Protein Family IF00983
Metagenome
Isolate
163
Members
98
Samples
114
Scaffolds
177.06
Avg Length
Representative Sequence
- ID
- 3300002931|CVPL010W_10030295|CVPL010W_100302952
- Length
- 191 aa
- Sequence
- MSLNSLSAGAQLPDDVNVVIEIPMNADPVKYEVDKASGAVFVDRFMLTAMHYPCNYGYIPQTLSDDGDPADVLVITPFPIQIGAVIRCRPIGILHMEDESGGDAKLLALPIDKLYPSYRQIQNVQDLPAQDIARIQHFFEHYKDLEAGKWVKVKDWGDAAAARAEIMQSAARYEQSGSSTDRPNSPLFAA*
Sample Types
Isolate
30.1%
Metagenome
69.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Formicidae
23.4%
Apidae
19.1%
Unclassified
17.0%
Termitidae
12.8%
Armadillidiidae
6.4%
Elmidae
5.3%
Kalotermitidae
3.2%
Culicidae
3.2%
Daphniidae
1.1%
Hydrophilidae
1.1%
Passalidae
1.1%
Curculionidae
1.1%
Cicadellidae
1.1%
Pseudococcidae
1.1%
Scarabaeidae
1.1%
Crambidae
1.1%
Muscidae
1.1%
Taxonomy
Archaea
0
Bacteria
142
Eukaryota
0
Viruses
0
Unclassified
21
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2687453754 | Pseudomonadales bacterium Cag26 | Isolate | Unclassified |
| 2 | 2751185856 | Bartonella apis BBC0244 | Isolate | Apidae |
| 3 | 2864755708 | Massilia timonae S00006 | Isolate | Elmidae |
| 4 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 5 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 6 | 8073617375 | Bartonella apis W8098 | Isolate | Apidae |
| 7 | 8082291289 | Bartonella apihabitans K-FP28 | Isolate | Apidae |
| 8 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 9 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 10 | 3300028918 | Ant gut bacterial community from Dolichoderus sp. 2-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC085 | Metagenome | Formicidae |
| 11 | 3300029810 | Ant gut bacterial community from Dolichoderus sp. 4-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC189 | Metagenome | Formicidae |
| 12 | 2556921669 | Shinella sp. DD12 | Isolate | Daphniidae |
| 13 | 2873562573 | Thermomonas sp. HDW16 | Isolate | Hydrophilidae |
| 14 | 2900354037 | Nocardia macrotermitis RB20 | Isolate | Termitidae |
| 15 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 16 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 17 | 8068946563 | Bartonella apihabitans M0187 | Isolate | Apidae |
| 18 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 19 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 20 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 21 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 22 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 23 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 24 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 25 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 26 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 27 | 2599185261 | Thorsellia anophelis DSM 18579 | Isolate | Unclassified |
| 28 | 2687453755 | Pseudomonadales bacterium Cag27 | Isolate | Unclassified |
| 29 | 2864937364 | Acidovorax soli S00198 | Isolate | Elmidae |
| 30 | 2873468275 | Agrobacterium vitis S00131 | Isolate | Elmidae |
| 31 | 2963630348 | Burkholderiales bacterium 3487_49 | Isolate | Formicidae |
