Protein Family IF00974
Metagenome
Isolate
322
Members
240
Samples
134
Scaffolds
403.37
Avg Length
Representative Sequence
- ID
- 3300002931|CVPL010W_10013425|CVPL010W_100134252
- Length
- 458 aa
- Sequence
- MFGAIVKHGNTADRPKPQMPTARRLVQCTWMRAVRYDNGLYRSPTRADALRIPHPLQPPARCCHDAMMISSLLDTDLYKFSMMQVVLHHFPAAQVEYRYKCRTPGVNLSPYLDEIRAEIHALCQLRFTEAELDYLGGLRFIKSDFVDFLRLFHLPERCIQITHSAQPGELDIRVRGSWLHTILFEIPVLAIVNEVYFRNVCPNPDWAEGRERLQTKMQLVTDDPALADFRVADYGTRRRFSRQWHEEVLMTLQRQMGKHLAGTSNVWLAMRYGMTPLGTMAHEYLQACQALGPRLRDSQVYAFEVWAKEYRGDLGIALSDVYGLDAFLRDFDMYFCKLFDGARHDSGDPFEWGERLLAHYHQNRVDPRNKTLIFSDGLTIPRAIGLAKHFARRCKVAFGIGTNLTNDLGHEPLQIVMKMVACNGQPVAKVSDAPEKTMCDDAAYLAYLRQVFQLPPT*
Sample Types
Isolate
58.4%
Metagenome
41.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Coreidae
33.6%
Apidae
28.6%
Formicidae
6.3%
Elmidae
5.9%
Kalotermitidae
4.6%
Unclassified
4.6%
Culicidae
3.4%
Termitidae
2.9%
Curculionidae
1.7%
Termopsidae
1.7%
Berytidae
0.8%
Rhinotermitidae
0.8%
Alydidae
0.8%
Largidae
0.8%
Drosophilidae
0.8%
Noctuidae
0.4%
Crambidae
0.4%
Pediculidae
0.4%
Aphelinidae
0.4%
Armadillidiidae
0.4%
Cixiidae
0.4%
Taxonomy
Archaea
0
Bacteria
307
Eukaryota
0
Viruses
0
Unclassified
15
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2834412944 | Snodgrassella alvi A-5-24 | Isolate | Apidae |
| 2 | 2834415282 | Snodgrassella alvi Occ4-2 | Isolate | Apidae |
| 3 | 2846359427 | Snodgrassella alvi wkB273 | Isolate | Apidae |
| 4 | 2857825141 | Snodgrassella alvi wkB332 | Isolate | Apidae |
| 5 | 2857830159 | Snodgrassella alvi A-9-24 | Isolate | Apidae |
| 6 | 2864804954 | Acinetobacter johnsonii S00050 | Isolate | Elmidae |
| 7 | 2864914039 | Chromobacterium alkanivorans S00172 | Isolate | Elmidae |
| 8 | 2864973726 | Acinetobacter schindleri S00243 | Isolate | Elmidae |
| 9 | 2864988360 | Chromobacterium alkanivorans S00296 | Isolate | Elmidae |
| 10 | 2868464004 | Snodgrassella alvi Pens2-2-5 | Isolate | Apidae |
| 11 | 3006190525 | Acinetobacter sp. S54 | Isolate | Curculionidae |
| 12 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 13 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 14 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 15 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 16 | 8023724303 | Caballeronia zhejiangensis LP003 | Isolate | Coreidae |
| 17 | 8024001094 | Caballeronia sp. TF1N1 | Isolate | Berytidae |
| 18 | 8025666332 | Caballeronia grimmiae LZ050 | Isolate | Coreidae |
| 19 | 8025694439 | Caballeronia cordobensis LZ033 | Isolate | Coreidae |
| 20 | 8025701579 | Caballeronia telluris LZ031 | Isolate | Coreidae |
| 21 | 8101258116 | Snodgrassella sp. M0112 | Isolate | Apidae |
| 22 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 23 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 24 | 8102041249 | Caballeronia sp. GACF4 | Isolate | Coreidae |
| 25 | 8102087471 | Caballeronia sp. GAWG2-1 | Isolate | Coreidae |
| 26 | 8102201977 | Caballeronia sp. LZ031 | Isolate | Coreidae |
| 27 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
| 28 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 29 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 30 | 2531839311 | Acinetobacter sp. HA | Isolate | Noctuidae |
| 31 | 2571042003 | Stenoxybacter acetivorans DSM 19021 | Isolate | Rhinotermitidae |
| 32 | 2585427851 | Snodgrassella alvi wkB29 | Isolate | Apidae |
| 33 | 2597489944 | Caballeronia insecticola RPE64 | Isolate | Alydidae |
| 34 | 2846373876 | Snodgrassella alvi Gris1-3 | Isolate | Apidae |
| 35 | 2848751009 | Snodgrassella alvi App2-2 | Isolate | Apidae |
| 36 | 2849411303 | Snodgrassella alvi A3 | Isolate | Apidae |
| 37 | 2854084220 | Snodgrassella alvi Snod2-1-5 | Isolate | Apidae |
| 38 | 2854093395 | Snodgrassella alvi N-S5 | Isolate | Apidae |
| 39 | 2854102457 | Snodgrassella alvi Gris1-6 | Isolate | Apidae |
| 40 | 2855798354 | Achromobacter insolitus AR476-2 | Isolate | Crambidae |
| 41 | 2857835046 | Snodgrassella alvi wkB9 | Isolate | Apidae |
| 42 | 2857845033 | Snodgrassella alvi WF3-3 | Isolate | Apidae |
| 43 | 3003878002 | Paraburkholderia sp. PGU19 | Isolate | Largidae |
| 44 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 45 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 46 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 47 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 48 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 49 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 50 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 51 | 8023752828 | Caballeronia grimmiae LZ062 | Isolate | Coreidae |
| 52 | 8024019580 | Caballeronia sp. Lep1P3 | Isolate | Coreidae |
| 53 | 8024031916 | Cupriavidus pauculus BHJ32i | Isolate | Alydidae |
| 54 | 8024044713 | Caballeronia sp. Sq4a | Isolate | Coreidae |
| 55 | 8069763219 | Caballeronia sp. LZ008 | Isolate | Coreidae |
| 56 | 8100449422 | Delftia sp. S66 | Isolate | Curculionidae |
| 57 | 8101274435 | Snodgrassella sp. W8134 | Isolate | Apidae |
| 58 | 8101276651 | Snodgrassella sp. W8135 | Isolate | Apidae |
| 59 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 60 | 8102169119 | Caballeronia sp. LZ016 | Isolate | Coreidae |
| 61 | 8102181083 | Caballeronia sp. LZ025 | Isolate | Coreidae |
| 62 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
| 63 | 2585427850 | Snodgrassella alvi wkB12 | Isolate | Apidae |
| 64 | 2811994808 | Snodgrassella alvi Sa_196 v2 | Isolate | Unclassified |
| 65 | 2841821538 | Psychrobacter sp. YP14 | Isolate | Unclassified |
| 66 | 2846361553 | Snodgrassella alvi PEB0171 | Isolate | Apidae |
| 67 | 2849417936 | Snodgrassella alvi N9 | Isolate | Apidae |
| 68 | 2852205774 | Snodgrassella alvi ESL0196 | Isolate | Apidae |
