Protein Family IF00973

Metagenome Isolate
221 Members
149 Samples
121 Scaffolds
286.53 Avg Length

🧬 Representative Sequence

ID
3300002931|CVPL010W_10011331|CVPL010W_100113317
Length
315 aa
Sequence
VPLRWDQASAQDTVNQISHPHPAMGAGSQHLFMELILEPFHYHYMQTAIWVCALVGAVCAFLSAYLMLKGWSLIGDALSHSIVPGVAGAWMLGLPFSLGAFAAGGLAASTMLFLRQRTRLREDVVIGLIFTSFFGLGLFMVSLSPMPINVNTIIMGNVLAITREDTVQLALIGVVSLALLMWKWRDLLAVFFDEQHAQSIGLNPFRLKLLFFALLSACTVAAMMTVGAFLVIAMVVTPGATAYLLSDRFLRLLAISVAIGAGSGALGAFISYFLDGATGGIIVLLQTALFLLAFFFSPSHGRLAARWRMRRAAP*

📊 Sample Types

Isolate 45.2%
Metagenome 54.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 23.6%
Formicidae 16.7%
Apidae 11.8%
Drosophilidae 6.9%
Anthocoridae 6.2%
Curculionidae 4.9%
Termitidae 2.8%
Armadillidiidae 2.8%
Culicidae 2.8%
Tenebrionidae 2.1%
Talitridae 2.1%
Tephritidae 2.1%
Pteromalidae 1.4%
Nephropidae 1.4%
Aphididae 1.4%
Pentatomidae 1.4%
Sarcophagidae 1.4%
Calliphoridae 1.4%
Thripidae 0.7%
Muscidae 0.7%
Lysianassidae 0.7%
Daphniidae 0.7%
Rhopalidae 0.7%
Carabidae 0.7%
Plutellidae 0.7%
Crambidae 0.7%
Elmidae 0.7%
Cerambycidae 0.7%

🌳 Taxonomy

Archaea 0
Bacteria 181
Eukaryota 0
Viruses 0
Unclassified 40

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
2 2551306516 Enterobacter hormaechei YT3 Isolate Tenebrionidae
3 2571042430 Vibrio harveyi NBRC 15634 Isolate Talitridae
4 2627854002 Vibrio nigripulchritudo ENn2 Isolate Unclassified
5 2871760914 Pantoea ananatis PANS 01-2 Isolate Thripidae
6 2937751072 Serratia sp. OLMTLW26 Isolate Anthocoridae
7 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
8 8073624232 Bartonella sp. W8151 Isolate Apidae
9 8102982778 Erwinia sp. S63 Isolate Curculionidae
10 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
11 2510065002 Arsenophonus sp. ArN Isolate Pteromalidae
12 2519899623 Enterobacter sp. Ag1 Isolate Culicidae
13 2531839005 Vibrio harveyi CAIM 1792 Isolate Unclassified
14 2537561600 Salmonella enterica enterica sv. Newport CVM 19443 Isolate Unclassified
15 2588253791 Yokenella regensburgei F. Haas DC-1, ATCC 49455 Isolate Unclassified
16 2885050628 Erwinia sp. OLMTSP26 Isolate Anthocoridae
17 2885061987 Erwinia sp. OLFS4 Isolate Anthocoridae
18 2885065815 Erwinia sp. OAMSP11 Isolate Anthocoridae
19 2898991528 Erwinia sp. OLMDLW33 Isolate Anthocoridae
20 2900132049 Bartonella massiliensis OS09 Isolate Unclassified
21 8067483258 Ochrobactrum soli MTP-C0764 Isolate Muscidae
22 8068950955 Bartonella apihabitans W8097 Isolate Apidae
23 8073621894 Bartonella apis W8099 Isolate Apidae
24 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
25 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
26 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Formicidae
27 3300007139 Ant gut microbial communities from Cephalotes pellans, Brazil Metagenome Formicidae
28 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
29 2065487013 Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm Metagenome
30 2501651205 Colwellia sp. MT41 Isolate Lysianassidae
31 2531839602 Shimwellia blattae NBRC 105725 Isolate Unclassified
32 2556921669 Shinella sp. DD12 Isolate Daphniidae
33 2609459958 Vibrio nigripulchritudo Wn13 Isolate Unclassified
34 2630968716 Vibrio nigripulchritudo AM115 Isolate Unclassified
35 2806310572 Pukyongiella litopenaei SH-1 Isolate Unclassified
36 2835143510 Yoonia maritima YPC211 Isolate Nephropidae
37 2844251356 Photobacterium leiognathi mandapamensis ajapo.3.1 Isolate Unclassified
38 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