| 32 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 33 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 34 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 35 | 8073624232 | Bartonella sp. W8151 | Isolate | Apidae |
| 36 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 37 | 2820142992 | Unclassified Proteobacteria Emb289P3bin113 | Isolate | Unclassified |
| 38 | 8068953321 | Bartonella apihabitans M0190 | Isolate | Apidae |
| 39 | 3006190525 | Acinetobacter sp. S54 | Isolate | Curculionidae |
| 40 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 41 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 42 | 3300009460 | Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov | Metagenome | |
| 43 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 44 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 45 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 46 | 2681813507 | Insolitispirillum peregrinum integrum DSM 11589 | Isolate | Unclassified |
| 47 | 2687453742 | Burkholderiales bacterium B_Cag20 | Isolate | Unclassified |
| 48 | 2751185853 | Bartonella apis BBC0178 | Isolate | Apidae |
| 49 | 2900368070 | Nocardia aurantia RB56 | Isolate | Termitidae |
| 50 | 8068944069 | Bartonella choladocola W8125 | Isolate | Apidae |
| 51 | 8068955631 | Bartonella apihabitans M0280 | Isolate | Apidae |
| 52 | 8073628750 | Bartonella sp. W8167 | Isolate | Apidae |
| 53 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 54 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 55 | 2648501856 | Candidatus Baumannia cicadellinicola BGSS | Isolate | Cicadellidae |
| 56 | 2687453753 | Burkholderiales bacterium B_Cag25 | Isolate | Unclassified |
| 57 | 2832201259 | Rickettsiella grylli TrM1 | Isolate | Unclassified |
| 58 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 59 | 650716016 | Candidatus Moranella endobia PCIT | Isolate | Pseudococcidae |
| 60 | 8073626464 | Bartonella apis W8152 | Isolate | Apidae |
| 61 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 62 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 63 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 64 | 3300029809 | Ant gut bacterial community from Dolichoderus sp. 3-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC188 | Metagenome | Formicidae |
| 65 | 2603880165 | Burkholderiales A1 | Isolate | Unclassified |
| 66 | 2603880170 | Burkholderiales A2 | Isolate | Unclassified |
| 67 | 2603880172 | Burkholderiales C | Isolate | Unclassified |
| 68 | 2687453756 | Pseudomonadales bacterium Cag32 | Isolate | Unclassified |
| 69 | 2695420964 | Hyphomicrobiales bacterium JR021 | Isolate | Unclassified |
| 70 | 2751185858 | Bartonella apis BBC0122 | Isolate | Apidae |
| 71 | 2818991320 | Klugiella xanthotipulae DSM 18031 | Isolate | Unclassified |
| 72 | 2864968865 | Paucibacter oligotrophus S00239 | Isolate | Elmidae |
| 73 | 2883683260 | Protaetiibacter larvae KACC 19322 | Isolate | Scarabaeidae |
| 74 | 2938192669 | Citrobacter sp. TSA-1 | Isolate | Unclassified |
| 75 | 8068941587 | Bartonella choladocola B10834H15 | Isolate | Apidae |
| 76 | 8073619611 | Bartonella apis B10834G6 | Isolate | Apidae |