| 69 | 2854086477 | Snodgrassella alvi N-S3 | Isolate | Apidae |
| 70 | 2854097802 | Snodgrassella alvi Aw-18 | Isolate | Apidae |
| 71 | 2864843793 | Acinetobacter johnsonii S00075 | Isolate | Elmidae |
| 72 | 2864870719 | Comamonas odontotermitis S00124 | Isolate | Elmidae |
| 73 | 2864937364 | Acidovorax soli S00198 | Isolate | Elmidae |
| 74 | 2963630348 | Burkholderiales bacterium 3487_49 | Isolate | Formicidae |
| 75 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 76 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 77 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 78 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 79 | 641522603 | Acinetobacter baumannii SDF | Isolate | Pediculidae |
| 80 | 8025650824 | Caballeronia hypogeia LZ032 | Isolate | Coreidae |
| 81 | 8025671076 | Caballeronia cordobensis LZ034LL | Isolate | Coreidae |
| 82 | 8025735396 | Caballeronia zhejiangensis LZ016 | Isolate | Coreidae |
| 83 | 8101265296 | Snodgrassella sp. W8158 | Isolate | Apidae |
| 84 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 85 | 8102074813 | Caballeronia sp. GAWG1-1 | Isolate | Coreidae |
| 86 | 8102081745 | Caballeronia sp. GAWG1-5s-s | Isolate | Coreidae |
| 87 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 88 | 8102131453 | Caballeronia sp. INML5 | Isolate | Coreidae |
| 89 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 90 | 8102216467 | Caballeronia sp. LZ033 | Isolate | Coreidae |
| 91 | 8102230706 | Caballeronia sp. LZ035 | Isolate | Coreidae |
| 92 | 8102239244 | Caballeronia sp. LZ043 | Isolate | Coreidae |
| 93 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 94 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 95 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 96 | 8119099601 | Snodgrassella alvi wkB2 | Isolate | Apidae |
| 97 | 2585428136 | Snodgrassella alvi wkB2 | Isolate | Apidae |
| 98 | 2854100132 | Snodgrassella alvi A-2-12 | Isolate | Apidae |
| 99 | 2857827427 | Snodgrassella alvi App6-4 | Isolate | Apidae |
| 100 | 2857832487 | Snodgrassella alvi HK9x | Isolate | Apidae |
| 101 | 3300000475 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-J21 | Metagenome | Apidae |
| 102 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 103 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 104 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 105 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 106 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 107 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 108 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 109 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 110 | 8021899934 | Acinetobacter sp. AR2-3 | Isolate | Culicidae |
| 111 | 8025716094 | Caballeronia zhejiangensis LZ028 | Isolate | Coreidae |
| 112 | 8101270055 | Snodgrassella sp. W8124 | Isolate | Apidae |
| 113 | 8101278866 | Snodgrassella sp. W6238H11 | Isolate | Apidae |
| 114 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 115 | 8101988189 | Caballeronia sp. ATUFL_F1_KS4A | Isolate | Coreidae |
| 116 | 8102014801 | Caballeronia sp. ATUFL_M2_KS44 | Isolate | Coreidae |
| 117 | 8102060671 | Caballeronia sp. GAFFF2 | Isolate | Coreidae |
| 118 | 8102152052 | Caballeronia sp. LZ001 | Isolate | Coreidae |
| 119 | 8102208438 | Caballeronia sp. LZ032 | Isolate | Coreidae |
| 120 | 8102251710 | Caballeronia sp. LZ065 | Isolate | Coreidae |
| 121 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
| 122 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 123 | 2684622927 | Snodgrassella alvi Sa_196 | Isolate | Unclassified |
| 124 | 2687453753 | Burkholderiales bacterium B_Cag25 | Isolate | Unclassified |
| 125 | 2837563510 | Snodgrassella alvi N-S1 | Isolate | Apidae |
| 126 | 2838140227 | Dyella sp. OAE510 | Isolate | Unclassified |
| 127 | 2843299038 | Snodgrassella alvi N-S2 | Isolate | Apidae |
| 128 | 2846368606 | Snodgrassella alvi A-11-12 | Isolate | Apidae |
| 129 | 2854088767 | Snodgrassella alvi MS1-3 | Isolate | Apidae |
| 130 | 2854104879 | Snodgrassella alvi Fer2-2 | Isolate | Apidae |
| 131 | 2857840086 | Snodgrassella alvi Aw-20 | Isolate | Apidae |
| 132 | 2868461634 | Snodgrassella alvi Gris2-3-4 | Isolate | Apidae |
| 133 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 134 | 3300007078 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 4 gut | Metagenome | Drosophilidae |
| 135 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 136 | 8024014383 | Caballeronia sp. SL2Y3 | Isolate | Berytidae |
| 137 | 8025740903 | Caballeronia zhejiangensis LZ008 | Isolate | Coreidae |
| 138 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 139 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 140 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 141 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 142 | 8102145433 | Caballeronia sp. LP006 | Isolate | Coreidae |
| 143 | 8102186987 | Caballeronia sp. LZ028 | Isolate | Coreidae |
| 144 | 8102223607 | Caballeronia sp. LZ034LL | Isolate | Coreidae |
| 145 | 8102286609 | Caballeronia sp. NCTM5 | Isolate | Coreidae |
| 146 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 147 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 148 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 149 | 2687453742 | Burkholderiales bacterium B_Cag20 | Isolate | Unclassified |
| 150 | 2846376288 | Snodgrassella alvi Fer4-2 | Isolate | Apidae |
| 151 | 2846379220 | Snodgrassella alvi wkB237 | Isolate | Apidae |
| 152 | 2849399727 | Snodgrassella alvi Fer1-2 | Isolate | Apidae |
| 153 | 2849402121 | Snodgrassella alvi A-10-12 | Isolate | Apidae |
| 154 | 2849409164 | Snodgrassella alvi wkB298 | Isolate | Apidae |