39 8068946563 Bartonella apihabitans M0187 Isolate Apidae
40 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
41 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
42 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
43 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
44 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
45 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
46 3300009453 Microbial communities of aphids from Cornus sp. in New Haven, CT, USA - Anoecia fulviabdominalis seqcov Metagenome
47 2507262005 Candidatus Regiella insecticola R5.15 Isolate Aphididae
48 2529292851 Providencia burhodogranariea DSM 19968 Isolate Drosophilidae
49 2651870110 Izhakiella capsodis N6PO6 Isolate Unclassified
50 2751185856 Bartonella apis BBC0244 Isolate Apidae
51 2885046828 Erwinia sp. OLCASP19 Isolate Anthocoridae
52 2885054481 Erwinia sp. OLMDSP33 Isolate Anthocoridae
53 648276708 Pantoea sp. aB Isolate Unclassified
54 8073617375 Bartonella apis W8098 Isolate Apidae
55 8082291289 Bartonella apihabitans K-FP28 Isolate Apidae
56 3004010258 Citrobacter sp. JGM124 Isolate Drosophilidae
57 3300005319 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 2 gut Metagenome Drosophilidae
58 3300007042 Ant gut microbial communities from Cephalotes pusillus, Brazil Metagenome Formicidae
59 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
60 3300007149 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut Metagenome Drosophilidae
61 3300028918 Ant gut bacterial community from Dolichoderus sp. 2-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC085 Metagenome Formicidae
62 3300029810 Ant gut bacterial community from Dolichoderus sp. 4-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC189 Metagenome Formicidae
63 2585428048 Colwellia sp. NBT2012 Isolate
64 2588253732 Klebsiella pneumoniae pneumoniae KP5-1 Isolate Pentatomidae
65 2609459925 Vibrio nigripulchritudo SO65 Isolate Unclassified
66 2627853677 Vibrio nigripulchritudo FTn2 Isolate Unclassified
67 2648501628 Xanthomonas sp. Cag60 Isolate Unclassified
68 2731957638 Vibrio harveyi NBRC 15634 Isolate Talitridae
69 2824588292 Yokenella regensburgei WCD67 Isolate Rhopalidae
70 2885058212 Erwinia sp. OLTSP20 Isolate Anthocoridae
71 2896925746 Vibrio nigripulchritudo SFn27 Isolate Unclassified
72 8004118532 Citrobacter amalonaticus ku-bf3 Isolate Carabidae
73 8065338428 Ignatzschineria indica KCTC 22643 Isolate Sarcophagidae
74 8068953321 Bartonella apihabitans M0190 Isolate Apidae
75 8101683685 Providencia sp. JGM181 Isolate Drosophilidae
76 3300007141 Ant gut microbial communities from Cephalotes maculatus, Brazil Metagenome Formicidae
77 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
78 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
79 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
80 3300035363 Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut Metagenome Plutellidae
81 2551306531 Enterobacter hormaechei YT2 Isolate Tenebrionidae
82 2648501820 Vibrio nigripulchritudo BLFn1 Isolate Unclassified
83 2687453742 Burkholderiales bacterium B_Cag20 Isolate Unclassified
84 2744054871 Candidatus Arsenophonus triatominarum ATi Isolate Unclassified
85 2751185853 Bartonella apis BBC0178 Isolate Apidae
86 2837516909 Rahnella bruchi DSM 27398 Isolate Unclassified
87 2885043073 Erwinia sp. OLSSP12 Isolate Anthocoridae
88 2896187957 Providencia stuartii Crippen Isolate Calliphoridae