| 77 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 78 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 79 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 80 | 3300026175 | Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 | Metagenome | Formicidae |
| 81 | 2562617066 | Rickettsiella grylli AAQJ | Isolate | Armadillidiidae |
| 82 | 2855798354 | Achromobacter insolitus AR476-2 | Isolate | Crambidae |
| 83 | 2864993140 | Agrobacterium vitis S00303 | Isolate | Elmidae |
| 84 | 2900132049 | Bartonella massiliensis OS09 | Isolate | Unclassified |
| 85 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 86 | 8067483258 | Ochrobactrum soli MTP-C0764 | Isolate | Muscidae |
| 87 | 8068950955 | Bartonella apihabitans W8097 | Isolate | Apidae |
| 88 | 8073621894 | Bartonella apis W8099 | Isolate | Apidae |
| 89 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 90 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 91 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 92 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 93 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 94 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 95 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 96 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 97 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 98 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0160453_100109 | 3300012814 | Bacteria | 83963 |
| 2 | Ga0160456_100224 | 3300012820 | Unclassified | 32863 |
| 3 | Ga0160441_106703 | 3300012825 | Bacteria | 1602 |
| 4 | Ga0160459_104614 | 3300012831 | Unclassified | 1853 |
| 5 | Ga0309903_100001 | 3300029809 | Bacteria | 185988 |
| 6 | JGI24705J35276_12232809 | 3300002504 | Bacteria | 4524 |
| 7 | CVPL010L_1000015 | 3300002932 | Bacteria | 82121 |
| 8 | CVPL005W_1000069 | 3300002934 | Unclassified | 40639 |
| 9 | Ga0074278_138880 | 3300005721 | Unclassified | 4282 |
| 10 | Ga0103261_1010387 | 3300007083 | Bacteria | 1301 |
| 11 | Ga0102738_1000159 | 3300007141 | Bacteria | 27243 |
| 12 | Ga0102737_1000174 | 3300007142 | Bacteria | 21715 |
| 13 | Ga0466734_100746 | 3300042623 | Bacteria | 7083 |
| 14 | Ga0160455_100002 | 3300012837 | Bacteria | 1193112 |
| 15 | Ga0160430_100929 | 3300012852 | Bacteria | 12779 |
| 16 | Ga0160435_1021970 | 3300012857 | Bacteria | 1117 |
| 17 | Ga0466657_143038 | 3300042582 | Bacteria | 3415 |
| 18 | Ga0466657_148407 | 3300042582 | Bacteria | 13557 |
| 19 | CVPL005W_1000372 | 3300002934 | Bacteria | 18991 |
| 20 | CVPL005L_10000357 | 3300002938 | Bacteria | 44612 |
| 21 | Ga0102736_1006139 | 3300007052 | Unclassified | 1492 |
| 22 | Ga0103266_1000481 | 3300007067 | Bacteria | 8401 |
| 23 | Ga0103265_1003016 | 3300007068 | Bacteria | 2533 |
| 24 | Ga0102735_1025226 | 3300007080 | Bacteria | 810 |
| 25 | Ga0103260_1002813 | 3300007139 | Bacteria | 2887 |
| 26 | Ga0103264_1002070 | 3300007188 | Bacteria | 14643 |
| 27 | Ga0103268_1046950 | 3300007192 | Unclassified | 1059 |
| 28 | Ga0127649_101884 | 3300009460 | Bacteria | 90098 |
| 29 | Ga0466724_47083 | 3300042649 | Bacteria | 378486 |
| 30 | Ga0466725_029360 | 3300042654 | Unclassified | 43083 |
| 31 | Ga0123354_10646116 | 3300010882 | Bacteria | 757 |
| 32 | Ga0160430_104020 | 3300012852 | Unclassified | 3816 |