| 155 | 2849413536 | Snodgrassella alvi N-S4 | Isolate | Apidae |
| 156 | 2854091108 | Snodgrassella alvi wkB339 | Isolate | Apidae |
| 157 | 2854095577 | Snodgrassella alvi A12 | Isolate | Apidae |
| 158 | 2857837414 | Snodgrassella alvi App4-8 | Isolate | Apidae |
| 159 | 2864859030 | Chromobacterium alkanivorans S00115 | Isolate | Elmidae |
| 160 | 2864874997 | Acinetobacter lwoffii S00127 | Isolate | Elmidae |
| 161 | 2864960361 | Comamonas odontotermitis S00229 | Isolate | Elmidae |
| 162 | 2868169047 | Comamonas aquatica S00077 | Isolate | Elmidae |
| 163 | 3300003131 | Encarsia pergandiella symbiont microbial communities from Weslaco, Texas | Metagenome | Aphelinidae |
| 164 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 165 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 166 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 167 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 168 | 8023757577 | Caballeronia peredens LP006 | Isolate | Coreidae |
| 169 | 8023764196 | Caballeronia peredens LZ001 | Isolate | Coreidae |
| 170 | 8025678175 | Caballeronia hypogeia LZ043 | Isolate | Coreidae |
| 171 | 8025728939 | Caballeronia telluris LZ024 | Isolate | Coreidae |
| 172 | 8025747911 | Caballeronia peredens LZ003 | Isolate | Coreidae |
| 173 | 8069755105 | Caballeronia sp. LZ003 | Isolate | Coreidae |
| 174 | 8069775773 | Caballeronia sp. LZ062 | Isolate | Coreidae |
| 175 | 8100461708 | Delftia sp. S65 | Isolate | Curculionidae |
| 176 | 8101272231 | Snodgrassella sp. W8132 | Isolate | Apidae |
| 177 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 178 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 179 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 180 | 8102020860 | Caballeronia sp. AZ10_KS36 | Isolate | Coreidae |
| 181 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 182 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
| 183 | 2603880165 | Burkholderiales A1 | Isolate | Unclassified |
| 184 | 2603880170 | Burkholderiales A2 | Isolate | Unclassified |
| 185 | 2603880172 | Burkholderiales C | Isolate | Unclassified |
| 186 | 2617270844 | Dyella sp. HyOG | Isolate | Cixiidae |
| 187 | 2840748007 | Snodgrassella alvi A-1-12 | Isolate | Apidae |
| 188 | 2843301220 | Snodgrassella alvi Nev4-2 | Isolate | Apidae |
| 189 | 2846363972 | Snodgrassella alvi N-W7 | Isolate | Apidae |
| 190 | 2849406737 | Snodgrassella alvi PEB0178 | Isolate | Apidae |
| 191 | 2849415715 | Snodgrassella alvi A2 | Isolate | Apidae |
| 192 | 2857822956 | Snodgrassella alvi N-W4 | Isolate | Apidae |
| 193 | 2864840607 | Acinetobacter johnsonii S00071 | Isolate | Elmidae |
| 194 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 195 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 196 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 197 | 8025658853 | Caballeronia temeraria LZ065 | Isolate | Coreidae |
| 198 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 199 | 8069770227 | Caballeronia sp. LZ019 | Isolate | Coreidae |
| 200 | 8101263066 | Snodgrassella sp. M0351 | Isolate | Apidae |
| 201 | 8101994502 | Caballeronia sp. ATUFL_F2_KS42 | Isolate | Coreidae |
| 202 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 203 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 204 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
| 205 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 206 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 207 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 208 | 2837560943 | Snodgrassella alvi HK3 | Isolate | Apidae |
| 209 | 2840743474 | Snodgrassella alvi N-23 | Isolate | Apidae |
| 210 | 2846366200 | Snodgrassella alvi Gris3-4 | Isolate | Apidae |
| 211 | 2846370940 | Snodgrassella alvi Nev3CBA3 | Isolate | Apidae |
| 212 | 2857842411 | Snodgrassella alvi Ruf1-X | Isolate | Apidae |
| 213 | 2864755708 | Massilia timonae S00006 | Isolate | Elmidae |
| 214 | 2864863795 | Acinetobacter johnsonii S00116 | Isolate | Elmidae |
| 215 | 3003178663 | Psychrobacter fulvigenes KC-40 | Isolate | Unclassified |
| 216 | 3003869270 | Paraburkholderia sp. PGU16 | Isolate | Largidae |
| 217 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 218 | 3300000471 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-O11 | Metagenome | Apidae |
| 219 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 220 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 221 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 222 | 8023747282 | Caballeronia zhejiangensis LZ019 | Isolate | Coreidae |
| 223 | 8024025509 | Caballeronia grimmiae Lep1A1 | Isolate | Coreidae |
| 224 | 8024037630 | Caballeronia zhejiangensis A33_M4_a | Isolate | Coreidae |
| 225 | 8025685901 | Caballeronia fortuita LZ035 | Isolate | Coreidae |
| 226 | 8025723035 | Caballeronia grimmiae LZ025 | Isolate | Coreidae |
| 227 | 8025756023 | Caballeronia peredens LZ002 | Isolate | Coreidae |
| 228 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 229 | 8100455565 | Delftia sp. S67 | Isolate | Curculionidae |
| 230 | 8101255641 | Snodgrassella sp. M0110 | Isolate | Apidae |
| 231 | 8101260589 | Snodgrassella sp. M0118 | Isolate | Apidae |
| 232 | 8101267702 | Snodgrassella sp. W6238H14 | Isolate | Apidae |
| 233 | 8102054868 | Caballeronia sp. GAFFF1 | Isolate | Coreidae |
| 234 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 235 | 8102161003 | Caballeronia sp. LZ002 | Isolate | Coreidae |
| 236 | 8102174626 | Caballeronia sp. LZ024 | Isolate | Coreidae |
| 237 | 8102246966 | Caballeronia sp. LZ050 | Isolate | Coreidae |
| 238 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 239 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 240 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_184825 | 3300042612 | Bacteria | 10468 |