89 648861007 Candidatus Regiella insecticola LSR1 Isolate Aphididae
90 8021535516 Klebsiella sp. Kd70 TUC-EEAOC Isolate Crambidae
91 8042061949 Vibrio harveyi Hep-2a-10 Isolate Unclassified
92 8068944069 Bartonella choladocola W8125 Isolate Apidae
93 8068955631 Bartonella apihabitans M0280 Isolate Apidae
94 8073628750 Bartonella sp. W8167 Isolate Apidae
95 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Formicidae
96 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
97 3300007224 Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut Metagenome Unclassified
98 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
99 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
100 3300028910 Ant gut bacterial community from Dolichoderus sp. 1-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC161 Metagenome Formicidae
101 2513020017 Shimwellia blattae DSM 4481 Isolate Unclassified
102 2603880170 Burkholderiales A2 Isolate Unclassified
103 2751185858 Bartonella apis BBC0122 Isolate Apidae
104 2836714267 Shimwellia blattae NCTC10965 Isolate
105 2836755666 Arsenophonus nasoniae FIN Isolate Pteromalidae
106 2846386538 Rahnella sp. AN3-3W3 Isolate Pentatomidae
107 2864751016 Pseudomonas oryzihabitans S00005 Isolate Elmidae
108 2868883784 Photobacterium leiognathi mandapamensis AJ-1a Isolate Unclassified
109 2876358570 Cronobacter sakazakii MOD1-Ls15g Isolate Calliphoridae
110 2938192669 Citrobacter sp. TSA-1 Isolate Unclassified
111 8021546568 Klebsiella sp. Kps Isolate Tephritidae
112 8068941587 Bartonella choladocola B10834H15 Isolate Apidae
113 8073619611 Bartonella apis B10834G6 Isolate Apidae
114 8101680043 Providencia sp. JGM178 Isolate Drosophilidae
115 8103002986 Erwinia sp. S38 Isolate Curculionidae
116 8103008710 Erwinia sp. S43 Isolate Curculionidae
117 2971189173 Yersinia pestis A-1249 Isolate Unclassified
118 3007478678 Pseudomonas sp. S37 Isolate Curculionidae
119 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
120 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
121 3300007767 Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut Metagenome Drosophilidae
122 3300026175 Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 Metagenome Formicidae
123 3300030930 Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 Metagenome Formicidae
124 8116627632 Vibrio penaeicida NBRC 15640 Isolate Unclassified
125 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
126 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
127 2035918003 Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine Metagenome Curculionidae
128 2547132185 Enterobacter cancerogenus YZ1 Isolate Tenebrionidae
129 2585427605 Colwellia sp. MT2012 Isolate
130 2619619082 Pantoea agglomerans SL1_M5 Isolate Unclassified
131 2636415586 Vibrio harveyi NBRC 15634 Isolate Talitridae
132 2667527887 Vibrio harveyi LMG 4044 Isolate Unclassified
133 2687453753 Burkholderiales bacterium B_Cag25 Isolate Unclassified
134 2822856742 Enterobacter cancerogenus CR-Eb1 Isolate Unclassified
135 2832037495 Ignatzschineria indica KCTC 22643 Isolate Sarcophagidae
136 2839785767 Thalassobius sp. I31.1 Isolate Nephropidae
137 2874880541 Enterobacter hormaechei E3442 Isolate Unclassified
138 8018312681 Enterobacter sp. OLF Isolate Tephritidae
139 8021540981 Klebsiella sp. Kpp Isolate Tephritidae
140 8028002147 Enterobacter sp. 10-1 Isolate Cerambycidae
141 8073626464 Bartonella apis W8152 Isolate Apidae
142 8099192374 Erwinia typographi IC4 Isolate Curculionidae