| 33 | Ga0466657_266916 | 3300042582 | Bacteria | 12515 |
| 34 | IMNBGM34_c000015 | 3300000036 | Bacteria | 47738 |
| 35 | Ga0102736_1005376 | 3300007052 | Bacteria | 1643 |
| 36 | Ga0103266_1000035 | 3300007067 | Bacteria | 107458 |
| 37 | Ga0102734_1001375 | 3300007129 | Bacteria | 13945 |
| 38 | Ga0102734_1008094 | 3300007129 | Unclassified | 7237 |
| 39 | Ga0103260_1038175 | 3300007139 | Unclassified | 739 |
| 40 | Ga0102738_1000019 | 3300007141 | Bacteria | 84268 |
| 41 | Ga0102738_1002110 | 3300007141 | Bacteria | 2998 |
| 42 | Ga0103264_1000253 | 3300007188 | Bacteria | 50442 |
| 43 | Ga0103264_1000812 | 3300007188 | Bacteria | 26086 |
| 44 | Ga0103264_1000917 | 3300007188 | Bacteria | 13257 |
| 45 | Ga0103264_1002868 | 3300007188 | Bacteria | 12712 |
| 46 | Ga0103264_1045163 | 3300007188 | Unclassified | 1805 |
| 47 | Ga0466701_082471 | 3300042598 | Bacteria | 98188 |
| 48 | Ga0123356_10291935 | 3300010049 | Unclassified | 1731 |
| 49 | Ga0466657_011757 | 3300042582 | Bacteria | 1227 |
| 50 | JGI24705J35276_12236792 | 3300002504 | Bacteria | 8938 |
| 51 | CVPL010W_10002401 | 3300002931 | Bacteria | 21986 |
| 52 | CVPL010W_10007337 | 3300002931 | Bacteria | 10903 |
| 53 | CVPL010W_10030295 | 3300002931 | Bacteria | 3294 |
| 54 | Ga0074278_133899 | 3300005721 | Bacteria | 5768 |
| 55 | Ga0103264_1000034 | 3300007188 | Bacteria | 107523 |
| 56 | Ga0103264_1000343 | 3300007188 | Bacteria | 24982 |
| 57 | Ga0466708_283595 | 3300042652 | Bacteria | 1701 |
| 58 | Ga0466725_034132 | 3300042654 | Bacteria | 1629 |
| 59 | Ga0466725_278313 | 3300042654 | Bacteria | 4117 |
| 60 | Ga0466725_448472 | 3300042654 | Bacteria | 1205 |
| 61 | Ga0123356_10009690 | 3300010049 | Bacteria | 9501 |
| 62 | Ga0160469_107828 | 3300012824 | Bacteria | 999 |
| 63 | Ga0160435_1007837 | 3300012857 | Bacteria | 2318 |
| 64 | CVPL005W_1001202 | 3300002934 | Unclassified | 9730 |
| 65 | Ga0102736_1029980 | 3300007052 | Bacteria | 645 |
| 66 | Ga0102737_1005942 | 3300007142 | Bacteria | 2380 |
| 67 | Ga0103268_1008959 | 3300007192 | Unclassified | 2068 |
| 68 | Ga0466702_441458 | 3300042635 | Bacteria | 4759 |
| 69 | Ga0466725_114097 | 3300042654 | Bacteria | 1769 |
| 70 | Ga0123355_10983335 | 3300009826 | Bacteria | 899 |
| 71 | Ga0160467_100205 | 3300012829 | Bacteria | 76889 |
| 72 | Ga0309901_1000013 | 3300028918 | Bacteria | 346588 |
| 73 | Ga0466657_025114 | 3300042582 | Bacteria | 1036 |
| 74 | HBC_ctgsDRAFT_1017855 | 3300000333 | Bacteria | 1727 |
| 75 | CVPL010W_10002038 | 3300002931 | Unclassified | 23760 |
| 76 | Ga0102736_1038251 | 3300007052 | Bacteria | 584 |
| 77 | Ga0103261_1001538 | 3300007083 | Unclassified | 3688 |
| 78 | Ga0102740_1000052 | 3300007140 | Unclassified | 28114 |
| 79 | Ga0103264_1000075 | 3300007188 | Bacteria | 58837 |
| 80 | Ga0103264_1000546 | 3300007188 | Bacteria | 18699 |
| 81 | Ga0103264_1000816 | 3300007188 | Bacteria | 17956 |
| 82 | Ga0466724_52805 | 3300042649 | Bacteria | 2377 |
| 83 | Ga0466701_085380 | 3300042598 | Bacteria | 1273 |
| 84 | Ga0466716_015836 | 3300042605 | Bacteria | 9571 |
| 85 | Ga0123356_10157058 | 3300010049 | Bacteria | 2267 |