| 2 | CVPL010W_10011744 | 3300002931 | Bacteria | 7385 |
| 3 | CVPL010W_10021613 | 3300002931 | Unclassified | 3542 |
| 4 | Ga0102736_1001042 | 3300007052 | Bacteria | 7630 |
| 5 | Ga0102737_1000084 | 3300007142 | Unclassified | 28806 |
| 6 | Ga0103264_1000020 | 3300007188 | Bacteria | 106161 |
| 7 | Ga0103264_1000450 | 3300007188 | Bacteria | 21293 |
| 8 | Ga0103264_1001063 | 3300007188 | Bacteria | 12201 |
| 9 | Ga0103264_1001817 | 3300007188 | Bacteria | 9825 |
| 10 | Ga0466711_088144 | 3300042615 | Bacteria | 25974 |
| 11 | Ga0466715_141778 | 3300042616 | Bacteria | 12990 |
| 12 | Ga0466715_214294 | 3300042616 | Bacteria | 15234 |
| 13 | Ga0466723_147990 | 3300042618 | Bacteria | 45924 |
| 14 | Ga0466726_385365 | 3300042619 | Bacteria | 19081 |
| 15 | Ga0123354_10048977 | 3300010882 | Bacteria | 6414 |
| 16 | Ga0466734_073443 | 3300042623 | Bacteria | 13776 |
| 17 | Ga0466730_065228 | 3300042625 | Bacteria | 49177 |
| 18 | Ga0160470_101628 | 3300012813 | Unclassified | 5177 |
| 19 | Ga0160432_100513 | 3300012818 | Unclassified | 24262 |
| 20 | Ga0466701_001180 | 3300042598 | Bacteria | 1683 |
| 21 | Ga0466701_018128 | 3300042598 | Bacteria | 118598 |
| 22 | Ga0466716_235143 | 3300042605 | Bacteria | 1425 |
| 23 | Ga0068302_10138275 | 3300005071 | Bacteria | 5556 |
| 24 | Ga0103261_1002565 | 3300007083 | Bacteria | 4656 |
| 25 | Ga0102734_1003177 | 3300007129 | Bacteria | 3750 |
| 26 | Ga0103260_1000583 | 3300007139 | Bacteria | 6955 |
| 27 | Ga0102737_1000475 | 3300007142 | Bacteria | 13087 |
| 28 | Ga0466711_073315 | 3300042615 | Bacteria | 1798 |
| 29 | Ga0466711_413562 | 3300042615 | Bacteria | 3529 |
| 30 | Ga0466730_085631 | 3300042625 | Bacteria | 48091 |
| 31 | Ga0466724_31866 | 3300042649 | Bacteria | 155267 |
| 32 | Ga0466708_072239 | 3300042652 | Bacteria | 14259 |
| 33 | Ga0466708_134832 | 3300042652 | Bacteria | 22190 |
| 34 | Ga0466708_219312 | 3300042652 | Bacteria | 32233 |
| 35 | Ga0466708_447105 | 3300042652 | Bacteria | 3118 |
| 36 | Ga0466727_319896 | 3300042655 | Bacteria | 1248 |
| 37 | Ga0466701_008332 | 3300042598 | Bacteria | 48418 |
| 38 | SCG598J21_12956 | 3300000475 | Bacteria | 195512 |
| 39 | CVPL005L_10002326 | 3300002938 | Bacteria | 21790 |
| 40 | Ga0103264_1000256 | 3300007188 | Bacteria | 30086 |
| 41 | Ga0466711_031361 | 3300042615 | Bacteria | 14182 |
| 42 | Ga0466711_517240 | 3300042615 | Unclassified | 18161 |
| 43 | Ga0466715_388813 | 3300042616 | Bacteria | 5981 |
| 44 | Ga0466723_198634 | 3300042618 | Bacteria | 1857 |
| 45 | Ga0466723_363740 | 3300042618 | Bacteria | 4701 |
| 46 | Ga0466691_106629 | 3300042593 | Bacteria | 8830 |
| 47 | Ga0466701_101243 | 3300042598 | Bacteria | 7155 |
| 48 | Ga0466722_182673 | 3300042609 | Bacteria | 7227 |
| 49 | Ga0466705_347516 | 3300042612 | Bacteria | 1900 |
| 50 | CVPL005W_1000001 | 3300002934 | Bacteria | 147007 |
| 51 | Ga0052165_100900 | 3300003131 | Bacteria | 2493 |
| 52 | Ga0102734_1015492 | 3300007129 | Bacteria | 1844 |
| 53 | Ga0102738_1000145 | 3300007141 | Bacteria | 20236 |
| 54 | Ga0466715_143205 | 3300042616 | Bacteria | 113538 |
| 55 | Ga0466730_060188 | 3300042625 | Bacteria | 807184 |
| 56 | Ga0466730_092809 | 3300042625 | Bacteria | 164860 |
| 57 | Ga0466708_318873 | 3300042652 | Bacteria | 31194 |
| 58 | Ga0160459_100570 | 3300012831 | Unclassified | 13569 |
| 59 | Ga0466701_021547 | 3300042598 | Bacteria | 156093 |
| 60 | Ga0466701_069147 | 3300042598 | Unclassified | 2084 |
| 61 | Ga0466722_165588 | 3300042609 | Bacteria | 8549 |
| 62 | HBC_ctgsDRAFT_1010539 | 3300000333 | Bacteria | 2201 |
| 63 | SCG598O11_13352 | 3300000471 | Bacteria | 34321 |
| 64 | CVPL010W_10013425 | 3300002931 | Bacteria | 6253 |
| 65 | CVPL010W_10016854 | 3300002931 | Bacteria | 4857 |
| 66 | Ga0103265_1002949 | 3300007068 | Bacteria | 4536 |
| 67 | Ga0102740_1000038 | 3300007140 | Unclassified | 30245 |
| 68 | Ga0102740_1000926 | 3300007140 | Unclassified | 7902 |
| 69 | Ga0104019_1002401 | 3300007150 | Bacteria | 15400 |
| 70 | Ga0466711_087916 | 3300042615 | Bacteria | 2652 |
| 71 | Ga0466715_032985 | 3300042616 | Bacteria | 3150 |
| 72 | Ga0466723_062319 | 3300042618 | Unclassified | 7387 |
| 73 | Ga0466726_374403 | 3300042619 | Bacteria | 46455 |
| 74 | Ga0466728_266090 | 3300042620 | Bacteria | 1776 |
| 75 | Ga0466730_057548 | 3300042625 | Bacteria | 20440 |
| 76 | Ga0466709_321469 | 3300042648 | Bacteria | 19890 |
| 77 | Ga0466724_28590 | 3300042649 | Bacteria | 4629 |
| 78 | Ga0160472_101454 | 3300012839 | Bacteria | 6925 |
| 79 | Ga0160447_100029 | 3300012849 | Bacteria | 215457 |
| 80 | Ga0160435_1002249 | 3300012857 | Unclassified | 4716 |
| 81 | Ga0466691_030447 | 3300042593 | Bacteria | 8047 |
| 82 | Ga0466696_296663 | 3300042596 | Bacteria | 5024 |
| 83 | Ga0466701_013189 | 3300042598 | Bacteria | 96993 |
| 84 | Ga0466713_001806 | 3300042602 | Bacteria | 2080 |
| 85 | Ga0103266_1000211 | 3300007067 | Bacteria | 16285 |
| 86 | Ga0104051_1000366 | 3300007078 | Bacteria | 2646 |
| 87 | Ga0102737_1000111 | 3300007142 | Bacteria | 25689 |
| 88 | Ga0103264_1000094 | 3300007188 | Bacteria | 53077 |
| 89 | Ga0103264_1004737 | 3300007188 | Unclassified | 6728 |
| 90 | Ga0466705_465067 | 3300042612 | Bacteria | 21320 |
| 91 | Ga0466715_000174 | 3300042616 | Bacteria | 10146 |
| 92 | Ga0466715_250804 | 3300042616 | Bacteria | 18129 |
| 93 | Ga0466726_068618 | 3300042619 | Bacteria | 73201 |
| 94 | Ga0160471_100557 | 3300012812 | Bacteria | 9913 |
| 95 | Ga0160452_100061 | 3300012834 | Bacteria | 144414 |
| 96 | Ga0466657_272543 | 3300042582 | Bacteria | 144653 |
| 97 | Ga0466690_313657 | 3300042590 | Bacteria | 8875 |
| 98 | Ga0466690_328533 | 3300042590 | Bacteria | 7184 |