143 3300002938 Larval gut metagenome for colony PL005 Metagenome Formicidae
144 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
145 3300005316 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 2 gut Metagenome Drosophilidae
146 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
147 3300007106 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut Metagenome Drosophilidae
148 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
149 3300029809 Ant gut bacterial community from Dolichoderus sp. 3-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC188 Metagenome Formicidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 CVPL010W_10000310 3300002931 Bacteria 47641
2 CVPL005L_10006291 3300002938 Unclassified 12760
3 Ga0104041_1001673 3300007106 Bacteria 13613
4 Ga0103260_1000378 3300007139 Bacteria 11064
5 Ga0102737_1000013 3300007142 Bacteria 54146
6 Ga0103264_1000568 3300007188 Unclassified 18212
7 Ga0104147_1013471 3300007224 Bacteria 22083
8 FGTW_contig13745 2065487013 Bacteria 27070
9 CVPL010W_10000416 3300002931 Bacteria 44245
10 CVPL010L_1000020 3300002932 Bacteria 56498
11 CVPL005W_1000298 3300002934 Bacteria 41676
12 Ga0103266_1000067 3300007067 Bacteria 40296
13 Ga0102735_1000090 3300007080 Bacteria 37625
14 Ga0102739_1000270 3300007095 Bacteria 12300
15 Ga0102734_1001187 3300007129 Bacteria 8121
16 Ga0102737_1007154 3300007142 Unclassified 2057
17 Ga0103264_1000294 3300007188 Bacteria 27491
18 Ga0103264_1011929 3300007188 Unclassified 4258
19 Ga0103268_1001147 3300007192 Bacteria 17672
20 Ga0127656_100526 3300009453 Bacteria 33170
21 Ga0160448_106834 3300012854 Bacteria 2799
22 Ga0316159_10453 3300030930 Unclassified 6388
23 Ga0247289_0139 3300035363 Unclassified 18899
24 Ga0466657_216185 3300042582 Bacteria 22362
25 CVPL010W_10001544 3300002931 Bacteria 27192
26 Ga0074302_1024015 3300005316 Bacteria 2670
27 Ga0102736_1000659 3300007052 Unclassified 7303
28 Ga0102736_1003705 3300007052 Bacteria 2162
29 Ga0103261_1002658 3300007083 Unclassified 2806
30 Ga0104041_1110265 3300007106 Unclassified 3144
31 Ga0102738_1000371 3300007141 Unclassified 7872
32 Ga0103264_1003128 3300007188 Bacteria 10408
33 Ga0466730_015559 3300042625 Bacteria 12801
34 Ga0466701_040221 3300042598 Bacteria 71565
35 Ga0466701_091420 3300042598 Bacteria 3300
36 Ga0466713_034072 3300042602 Bacteria 82126
37 Ga0466713_087423 3300042602 Unclassified 7667
38 Ga0160455_100873 3300012837 Bacteria 11464
39 Ga0160460_100353 3300012845 Bacteria 31451
40 Ga0160433_101796 3300012846 Unclassified 5328
41 FGTW_contig20739 2065487013 Unclassified 1440
42 CVPL005W_1000053 3300002934 Bacteria 43713
43 CVPL005W_1002750 3300002934 Unclassified 3230
44 Ga0063521_1000253 3300003973 Bacteria 35555
45 Ga0074278_123997 3300005721 Bacteria 11946
46 Ga0103263_100010 3300007042 Bacteria 58538
47 Ga0102736_1000668 3300007052 Unclassified 6624
48 Ga0102736_1001476 3300007052 Bacteria 4125
49 Ga0103261_1000510 3300007083 Unclassified 6341
50 Ga0102739_1005546 3300007095 Unclassified 1721
51 Ga0104041_1110212 3300007106 Unclassified 3341
52 Ga0102734_1028000 3300007129 Bacteria 1969
53 Ga0102740_1000625 3300007140 Unclassified 9659
54 Ga0102740_1008740 3300007140 Unclassified 1656
55 Ga0466724_29344 3300042649 Unclassified 10292
56 Ga0255572_1000003 3300026175 Bacteria 262489
57 Ga0247289_0148 3300035363 Unclassified 17928
58 CVPL010W_10011331 3300002931 Bacteria 7956
59 CVPL010W_10017285 3300002931 Unclassified 4721