| 86 | Ga0466701_000081 | 3300042598 | Bacteria | 9300 |
| 87 | CVPL010W_10001028 | 3300002931 | Bacteria | 31984 |
| 88 | CVPL010W_10048888 | 3300002931 | Bacteria | 1049 |
| 89 | CVPL010L_1001083 | 3300002932 | Bacteria | 12930 |
| 90 | CVPL005W_1000693 | 3300002934 | Bacteria | 12181 |
| 91 | Ga0102739_1000718 | 3300007095 | Bacteria | 6117 |
| 92 | Ga0102739_1002855 | 3300007095 | Bacteria | 2604 |
| 93 | Ga0102740_1002039 | 3300007140 | Bacteria | 4807 |
| 94 | Ga0102737_1002319 | 3300007142 | Unclassified | 4778 |
| 95 | Ga0103264_1000169 | 3300007188 | Bacteria | 38203 |
| 96 | Ga0103264_1000615 | 3300007188 | Bacteria | 17142 |
| 97 | Ga0103264_1003031 | 3300007188 | Bacteria | 7672 |
| 98 | Ga0466725_056520 | 3300042654 | Bacteria | 1584 |
| 99 | Ga0123354_10219550 | 3300010882 | Bacteria | 2025 |
| 100 | Ga0160443_110111 | 3300012848 | Bacteria | 1092 |
| 101 | Ga0160436_1000258 | 3300012861 | Unclassified | 24660 |
| 102 | Ga0255572_1000001 | 3300026175 | Bacteria | 634207 |
| 103 | Ga0309904_1000008 | 3300029810 | Bacteria | 40239 |
| 104 | CVPL010W_10003439 | 3300002931 | Bacteria | 18149 |
| 105 | CVPL010L_1000171 | 3300002932 | Bacteria | 31497 |
| 106 | Ga0103261_1009786 | 3300007083 | Bacteria | 1341 |
| 107 | Ga0102739_1004466 | 3300007095 | Bacteria | 1972 |
| 108 | Ga0103260_1004422 | 3300007139 | Bacteria | 2148 |
| 109 | Ga0102737_1002193 | 3300007142 | Unclassified | 7842 |
| 110 | Ga0102737_1013674 | 3300007142 | Unclassified | 1313 |
| 111 | Ga0103264_1000090 | 3300007188 | Bacteria | 60653 |
| 112 | Ga0466703_053190 | 3300042636 | Bacteria | 54858 |
| 113 | Ga0466725_038809 | 3300042654 | Bacteria | 70980 |
| 114 | Ga0466725_363877 | 3300042654 | Bacteria | 2444 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042605 | Ga0466716_015836 | Ga0466716_015836_6392_6871 | 159 |
| 2 | 3300012852 | Ga0160430_100929 | Ga0160430_10092913 | 162 |
| 3 | 3300042654 | Ga0466725_034132 | Ga0466725_034132_1099_1590 | 163 |
| 4 | iso_pr_bacteria | 2883683260 | 2883683980 | 163 |
| 5 | iso_pr_bacteria | 2900354037 | 2900357208 | 163 |
| 6 | iso_pr_bacteria | 2900368070 | 2900368101 | 163 |
| 7 | 3300012857 | Ga0160435_1007837 | Ga0160435_10078372 | 164 |
| 8 | 3300012861 | Ga0160436_1000258 | Ga0160436_100025818 | 164 |
| 9 | iso_pr_bacteria | 2818991320 | 2819437070 | 164 |
| 10 | 3300012824 | Ga0160469_107828 | Ga0160469_1078282 | 167 |
| 11 | iso_pr_bacteria | 2695420964 | 2698253587 | 174 |
| 12 | 3300002932 | CVPL010L_1000015 | CVPL010L_100001573 | 175 |
| 13 | 3300007141 | Ga0102738_1000019 | Ga0102738_100001969 | 175 |
| 14 | iso_pr_bacteria | 2599185261 | 2599817861 | 175 |
| 15 | iso_pr_bacteria | 2687453754 | 2690041464 | 175 |
| 16 | iso_pr_bacteria | 2687453755 | 2690044597 | 175 |
| 17 | iso_pr_bacteria | 2687453756 | 2690045498 | 175 |
| 18 | iso_pr_bacteria | 2751185853 | 2753585986 | 175 |
| 19 | iso_pr_bacteria | 2751185856 | 2753591303 | 175 |
| 20 | iso_pr_bacteria | 2751185858 | 2753595128 | 175 |
| 21 | iso_pr_bacteria | 2820142992 | 2820143084 | 175 |
| 22 | iso_pr_bacteria | 2864993140 | 2864996095 | 175 |
| 23 | iso_pr_bacteria | 2873468275 | 2873471047 | 175 |
| 24 | iso_pr_bacteria | 2938192669 | 2938194260 | 175 |