| 99 | Ga0466691_006763 | 3300042593 | Bacteria | 1863 |
| 100 | Ga0466691_147349 | 3300042593 | Bacteria | 1959 |
| 101 | Ga0466701_044341 | 3300042598 | Bacteria | 2899 |
| 102 | Ga0466701_081039 | 3300042598 | Bacteria | 3921 |
| 103 | Ga0466701_101982 | 3300042598 | Bacteria | 2830 |
| 104 | Ga0466698_020222 | 3300042610 | Bacteria | 1482 |
| 105 | CVPL005W_1000718 | 3300002934 | Bacteria | 18749 |
| 106 | Ga0074278_126124 | 3300005721 | Bacteria | 15782 |
| 107 | Ga0102737_1009320 | 3300007142 | Bacteria | 1695 |
| 108 | Ga0103268_1003805 | 3300007192 | Bacteria | 3105 |
| 109 | Ga0466726_074644 | 3300042619 | Bacteria | 19336 |
| 110 | Ga0466726_207306 | 3300042619 | Bacteria | 5173 |
| 111 | Ga0466730_054457 | 3300042625 | Bacteria | 19504 |
| 112 | Ga0466730_057968 | 3300042625 | Bacteria | 28148 |
| 113 | Ga0466724_29472 | 3300042649 | Bacteria | 417400 |
| 114 | Ga0466724_51427 | 3300042649 | Unclassified | 6376 |
| 115 | Ga0466708_102420 | 3300042652 | Bacteria | 28169 |
| 116 | Ga0160460_100931 | 3300012845 | Bacteria | 12450 |
| 117 | Ga0160457_1000975 | 3300012858 | Bacteria | 9446 |
| 118 | Ga0466691_009883 | 3300042593 | Bacteria | 22199 |
| 119 | Ga0466701_055352 | 3300042598 | Bacteria | 40267 |
| 120 | Ga0466701_057980 | 3300042598 | Bacteria | 195772 |
| 121 | CVPL010W_10001028 | 3300002931 | Bacteria | 31984 |
| 122 | CVPL005W_1000452 | 3300002934 | Unclassified | 16506 |
| 123 | Ga0102737_1003178 | 3300007142 | Bacteria | 3832 |
| 124 | Ga0103264_1002020 | 3300007188 | Unclassified | 9056 |
| 125 | Ga0103264_1014450 | 3300007188 | Bacteria | 3878 |
| 126 | Ga0466726_338230 | 3300042619 | Bacteria | 2739 |
| 127 | Ga0466726_421607 | 3300042619 | Bacteria | 9039 |
| 128 | Ga0466728_052160 | 3300042620 | Bacteria | 2372 |
| 129 | Ga0466728_133581 | 3300042620 | Bacteria | 36629 |
| 130 | Ga0466734_067733 | 3300042623 | Bacteria | 8984 |
| 131 | Ga0466735_072529 | 3300042624 | Bacteria | 2832 |
| 132 | Ga0466724_45279 | 3300042649 | Bacteria | 107209 |
| 133 | Ga0466701_022011 | 3300042598 | Bacteria | 293822 |
| 134 | Ga0466716_172603 | 3300042605 | Bacteria | 3582 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042624 | Ga0466735_072529 | Ga0466735_072529_895_2031 | 348 |
| 2 | 3300042619 | Ga0466726_421607 | Ga0466726_421607_5498_6634 | 359 |
| 3 | 3300042598 | Ga0466701_081039 | Ga0466701_081039_2330_3517 | 364 |
| 4 | 3300042598 | Ga0466701_101243 | Ga0466701_101243_3511_4707 | 367 |
| 5 | 3300042625 | Ga0466730_057548 | Ga0466730_057548_6444_7637 | 367 |
| 6 | 3300042649 | Ga0466724_31866 | Ga0466724_31866_108624_109817 | 367 |
| 7 | 3300042598 | Ga0466701_044341 | Ga0466701_044341_1491_2687 | 368 |
| 8 | 3300042602 | Ga0466713_001806 | Ga0466713_001806_929_2065 | 378 |
| 9 | 3300007129 | Ga0102734_1003177 | Ga0102734_10031773 | 382 |
| 10 | 3300042593 | Ga0466691_006763 | Ga0466691_006763_694_1842 | 382 |
| 11 | 3300042590 | Ga0466690_328533 | Ga0466690_328533_5674_6864 | 383 |
| 12 | 3300042605 | Ga0466716_172603 | Ga0466716_172603_2160_3353 | 383 |
| 13 | 3300042598 | Ga0466701_022011 | Ga0466701_022011_118051_119256 | 384 |
| 14 | 3300042649 | Ga0466724_29472 | Ga0466724_29472_120744_121949 | 384 |
| 15 | 3300042598 | Ga0466701_069147 | Ga0466701_069147_175_1428 | 385 |
| 16 | 3300042652 | Ga0466708_072239 | Ga0466708_072239_3100_4299 | 385 |
| 17 | 3300042612 | Ga0466705_184825 | Ga0466705_184825_3132_4337 | 386 |
| 18 | 3300042652 | Ga0466708_447105 | Ga0466708_447105_219_1418 | 386 |
| 19 | 3300042619 | Ga0466726_338230 | Ga0466726_338230_337_1530 | 387 |
| 20 | 3300042625 | Ga0466730_057968 | Ga0466730_057968_4991_6154 | 387 |
| 21 | 3300042652 | Ga0466708_102420 | Ga0466708_102420_2828_4021 | 387 |
| 22 | 3300042598 | Ga0466701_001180 | Ga0466701_001180_73_1239 | 388 |
| 23 | 3300042615 | Ga0466711_088144 | Ga0466711_088144_20766_21980 | 388 |
| 24 | 3300007142 | Ga0102737_1000111 | Ga0102737_10001119 | 389 |
| 25 | 3300042605 | Ga0466716_235143 | Ga0466716_235143_201_1409 | 389 |
| 26 | 3300042619 | Ga0466726_074644 | Ga0466726_074644_16612_17826 | 389 |
| 27 | iso_pr_bacteria | 2864874997 | 2864877430 | 389 |
| 28 | 3300042598 | Ga0466701_013189 | Ga0466701_013189_68335_69534 | 390 |
| 29 | 3300042609 | Ga0466722_182673 | Ga0466722_182673_258_1469 | 390 |
| 30 | 3300042616 | Ga0466715_143205 | Ga0466715_143205_46868_48103 | 390 |
| 31 | 3300002934 | CVPL005W_1000001 | CVPL005W_100000151 | 391 |
| 32 | 3300007188 | Ga0103264_1004737 | Ga0103264_10047376 | 391 |
| 33 | 3300007188 | Ga0103264_1014450 | Ga0103264_10144504 | 391 |
| 34 | 3300007192 | Ga0103268_1003805 | Ga0103268_10038054 | 391 |
| 35 | 3300042598 | Ga0466701_101982 | Ga0466701_101982_1326_2501 | 391 |
| 36 | iso_pr_bacteria | 2603880165 | 2606014906 | 391 |
| 37 | iso_pr_bacteria | 2687453742 | 2689988356 | 391 |
| 38 | iso_pr_bacteria | 2687453753 | 2690038826 | 391 |
| 39 | iso_pr_bacteria | 2855798354 | 2855802600 | 391 |
| 40 | 3300002931 | CVPL010W_10016854 | CVPL010W_100168543 | 392 |
| 41 | 3300002934 | CVPL005W_1000452 | CVPL005W_10004525 | 392 |
| 42 | 3300002938 | CVPL005L_10002326 | CVPL005L_100023269 | 392 |
| 43 | 3300003131 | Ga0052165_100900 | Ga0052165_1009001 | 392 |
| 44 | 3300007129 | Ga0102734_1015492 | Ga0102734_10154922 | 392 |
| 45 | 3300007140 | Ga0102740_1000926 | Ga0102740_10009265 | 392 |
| 46 | 3300007142 | Ga0102737_1000475 | Ga0102737_10004759 | 392 |
| 47 | 3300007142 | Ga0102737_1003178 | Ga0102737_10031783 | 392 |
| 48 | 3300007188 | Ga0103264_1000094 | Ga0103264_10000947 | 392 |
| 49 | 3300007188 | Ga0103264_1000256 | Ga0103264_100025613 | 392 |
| 50 | 3300007188 | Ga0103264_1000450 | Ga0103264_100045013 | 392 |
