | 2227080771 | 2225789004 | Bacteria | 224496 |
| 45 | Ga0105553_1033891 | 3300007767 | Bacteria | 20853 |
| 46 | Ga0466704_399957 | 3300042643 | Bacteria | 13440 |
| 47 | Ga0160456_100908 | 3300012820 | Unclassified | 7931 |
| 48 | Ga0160469_100020 | 3300012824 | Bacteria | 336522 |
| 49 | Ga0160460_100232 | 3300012845 | Bacteria | 51277 |
| 50 | Ga0160435_1005729 | 3300012857 | Unclassified | 2792 |
| 51 | Ga0160436_1000354 | 3300012861 | Bacteria | 19493 |
| 52 | Ga0247290_00116 | 3300035364 | Bacteria | 24777 |
| 53 | CVPL005L_10000003 | 3300002938 | Bacteria | 280771 |
| 54 | Ga0063521_1000038 | 3300003973 | Bacteria | 113419 |
| 55 | Ga0466705_389453 | 3300042612 | Bacteria | 22217 |
| 56 | Ga0466734_001535 | 3300042623 | Bacteria | 6856 |
| 57 | Ga0466730_007218 | 3300042625 | Bacteria | 66509 |
| 58 | Ga0160468_100620 | 3300012819 | Bacteria | 13209 |
| 59 | Ga0160472_100777 | 3300012839 | Bacteria | 13884 |
| 60 | Ga0160433_100143 | 3300012846 | Bacteria | 62597 |
| 61 | Ga0247289_0066 | 3300035363 | Bacteria | 30319 |
| 62 | Ga0466693_074793 | 3300042592 | Bacteria | 6175 |
| 63 | Ga0160454_100045 | 3300012798 | Unclassified | 205040 |
| 64 | HBC_ctgsDRAFT_1001157 | 3300000333 | Bacteria | 5773 |
| 65 | CVPL010L_1000013 | 3300002932 | Bacteria | 177613 |
| 66 | Ga0466730_040745 | 3300042625 | Bacteria | 31736 |
| 67 | Ga0466730_061446 | 3300042625 | Bacteria | 2300 |
| 68 | Ga0160468_100320 | 3300012819 | Bacteria | 22385 |
| 69 | Ga0160456_100132 | 3300012820 | Bacteria | 70951 |
| 70 | Ga0160452_100034 | 3300012834 | Bacteria | 214802 |
| 71 | Ga0160446_100117 | 3300012835 | Bacteria | 71007 |
| 72 | Ga0160435_1000283 | 3300012857 | Unclassified | 22154 |
| 73 | Ga0160457_1000104 | 3300012858 | Unclassified | 109324 |
| 74 | Ga0466701_013706 | 3300042598 | Bacteria | 144396 |
| 75 | Ga0466713_106851 | 3300042602 | Unclassified | 4415 |
| 76 | Ga0063521_1000026 | 3300003973 | Bacteria | 128736 |
| 77 | Ga0063521_1000303 | 3300003973 | Bacteria | 30385 |
| 78 | Ga0074278_109074 | 3300005721 | Bacteria | 58903 |
| 79 | Ga0104040_1034656 | 3300007149 | Bacteria | 3651 |
Family Sequences
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF04349 | MdoG | Periplasmic glucan biosynthesis protein, MdoG | 108 | 597 | 0.95 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.83 | 0.88 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.