| 25 | iso_pr_bacteria | 8068941587 | 8068941837 | 175 |
| 26 | iso_pr_bacteria | 8068944069 | 8068944936 | 175 |
| 27 | iso_pr_bacteria | 8068946563 | 8068947433 | 175 |
| 28 | iso_pr_bacteria | 8068950955 | 8068951337 | 175 |
| 29 | iso_pr_bacteria | 8068953321 | 8068954652 | 175 |
| 30 | iso_pr_bacteria | 8068955631 | 8068956930 | 175 |
| 31 | iso_pr_bacteria | 8073617375 | 8073618864 | 175 |
| 32 | iso_pr_bacteria | 8073619611 | 8073620492 | 175 |
| 33 | iso_pr_bacteria | 8073621894 | 8073622260 | 175 |
| 34 | iso_pr_bacteria | 8073624232 | 8073625518 | 175 |
| 35 | iso_pr_bacteria | 8073626464 | 8073626634 | 175 |
| 36 | iso_pr_bacteria | 8073628750 | 8073630077 | 175 |
| 37 | iso_pr_bacteria | 8082291289 | 8082291627 | 175 |
| 38 | 3300000036 | IMNBGM34_c000015 | IMNBGM34_00001519 | 176 |
| 39 | 3300005721 | Ga0074278_133899 | Ga0074278_1338993 | 176 |
| 40 | 3300005721 | Ga0074278_138880 | Ga0074278_1388807 | 176 |
| 41 | 3300007188 | Ga0103264_1000615 | Ga0103264_100061518 | 176 |
| 42 | 3300007188 | Ga0103264_1000816 | Ga0103264_100081618 | 176 |
| 43 | 3300007192 | Ga0103268_1046950 | Ga0103268_10469502 | 176 |
| 44 | 3300010049 | Ga0123356_10009690 | Ga0123356_100096904 | 176 |
| 45 | 3300042582 | Ga0466657_025114 | Ga0466657_025114_395_925 | 176 |
| 46 | 3300042636 | Ga0466703_053190 | Ga0466703_053190_30688_31218 | 176 |
| 47 | 3300042654 | Ga0466725_056520 | Ga0466725_056520_262_792 | 176 |
| 48 | iso_pr_bacteria | 2603880170 | 2606030318 | 176 |
| 49 | iso_pr_bacteria | 2687453742 | 2689987765 | 176 |
| 50 | iso_pr_bacteria | 2855798354 | 2855802230 | 176 |
| 51 | iso_pr_bacteria | 2900132049 | 2900132311 | 176 |
| 52 | iso_pr_bacteria | 8067483258 | 8067485602 | 176 |
| 53 | 3300000333 | HBC_ctgsDRAFT_1017855 | HBC_ctgsDRAFT_10178553 | 177 |
| 54 | 3300002504 | JGI24705J35276_12236792 | JGI24705J35276_122367923 | 177 |
| 55 | 3300002931 | CVPL010W_10001028 | CVPL010W_100010289 | 177 |
| 56 | 3300002931 | CVPL010W_10003439 | CVPL010W_100034398 | 177 |
| 57 | 3300002931 | CVPL010W_10048888 | CVPL010W_100488881 | 177 |
| 58 | 3300002934 | CVPL005W_1000069 | CVPL005W_100006928 | 177 |
| 59 | 3300002934 | CVPL005W_1001202 | CVPL005W_100120210 | 177 |
| 60 | 3300002938 | CVPL005L_10000357 | CVPL005L_100003577 | 177 |
| 61 | 3300007052 | Ga0102736_1029980 | Ga0102736_10299802 | 177 |
| 62 | 3300007083 | Ga0103261_1009786 | Ga0103261_10097862 | 177 |
| 63 | 3300007083 | Ga0103261_1010387 | Ga0103261_10103872 | 177 |
| 64 | 3300007129 | Ga0102734_1008094 | Ga0102734_10080945 | 177 |
| 65 | 3300007139 | Ga0103260_1004422 | Ga0103260_10044224 | 177 |
| 66 | 3300007139 | Ga0103260_1038175 | Ga0103260_10381751 | 177 |
| 67 | 3300007142 | Ga0102737_1000174 | Ga0102737_100017411 | 177 |
| 68 | 3300007142 | Ga0102737_1005942 | Ga0102737_10059422 | 177 |
| 69 | 3300007188 | Ga0103264_1000075 | Ga0103264_100007551 | 177 |
| 70 | 3300007188 | Ga0103264_1000253 | Ga0103264_10002535 | 177 |
| 71 | 3300007188 | Ga0103264_1000546 | Ga0103264_100054613 | 177 |
| 72 | 3300029809 | Ga0309903_100001 | Ga0309903_10000141 | 177 |
| 73 | 3300029810 | Ga0309904_1000008 | Ga0309904_100000828 | 177 |