| 51 | 3300007188 | Ga0103264_1001817 | Ga0103264_10018178 | 392 |
| 52 | 3300007188 | Ga0103264_1002020 | Ga0103264_10020206 | 392 |
| 53 | 3300012818 | Ga0160432_100513 | Ga0160432_10051314 | 392 |
| 54 | 3300012858 | Ga0160457_1000975 | Ga0160457_10009756 | 392 |
| 55 | 3300042616 | Ga0466715_388813 | Ga0466715_388813_2032_3210 | 392 |
| 56 | iso_pr_bacteria | 8024031916 | 8024034017 | 392 |
| 57 | 3300012813 | Ga0160470_101628 | Ga0160470_1016283 | 393 |
| 58 | 3300012845 | Ga0160460_100931 | Ga0160460_1009312 | 393 |
| 59 | 3300012849 | Ga0160447_100029 | Ga0160447_100029169 | 393 |
| 60 | 3300042616 | Ga0466715_214294 | Ga0466715_214294_12912_14093 | 393 |
| 61 | 3300010882 | Ga0123354_10048977 | Ga0123354_100489774 | 394 |
| 62 | iso_pr_bacteria | 2963630348 | 2963631466 | 394 |
| 63 | 3300007067 | Ga0103266_1000211 | Ga0103266_10002118 | 395 |
| 64 | 3300007068 | Ga0103265_1002949 | Ga0103265_10029495 | 395 |
| 65 | 3300007142 | Ga0102737_1000084 | Ga0102737_10000843 | 395 |
| 66 | 3300042649 | Ga0466724_28590 | Ga0466724_28590_700_1983 | 395 |
| 67 | iso_pr_bacteria | 2864870719 | 2864872239 | 395 |
| 68 | iso_pr_bacteria | 2864960361 | 2864961887 | 395 |
| 69 | 3300042610 | Ga0466698_020222 | Ga0466698_020222_222_1412 | 396 |
| 70 | 3300042623 | Ga0466734_073443 | Ga0466734_073443_7904_9094 | 396 |
| 71 | 3300042652 | Ga0466708_134832 | Ga0466708_134832_8979_10202 | 396 |
| 72 | iso_pr_bacteria | 2597489944 | 2598058068 | 396 |
| 73 | iso_pr_bacteria | 2864937364 | 2864941109 | 396 |
| 74 | iso_pr_bacteria | 8023747282 | 8023750330 | 396 |
| 75 | iso_pr_bacteria | 8023752828 | 8023754587 | 396 |
| 76 | iso_pr_bacteria | 8024014383 | 8024016230 | 396 |
| 77 | iso_pr_bacteria | 8024019580 | 8024020538 | 396 |
| 78 | iso_pr_bacteria | 8024025509 | 8024026346 | 396 |
| 79 | iso_pr_bacteria | 8024044713 | 8024046656 | 396 |
| 80 | iso_pr_bacteria | 8025650824 | 8025652835 | 396 |
| 81 | iso_pr_bacteria | 8025658853 | 8025661136 | 396 |
| 82 | iso_pr_bacteria | 8025666332 | 8025668202 | 396 |
| 83 | iso_pr_bacteria | 8025671076 | 8025673066 | 396 |
| 84 | iso_pr_bacteria | 8025678175 | 8025680020 | 396 |
| 85 | iso_pr_bacteria | 8025685901 | 8025688395 | 396 |
| 86 | iso_pr_bacteria | 8025694439 | 8025696621 | 396 |
| 87 | iso_pr_bacteria | 8025701579 | 8025706985 | 396 |
| 88 | iso_pr_bacteria | 8025723035 | 8025724875 | 396 |
| 89 | iso_pr_bacteria | 8025728939 | 8025731041 | 396 |
| 90 | iso_pr_bacteria | 8025735396 | 8025737040 | 396 |
| 91 | iso_pr_bacteria | 8069770227 | 8069773275 | 396 |
| 92 | iso_pr_bacteria | 8069775773 | 8069777532 | 396 |
| 93 | iso_pr_bacteria | 8078130113 | 8078132098 | 396 |
| 94 | iso_pr_bacteria | 8102014801 | 8102016762 | 396 |
| 95 | iso_pr_bacteria | 8102020860 | 8102023167 | 396 |
| 96 | iso_pr_bacteria | 8102054868 | 8102056781 | 396 |
| 97 | iso_pr_bacteria | 8102081745 | 8102083775 | 396 |
| 98 | iso_pr_bacteria | 8102169119 | 8102170763 | 396 |
| 99 | iso_pr_bacteria | 8102174626 | 8102176728 | 396 |
| 100 | iso_pr_bacteria | 8102181083 | 8102182923 | 396 |
| 101 | iso_pr_bacteria | 8102201977 | 8102207383 | 396 |
| 102 | iso_pr_bacteria | 8102208438 | 8102210449 | 396 |
| 103 | iso_pr_bacteria | 8102216467 | 8102218649 | 396 |
| 104 | iso_pr_bacteria | 8102223607 | 8102225597 | 396 |
| 105 | iso_pr_bacteria | 8102230706 | 8102233200 | 396 |
| 106 | iso_pr_bacteria | 8102239244 | 8102241088 | 396 |
| 107 | iso_pr_bacteria | 8102246966 | 8102248836 | 396 |
| 108 | iso_pr_bacteria | 8102251710 | 8102253993 | 396 |
| 109 | 3300007188 | Ga0103264_1000020 | Ga0103264_10000208 | 397 |
| 110 | 3300012831 | Ga0160459_100570 | Ga0160459_10057011 | 397 |
| 111 | 3300042590 | Ga0466690_313657 | Ga0466690_313657_146_1339 | 397 |
| 112 | 3300042596 | Ga0466696_296663 | Ga0466696_296663_2282_3475 | 397 |
| 113 | 3300042609 | Ga0466722_165588 | Ga0466722_165588_5736_6929 | 397 |
| 114 | 3300042616 | Ga0466715_032985 | Ga0466715_032985_1356_2549 | 397 |
| 115 | 3300042616 | Ga0466715_141778 | Ga0466715_141778_10128_11345 | 397 |
| 116 | 3300042616 | Ga0466715_250804 | Ga0466715_250804_7376_8569 | 397 |
| 117 | 3300042618 | Ga0466723_363740 | Ga0466723_363740_2080_3273 | 397 |
| 118 | 3300042619 | Ga0466726_207306 | Ga0466726_207306_478_1671 | 397 |
| 119 | iso_pr_bacteria | 8023724303 | 8023730060 | 397 |
| 120 | iso_pr_bacteria | 8023757577 | 8023763334 | 397 |
| 121 | iso_pr_bacteria | 8023764196 | 8023770578 | 397 |
| 122 | iso_pr_bacteria | 8024001094 | 8024003059 | 397 |
| 123 | iso_pr_bacteria | 8025747911 | 8025750027 | 397 |
| 124 | iso_pr_bacteria | 8025756023 | 8025758139 | 397 |
| 125 | iso_pr_bacteria | 8069755105 | 8069757221 | 397 |
| 126 | iso_pr_bacteria | 8102041249 | 8102043202 | 397 |
| 127 | iso_pr_bacteria | 8102060671 | 8102062805 | 397 |
| 128 | iso_pr_bacteria | 8102074813 | 8102076876 | 397 |
| 129 | iso_pr_bacteria | 8102087471 | 8102089449 | 397 |
| 130 | iso_pr_bacteria | 8102145433 | 8102151190 | 397 |
| 131 | iso_pr_bacteria | 8102152052 | 8102158434 | 397 |
| 132 | iso_pr_bacteria | 8102161003 | 8102166929 | 397 |
| 133 | 3300042625 | Ga0466730_092809 | Ga0466730_092809_34362_35612 | 398 |
| 134 | iso_pr_bacteria | 2864755708 | 2864758881 | 398 |
| 135 | 3300002931 | CVPL010W_10011744 | CVPL010W_100117443 | 399 |
| 136 | 3300007141 | Ga0102738_1000145 | Ga0102738_10001454 | 399 |
| 137 | 3300042598 | Ga0466701_018128 | Ga0466701_018128_67576_68775 | 399 |
| 138 | 3300042598 | Ga0466701_021547 | Ga0466701_021547_29037_30236 | 399 |
| 139 | 3300042625 | Ga0466730_060188 | Ga0466730_060188_634510_635709 | 399 |
| 140 | iso_pr_bacteria | 2838140227 | 2838141160 | 399 |
| 141 | iso_pr_bacteria | 3003869270 | 3003870186 | 399 |
| 142 | iso_pr_bacteria | 3003878002 | 3003879019 | 399 |