60 CVPL005W_1000207 3300002934 Unclassified 26220
61 Ga0063521_1000071 3300003973 Bacteria 83397
62 Ga0074278_104217 3300005721 Unclassified 4239
63 Ga0102738_1000059 3300007141 Bacteria 45781
64 Ga0102737_1007959 3300007142 Bacteria 1900
65 Ga0103264_1000016 3300007188 Bacteria 116870
66 Ga0103264_1000138 3300007188 Bacteria 73886
67 Ga0103264_1000793 3300007188 Bacteria 14537
68 Ga0103268_1005315 3300007192 Bacteria 2611
69 DPOL_contig00004 2035918003 Bacteria 74609
70 CVPL010W_10000308 3300002931 Bacteria 47673
71 CVPL010W_10002473 3300002931 Bacteria 22039
72 Ga0063521_1000588 3300003973 Bacteria 15372
73 Ga0063521_1000782 3300003973 Unclassified 11474
74 Ga0074304_1034497 3300005319 Unclassified 2793
75 Ga0102736_1000023 3300007052 Bacteria 70447
76 Ga0103261_1002360 3300007083 Bacteria 2963
77 Ga0103261_1007994 3300007083 Unclassified 1501
78 Ga0102739_1013182 3300007095 Bacteria 1065
79 Ga0102734_1000259 3300007129 Bacteria 16478
80 Ga0102734_1000524 3300007129 Bacteria 27056
81 Ga0102738_1011482 3300007141 Bacteria 1216
82 Ga0102737_1003484 3300007142 Bacteria 3582
83 Ga0160471_100129 3300012812 Bacteria 30780
84 Ga0466724_19220 3300042649 Unclassified 15959
85 Ga0466724_47083 3300042649 Bacteria 378486
86 Ga0160468_105167 3300012819 Bacteria 1505
87 Ga0316159_10081 3300030930 Bacteria 19428
88 CVPL010W_10000148 3300002931 Bacteria 57471
89 CVPL010L_1000466 3300002932 Unclassified 8915
90 Ga0063521_1000033 3300003973 Bacteria 118552
91 Ga0103260_1000011 3300007139 Bacteria 101836
92 Ga0103260_1005860 3300007139 Bacteria 1790
93 Ga0102740_1000001 3300007140 Bacteria 144366
94 Ga0102740_1014350 3300007140 Unclassified 1222
95 Ga0102737_1000683 3300007142 Bacteria 10788
96 Ga0102737_1002406 3300007142 Unclassified 4655
97 Ga0105005_1283228 3300007505 Unclassified 1764
98 Ga0466730_035437 3300042625 Unclassified 24782
99 Ga0466713_073462 3300042602 Bacteria 5818
100 Ga0160444_100017 3300012841 Bacteria 336790
101 Ga0309902_000001 3300028910 Bacteria 348555
102 Ga0309903_100004 3300029809 Bacteria 108343
103 Ga0309904_1000017 3300029810 Bacteria 25067
104 Ga0466701_001909 3300042598 Bacteria 24724
105 CVPL010W_10000599 3300002931 Bacteria 39468
106 CVPL005W_1001322 3300002934 Bacteria 6738
107 Ga0063521_1000004 3300003973 Bacteria 302382
108 Ga0103266_1011815 3300007067 Unclassified 1041
109 Ga0102735_1001219 3300007080 Bacteria 4504
110 Ga0103261_1000066 3300007083 Bacteria 33889
111 Ga0102734_1020940 3300007129 Unclassified 2169
112 Ga0102737_1000520 3300007142 Unclassified 12571
113 Ga0104040_1142877 3300007149 Bacteria 2340
114 Ga0103264_1000030 3300007188 Bacteria 85624
115 Ga0103264_1000055 3300007188 Bacteria 65906
116 Ga0103267_1000011 3300007190 Bacteria 88011
117 Ga0105553_1034052 3300007767 Unclassified 6641
118 Ga0466730_063581 3300042625 Unclassified 8787
119 Ga0466724_17050 3300042649 Unclassified 1434
120 Ga0309901_1000016 3300028918 Bacteria 176007
121 Ga0316159_10001 3300030930 Bacteria 1642808

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042649 Ga0466724_47083 Ga0466724_47083_1166_2029 256
2 3300002931 CVPL010W_10017285 CVPL010W_100172855 260
3 3300007188 Ga0103264_1000030 Ga0103264_100003040 261
4 3300007142 Ga0102737_1007154 Ga0102737_10071542 262
5 3300007188 Ga0103264_1011929 Ga0103264_10119293 264
6 3300007095 Ga0102739_1005546 Ga0102739_10055462 266
7 3300012846 Ga0160433_101796 Ga0160433_1017965 272
8 3300007083 Ga0103261_1007994 Ga0103261_10079942 274