| 74 | 3300042582 | Ga0466657_148407 | Ga0466657_148407_12161_12694 | 177 |
| 75 | 3300042582 | Ga0466657_266916 | Ga0466657_266916_5590_6123 | 177 |
| 76 | 3300042598 | Ga0466701_000081 | Ga0466701_000081_4093_4626 | 177 |
| 77 | 3300042649 | Ga0466724_47083 | Ga0466724_47083_21637_22170 | 177 |
| 78 | 3300042654 | Ga0466725_029360 | Ga0466725_029360_3715_4248 | 177 |
| 79 | 3300042654 | Ga0466725_278313 | Ga0466725_278313_525_1058 | 177 |
| 80 | 3300042654 | Ga0466725_363877 | Ga0466725_363877_1862_2395 | 177 |
| 81 | iso_pr_bacteria | 2556921669 | 2558280774 | 177 |
| 82 | iso_pr_bacteria | 2603880165 | 2606013498 | 177 |
| 83 | iso_pr_bacteria | 2681813507 | 2684382793 | 177 |
| 84 | iso_pr_bacteria | 650716016 | 651012153 | 177 |
| 85 | 3300002504 | JGI24705J35276_12232809 | JGI24705J35276_122328092 | 178 |
| 86 | 3300002931 | CVPL010W_10007337 | CVPL010W_100073374 | 178 |
| 87 | 3300007052 | Ga0102736_1005376 | Ga0102736_10053764 | 178 |
| 88 | 3300007052 | Ga0102736_1038251 | Ga0102736_10382511 | 178 |
| 89 | 3300007067 | Ga0103266_1000481 | Ga0103266_10004816 | 178 |
| 90 | 3300007068 | Ga0103265_1003016 | Ga0103265_10030164 | 178 |
| 91 | 3300007083 | Ga0103261_1001538 | Ga0103261_10015384 | 178 |
| 92 | 3300007095 | Ga0102739_1000718 | Ga0102739_10007183 | 178 |
| 93 | 3300007139 | Ga0103260_1002813 | Ga0103260_10028132 | 178 |
| 94 | 3300007142 | Ga0102737_1002193 | Ga0102737_10021932 | 178 |
| 95 | 3300007142 | Ga0102737_1013674 | Ga0102737_10136742 | 178 |
| 96 | 3300007188 | Ga0103264_1000034 | Ga0103264_1000034103 | 178 |
| 97 | 3300007188 | Ga0103264_1002070 | Ga0103264_100207015 | 178 |
| 98 | 3300012814 | Ga0160453_100109 | Ga0160453_10010912 | 178 |
| 99 | 3300012820 | Ga0160456_100224 | Ga0160456_10022411 | 178 |
| 100 | 3300012829 | Ga0160467_100205 | Ga0160467_10020510 | 178 |
| 101 | 3300012831 | Ga0160459_104614 | Ga0160459_1046142 | 178 |
| 102 | 3300012837 | Ga0160455_100002 | Ga0160455_100002634 | 178 |
| 103 | 3300012857 | Ga0160435_1021970 | Ga0160435_10219702 | 178 |
| 104 | 3300026175 | Ga0255572_1000001 | Ga0255572_1000001110 | 178 |
| 105 | 3300028918 | Ga0309901_1000013 | Ga0309901_1000013231 | 178 |
| 106 | 3300042598 | Ga0466701_082471 | Ga0466701_082471_35121_35657 | 178 |
| 107 | 3300042598 | Ga0466701_085380 | Ga0466701_085380_247_783 | 178 |
| 108 | 3300002931 | CVPL010W_10002038 | CVPL010W_100020381 | 179 |
| 109 | 3300002932 | CVPL010L_1000171 | CVPL010L_10001719 | 179 |
| 110 | 3300002932 | CVPL010L_1001083 | CVPL010L_100108317 | 179 |
| 111 | 3300002934 | CVPL005W_1000372 | CVPL005W_10003724 | 179 |
| 112 | 3300007067 | Ga0103266_1000035 | Ga0103266_100003540 | 179 |
| 113 | 3300007095 | Ga0102739_1002855 | Ga0102739_10028555 | 179 |
| 114 | 3300007095 | Ga0102739_1004466 | Ga0102739_10044664 | 179 |
| 115 | 3300007129 | Ga0102734_1001375 | Ga0102734_10013756 | 179 |
| 116 | 3300007141 | Ga0102738_1000159 | Ga0102738_100015913 | 179 |
| 117 | 3300007188 | Ga0103264_1000090 | Ga0103264_100009016 | 179 |
| 118 | 3300007188 | Ga0103264_1000343 | Ga0103264_10003432 | 179 |
| 119 | 3300007188 | Ga0103264_1003031 | Ga0103264_10030315 | 179 |