| 143 | iso_pr_bacteria | 8100449422 | 8100450813 | 399 |
| 144 | iso_pr_bacteria | 8100455565 | 8100458327 | 399 |
| 145 | iso_pr_bacteria | 8100461708 | 8100465906 | 399 |
| 146 | 3300007150 | Ga0104019_1002401 | Ga0104019_100240110 | 400 |
| 147 | 3300042625 | Ga0466730_054457 | Ga0466730_054457_13613_14815 | 400 |
| 148 | 3300042582 | Ga0466657_272543 | Ga0466657_272543_102402_103607 | 401 |
| 149 | 3300042618 | Ga0466723_198634 | Ga0466723_198634_319_1542 | 401 |
| 150 | iso_pr_bacteria | 2603880172 | 2606034692 | 401 |
| 151 | iso_pr_bacteria | 2868169047 | 2868172727 | 401 |
| 152 | iso_pr_bacteria | 8021899934 | 8021900337 | 401 |
| 153 | 3300002931 | CVPL010W_10021613 | CVPL010W_100216132 | 402 |
| 154 | 3300007083 | Ga0103261_1002565 | Ga0103261_10025652 | 402 |
| 155 | 3300042593 | Ga0466691_106629 | Ga0466691_106629_5521_6729 | 402 |
| 156 | 3300042615 | Ga0466711_073315 | Ga0466711_073315_155_1363 | 402 |
| 157 | 3300042615 | Ga0466711_413562 | Ga0466711_413562_1877_3085 | 402 |
| 158 | 3300042615 | Ga0466711_517240 | Ga0466711_517240_7425_8633 | 402 |
| 159 | 3300042620 | Ga0466728_133581 | Ga0466728_133581_21664_22872 | 402 |
| 160 | 3300042620 | Ga0466728_266090 | Ga0466728_266090_480_1688 | 402 |
| 161 | 3300042648 | Ga0466709_321469 | Ga0466709_321469_13052_14260 | 402 |
| 162 | iso_pr_bacteria | 2864859030 | 2864863145 | 402 |
| 163 | iso_pr_bacteria | 2864914039 | 2864918066 | 402 |
| 164 | iso_pr_bacteria | 2864988360 | 2864992191 | 402 |
| 165 | iso_pr_bacteria | 3006190525 | 3006191273 | 402 |
| 166 | 3300007078 | Ga0104051_1000366 | Ga0104051_10003663 | 403 |
| 167 | 3300042598 | Ga0466701_057980 | Ga0466701_057980_76296_77507 | 403 |
| 168 | iso_pr_bacteria | 2531839311 | 2533040038 | 403 |
| 169 | iso_pr_bacteria | 2617270844 | 2617732094 | 403 |
| 170 | iso_pr_bacteria | 2864804954 | 2864806577 | 403 |
| 171 | iso_pr_bacteria | 2864840607 | 2864841002 | 403 |
| 172 | iso_pr_bacteria | 2864843793 | 2864845017 | 403 |
| 173 | iso_pr_bacteria | 2864863795 | 2864864190 | 403 |
| 174 | iso_pr_bacteria | 2864973726 | 2864975913 | 403 |
| 175 | 3300042598 | Ga0466701_055352 | Ga0466701_055352_16040_17272 | 404 |
| 176 | 3300042615 | Ga0466711_087916 | Ga0466711_087916_1285_2499 | 404 |
| 177 | 3300042616 | Ga0466715_000174 | Ga0466715_000174_289_1503 | 404 |
| 178 | 3300042625 | Ga0466730_065228 | Ga0466730_065228_22226_23458 | 404 |
| 179 | 3300042649 | Ga0466724_45279 | Ga0466724_45279_67335_68549 | 404 |
| 180 | 3300042598 | Ga0466701_008332 | Ga0466701_008332_16403_17647 | 405 |
| 181 | 3300042619 | Ga0466726_068618 | Ga0466726_068618_70306_71523 | 405 |
| 182 | iso_pr_bacteria | 2571042003 | 2571062174 | 405 |
| 183 | 3300042593 | Ga0466691_009883 | Ga0466691_009883_10618_11838 | 406 |
| 184 | 3300042618 | Ga0466723_062319 | Ga0466723_062319_139_1359 | 406 |
| 185 | 3300042619 | Ga0466726_374403 | Ga0466726_374403_45034_46254 | 406 |
| 186 | 3300042619 | Ga0466726_385365 | Ga0466726_385365_17684_18904 | 406 |
| 187 | 3300042655 | Ga0466727_319896 | Ga0466727_319896_12_1232 | 406 |
| 188 | iso_pr_bacteria | 641522603 | 641585585 | 406 |
| 189 | iso_pr_bacteria | 8100449422 | 8100449885 | 406 |
| 190 | iso_pr_bacteria | 8100455565 | 8100460113 | 406 |
| 191 | iso_pr_bacteria | 8100461708 | 8100466216 | 406 |
| 192 | 3300005071 | Ga0068302_10138275 | Ga0068302_101382754 | 407 |
| 193 | 3300042593 | Ga0466691_030447 | Ga0466691_030447_228_1451 | 407 |
| 194 | 3300042593 | Ga0466691_147349 | Ga0466691_147349_332_1555 | 407 |
| 195 | 3300042620 | Ga0466728_052160 | Ga0466728_052160_178_1401 | 407 |
| 196 | iso_pr_bacteria | 2841821538 | 2841822132 | 407 |
| 197 | iso_pr_bacteria | 8102102351 | 8102104304 | 407 |
| 198 | iso_pr_bacteria | 8102109360 | 8102111368 | 407 |
| 199 | iso_pr_bacteria | 8102117041 | 8102118968 | 407 |
| 200 | iso_pr_bacteria | 8102124461 | 8102126588 | 407 |
| 201 | iso_pr_bacteria | 8102138357 | 8102140357 | 407 |
| 202 | 3300042615 | Ga0466711_031361 | Ga0466711_031361_3674_4900 | 408 |
| 203 | iso_pr_bacteria | 3003178663 | 3003180641 | 408 |
| 204 | 3300012812 | Ga0160471_100557 | Ga0160471_1005572 | 409 |
| 205 | 3300012839 | Ga0160472_101454 | Ga0160472_1014546 | 409 |
| 206 | 3300012857 | Ga0160435_1002249 | Ga0160435_10022494 | 409 |
| 207 | iso_pr_bacteria | 2846359427 | 2846360596 | 409 |
| 208 | iso_pr_bacteria | 2846379220 | 2846381296 | 409 |
| 209 | iso_pr_bacteria | 2849409164 | 2849409649 | 409 |
| 210 | 3300005721 | Ga0074278_126124 | Ga0074278_12612415 | 410 |
| 211 | 3300042612 | Ga0466705_347516 | Ga0466705_347516_345_1577 | 410 |
| 212 | 3300042652 | Ga0466708_318873 | Ga0466708_318873_6895_8169 | 410 |
| 213 | 3300007140 | Ga0102740_1000038 | Ga0102740_100003815 | 411 |
| 214 | 3300042652 | Ga0466708_219312 | Ga0466708_219312_25118_26353 | 411 |
| 215 | iso_pr_bacteria | 2585427850 | 2586973058 | 412 |
| 216 | iso_pr_bacteria | 2585427851 | 2586976540 | 412 |
| 217 | iso_pr_bacteria | 2585428136 | 2588038346 | 412 |
| 218 | iso_pr_bacteria | 2684622927 | 2686107174 | 412 |
| 219 | iso_pr_bacteria | 2811994808 | 2812043584 | 412 |
| 220 | iso_pr_bacteria | 2834412944 | 2834413342 | 412 |
| 221 | iso_pr_bacteria | 2834415282 | 2834417603 | 412 |
| 222 | iso_pr_bacteria | 2837560943 | 2837563419 | 412 |
| 223 | iso_pr_bacteria | 2837563510 | 2837563663 | 412 |
| 224 | iso_pr_bacteria | 2840743474 | 2840744388 | 412 |
| 225 | iso_pr_bacteria | 2840748007 | 2840748416 | 412 |
| 226 | iso_pr_bacteria | 2843299038 | 2843299239 | 412 |
| 227 | iso_pr_bacteria | 2843301220 | 2843303157 | 412 |
| 228 | iso_pr_bacteria | 2846361553 | 2846362721 | 412 |
| 229 | iso_pr_bacteria | 2846363972 | 2846364399 | 412 |
| 230 | iso_pr_bacteria | 2846366200 | 2846367997 | 412 |
| 231 | iso_pr_bacteria | 2846368606 | 2846369180 | 412 |
| 232 | iso_pr_bacteria | 2846370940 | 2846372823 | 412 |
| 233 | iso_pr_bacteria | 2846373876 | 2846375410 | 412 |
| 234 | iso_pr_bacteria | 2846376288 | 2846378756 | 412 |
| 235 | iso_pr_bacteria | 2848751009 | 2848751094 | 412 |
| 236 | iso_pr_bacteria | 2849399727 | 2849401031 | 412 |
| 237 | iso_pr_bacteria | 2849402121 | 2849404349 | 412 |
| 238 | iso_pr_bacteria | 2849406737 | 2849406907 | 412 |
| 239 | iso_pr_bacteria | 2849411303 | 2849411646 | 412 |
| 240 | iso_pr_bacteria | 2849413536 | 2849415501 | 412 |
| 241 | iso_pr_bacteria | 2849415715 | 2849416123 | 412 |
| 242 | iso_pr_bacteria | 2849417936 | 2849417990 | 412 |
| 243 | iso_pr_bacteria | 2852205774 | 2852207064 | 412 |
| 244 | iso_pr_bacteria | 2854084220 | 2854085847 | 412 |
| 245 | iso_pr_bacteria | 2854086477 | 2854087568 | 412 |
| 246 | iso_pr_bacteria | 2854088767 | 2854089562 | 412 |
| 247 | iso_pr_bacteria | 2854091108 | 2854092035 | 412 |
| 248 | iso_pr_bacteria | 2854093395 | 2854094945 | 412 |
| 249 | iso_pr_bacteria | 2854095577 | 2854097291 | 412 |
| 250 | iso_pr_bacteria | 2854097802 | 2854099853 | 412 |
| 251 | iso_pr_bacteria | 2854100132 | 2854102390 | 412 |
| 252 | iso_pr_bacteria | 2854102457 | 2854102790 | 412 |
| 253 | iso_pr_bacteria | 2854104879 | 2854107094 | 412 |
| 254 | iso_pr_bacteria | 2857822956 | 2857823985 | 412 |
| 255 | iso_pr_bacteria | 2857825141 | 2857826688 | 412 |
| 256 | iso_pr_bacteria | 2857827427 | 2857829071 | 412 |
| 257 | iso_pr_bacteria | 2857830159 | 2857830441 | 412 |
| 258 | iso_pr_bacteria | 2857832487 | 2857833609 | 412 |
| 259 | iso_pr_bacteria | 2857835046 | 2857836871 | 412 |
| 260 | iso_pr_bacteria | 2857837414 | 2857839835 | 412 |
| 261 | iso_pr_bacteria | 2857840086 | 2857840261 | 412 |
| 262 | iso_pr_bacteria | 2857842411 | 2857843422 | 412 |
| 263 | iso_pr_bacteria | 2857845033 | 2857847536 | 412 |
| 264 | iso_pr_bacteria | 2868461634 | 2868462054 | 412 |
| 265 | iso_pr_bacteria | 2868464004 | 2868465385 | 412 |
| 266 | iso_pr_bacteria | 8101255641 | 8101257914 | 412 |
| 267 | iso_pr_bacteria | 8101258116 | 8101260464 | 412 |
| 268 | iso_pr_bacteria | 8101260589 | 8101262858 | 412 |
| 269 | iso_pr_bacteria | 8101263066 | 8101264051 | 412 |
| 270 | iso_pr_bacteria | 8101265296 | 8101267420 | 412 |
| 271 | iso_pr_bacteria | 8101267702 | 8101268560 | 412 |
| 272 | iso_pr_bacteria | 8101270055 | 8101270710 | 412 |
| 273 | iso_pr_bacteria | 8101272231 | 8101272834 | 412 |
| 274 | iso_pr_bacteria | 8101274435 | 8101274954 | 412 |
| 275 | iso_pr_bacteria | 8101276651 | 8101277407 | 412 |
| 276 | iso_pr_bacteria | 8101278866 | 8101280270 | 412 |
| 277 | iso_pr_bacteria | 8119099601 | 8119101555 | 412 |
| 278 | 3300000333 | HBC_ctgsDRAFT_1010539 | HBC_ctgsDRAFT_10105392 | 413 |
| 279 | 3300042618 | Ga0466723_147990 | Ga0466723_147990_13909_15150 | 413 |
| 280 | 3300007188 | Ga0103264_1001063 | Ga0103264_10010632 | 414 |
| 281 | 3300042623 | Ga0466734_067733 | Ga0466734_067733_2760_4010 | 416 |
| 282 | 3300000471 | SCG598O11_13352 | SCG598O11_1335224 | 419 |
| 283 | 3300000475 | SCG598J21_12956 | SCG598J21_12956173 | 419 |
| 284 | iso_pr_bacteria | 8025708040 | 8025710080 | 419 |
| 285 | iso_pr_bacteria | 8102094248 | 8102096518 | 419 |
| 286 | iso_pr_bacteria | 8102193924 | 8102195963 | 419 |
| 287 | 3300007052 | Ga0102736_1001042 | Ga0102736_10010428 | 420 |
| 288 | 3300012834 | Ga0160452_100061 | Ga0160452_10006149 | 420 |
| 289 | iso_pr_bacteria | 8024037630 | 8024039635 | 423 |
| 290 | iso_pr_bacteria | 8025716094 | 8025718388 | 423 |
| 291 | iso_pr_bacteria | 8025740903 | 8025742807 | 423 |
| 292 | iso_pr_bacteria | 8069748016 | 8069749955 | 423 |
| 293 | iso_pr_bacteria | 8069763219 | 8069765123 | 423 |
| 294 | iso_pr_bacteria | 8101951471 | 8101953466 | 423 |
| 295 | iso_pr_bacteria | 8101960468 | 8101962460 | 423 |
| 296 | iso_pr_bacteria | 8101967387 | 8101969379 | 423 |
| 297 | iso_pr_bacteria | 8101974301 | 8101976285 | 423 |
| 298 | iso_pr_bacteria | 8101981714 | 8101983710 | 423 |
| 299 | iso_pr_bacteria | 8101988189 | 8101990264 | 423 |
| 300 | iso_pr_bacteria | 8101994502 | 8101996719 | 423 |
| 301 | iso_pr_bacteria | 8102001125 | 8102002973 | 423 |
| 302 | iso_pr_bacteria | 8102007614 | 8102009559 | 423 |
| 303 | iso_pr_bacteria | 8102026984 | 8102029073 | 423 |
| 304 | iso_pr_bacteria | 8102033761 | 8102036155 | 423 |
| 305 | iso_pr_bacteria | 8102047609 | 8102049694 | 423 |
| 306 | iso_pr_bacteria | 8102067727 | 8102069730 | 423 |
| 307 | iso_pr_bacteria | 8102131453 | 8102135763 | 423 |
| 308 | iso_pr_bacteria | 8102186987 | 8102189280 | 423 |
| 309 | iso_pr_bacteria | 8102264549 | 8102266626 | 423 |
| 310 | iso_pr_bacteria | 8102271933 | 8102274089 | 423 |
| 311 | iso_pr_bacteria | 8102279326 | 8102281358 | 423 |
| 312 | iso_pr_bacteria | 8102286609 | 8102288770 | 423 |
| 313 | iso_pr_bacteria | 8102312426 | 8102314422 | 423 |
| 314 | 3300042612 | Ga0466705_465067 | Ga0466705_465067_19350_20624 | 424 |
| 315 | 3300042625 | Ga0466730_085631 | Ga0466730_085631_44608_45885 | 425 |
| 316 | 3300042649 | Ga0466724_51427 | Ga0466724_51427_1914_3191 | 425 |
| 317 | iso_pr_bacteria | 2603880170 | 2606027836 | 432 |
| 318 | 3300002934 | CVPL005W_1000718 | CVPL005W_100071814 | 433 |
| 319 | 3300007139 | Ga0103260_1000583 | Ga0103260_10005837 | 445 |
| 320 | 3300007142 | Ga0102737_1009320 | Ga0102737_10093201 | 445 |
| 321 | 3300002931 | CVPL010W_10001028 | CVPL010W_1000102827 | 451 |
| 322 | 3300002931 | CVPL010W_10013425 | CVPL010W_100134252 | 458 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.83 | 0.9 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.