| 120 | 3300007188 | Ga0103264_1045163 | Ga0103264_10451632 | 179 |
| 121 | 3300009460 | Ga0127649_101884 | Ga0127649_101884101 | 179 |
| 122 | 3300010049 | Ga0123356_10157058 | Ga0123356_101570582 | 179 |
| 123 | 3300010882 | Ga0123354_10219550 | Ga0123354_102195502 | 179 |
| 124 | 3300010882 | Ga0123354_10646116 | Ga0123354_106461161 | 179 |
| 125 | 3300012825 | Ga0160441_106703 | Ga0160441_1067032 | 179 |
| 126 | 3300012848 | Ga0160443_110111 | Ga0160443_1101112 | 179 |
| 127 | 3300012852 | Ga0160430_104020 | Ga0160430_1040202 | 179 |
| 128 | 3300042582 | Ga0466657_011757 | Ga0466657_011757_356_895 | 179 |
| 129 | 3300042582 | Ga0466657_143038 | Ga0466657_143038_280_819 | 179 |
| 130 | 3300042654 | Ga0466725_114097 | Ga0466725_114097_593_1132 | 179 |
| 131 | iso_pr_bacteria | 2864755708 | 2864759834 | 179 |
| 132 | iso_pr_bacteria | 2864968865 | 2864970912 | 179 |
| 133 | iso_pr_bacteria | 3006190525 | 3006192779 | 179 |
| 134 | 3300002931 | CVPL010W_10002401 | CVPL010W_1000240116 | 180 |
| 135 | 3300002934 | CVPL005W_1000693 | CVPL005W_10006939 | 180 |
| 136 | 3300007052 | Ga0102736_1006139 | Ga0102736_10061392 | 180 |
| 137 | 3300007140 | Ga0102740_1002039 | Ga0102740_10020393 | 180 |
| 138 | 3300007188 | Ga0103264_1000169 | Ga0103264_100016925 | 180 |
| 139 | 3300009826 | Ga0123355_10983335 | Ga0123355_109833351 | 180 |
| 140 | 3300010049 | Ga0123356_10291935 | Ga0123356_102919352 | 180 |
| 141 | 3300042623 | Ga0466734_100746 | Ga0466734_100746_6333_6875 | 180 |
| 142 | 3300042649 | Ga0466724_52805 | Ga0466724_52805_1690_2232 | 180 |
| 143 | 3300042654 | Ga0466725_448472 | Ga0466725_448472_134_676 | 180 |
| 144 | iso_pr_bacteria | 2687453753 | 2690038512 | 180 |
| 145 | iso_pr_bacteria | 2864937364 | 2864942553 | 180 |
| 146 | 3300007080 | Ga0102735_1025226 | Ga0102735_10252262 | 181 |
| 147 | 3300007140 | Ga0102740_1000052 | Ga0102740_100005210 | 181 |
| 148 | 3300007141 | Ga0102738_1002110 | Ga0102738_10021106 | 181 |
| 149 | 3300007142 | Ga0102737_1002319 | Ga0102737_10023199 | 181 |
| 150 | 3300007188 | Ga0103264_1000812 | Ga0103264_100081216 | 181 |
| 151 | 3300007192 | Ga0103268_1008959 | Ga0103268_10089594 | 181 |
| 152 | 3300007188 | Ga0103264_1000917 | Ga0103264_10009173 | 182 |
| 153 | 3300042635 | Ga0466702_441458 | Ga0466702_441458_1559_2107 | 182 |
| 154 | 3300042652 | Ga0466708_283595 | Ga0466708_283595_438_986 | 182 |
| 155 | 3300042654 | Ga0466725_038809 | Ga0466725_038809_40973_41521 | 182 |
| 156 | iso_pr_bacteria | 2873562573 | 2873563267 | 182 |
| 157 | iso_pr_bacteria | 2963630348 | 2963633658 | 182 |
| 158 | iso_pr_bacteria | 2562617066 | 2562865680 | 183 |
| 159 | iso_pr_bacteria | 2832201259 | 2832202629 | 183 |
| 160 | 3300007188 | Ga0103264_1002868 | Ga0103264_10028688 | 184 |
| 161 | iso_pr_bacteria | 2648501856 | 2651561103 | 184 |
| 162 | iso_pr_bacteria | 2603880172 | 2606034532 | 190 |
| 163 | 3300002931 | CVPL010W_10030295 | CVPL010W_100302952 | 191 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00719 | Pyrophosphatase | Inorganic pyrophosphatase | 18 | 174 | 0.98 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.89 | 0.93 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.