9 3300007140 Ga0102740_1014350 Ga0102740_10143502 274
10 3300007224 Ga0104147_1013471 Ga0104147_101347118 274
11 3300007188 Ga0103264_1000294 Ga0103264_100029425 275
12 3300042602 Ga0466713_073462 Ga0466713_073462_2831_3694 275
13 3300002934 CVPL005W_1002750 CVPL005W_10027504 276
14 3300002938 CVPL005L_10006291 CVPL005L_1000629112 276
15 3300005721 Ga0074278_104217 Ga0074278_1042172 277
16 3300028910 Ga0309902_000001 Ga0309902_000001_202906_203742 278
17 iso_pr_bacteria 2507262005 2507286407 278
18 3300028918 Ga0309901_1000016 Ga0309901_1000016168 280
19 3300007129 Ga0102734_1020940 Ga0102734_10209403 281
20 2065487013 FGTW_contig20739 FGTW_00320920 282
21 3300007083 Ga0103261_1000510 Ga0103261_10005108 282
22 3300035363 Ga0247289_0139 Ga0247289_0139_4097_4945 282
23 3300035363 Ga0247289_0148 Ga0247289_0148_3543_4391 282
24 3300042602 Ga0466713_087423 Ga0466713_087423_2114_2962 282
25 3300042649 Ga0466724_17050 Ga0466724_17050_495_1343 282
26 iso_pr_bacteria 2588253732 2588525912 282
27 iso_pr_bacteria 2648501628 2650560751 282
28 iso_pr_bacteria 2874880541 2874882529 282
29 iso_pr_bacteria 8021535516 8021537984 282
30 iso_pr_bacteria 8021540981 8021543408 282
31 iso_pr_bacteria 8021546568 8021546687 282
32 iso_pr_bacteria 8028002147 8028004644 282
33 2035918003 DPOL_contig00004 DPOLB_13020 283
34 2065487013 FGTW_contig13745 FGTW_02512660 283
35 3300002931 CVPL010W_10000308 CVPL010W_1000030829 283
36 3300002932 CVPL010L_1000020 CVPL010L_100002053 283
37 3300002934 CVPL005W_1000207 CVPL005W_100020713 283
38 3300007052 Ga0102736_1000659 Ga0102736_10006596 283
39 3300007129 Ga0102734_1028000 Ga0102734_10280002 283
40 3300007141 Ga0102738_1011482 Ga0102738_10114822 283
41 3300007188 Ga0103264_1000016 Ga0103264_100001680 283
42 3300030930 Ga0316159_10453 Ga0316159_104538 283
43 3300042625 Ga0466730_015559 Ga0466730_015559_10746_11597 283
44 iso_pr_bacteria 2547132185 2547710590 283
45 iso_pr_bacteria 2551306516 2553377567 283
46 iso_pr_bacteria 2551306531 2553450069 283
47 iso_pr_bacteria 2751185853 2753587912 283
48 iso_pr_bacteria 2751185856 2753593261 283
49 iso_pr_bacteria 2751185858 2753597226 283
50 iso_pr_bacteria 2839785767 2839788150 283
51 iso_pr_bacteria 8068941587 8068942227 283
52 iso_pr_bacteria 8068944069 8068944566 283
53 iso_pr_bacteria 8068946563 8068947845 283
54 iso_pr_bacteria 8068950955 8068951708 283
55 iso_pr_bacteria 8068953321 8068955013 283
56 iso_pr_bacteria 8068955631 8068957298 283
57 iso_pr_bacteria 8073617375 8073617553 283
58 iso_pr_bacteria 8073619611 8073620093 283
59 iso_pr_bacteria 8073621894 8073622616 283
60 iso_pr_bacteria 8073624232 8073624722 283
61 iso_pr_bacteria 8073626464 8073628387 283
62 iso_pr_bacteria 8073628750 8073630523 283
63 iso_pr_bacteria 8082291289 8082293943 283
64 3300002932 CVPL010L_1000466 CVPL010L_10004665 284
65 3300003973 Ga0063521_1000782 Ga0063521_100078210 284
66 3300007052 Ga0102736_1000668 Ga0102736_10006682 284
67 3300007067 Ga0103266_1000067 Ga0103266_10000674 284
68 3300007067 Ga0103266_1011815 Ga0103266_10118152 284
69 3300007142 Ga0102737_1007959 Ga0102737_10079592 284
70 3300007192 Ga0103268_1005315 Ga0103268_10053152 284
71 iso_pr_bacteria 2837516909 2837520459 284
72 iso_pr_bacteria 2846386538 2846386627 284
73 iso_pr_bacteria 2864751016 2864753081 284
74 iso_pr_bacteria 2898991528 2898991592 284
75 3300002931 CVPL010W_10001544 CVPL010W_1000154423 285
76 3300003973 Ga0063521_1000004 Ga0063521_1000004181 285
77 3300005721 Ga0074278_123997 Ga0074278_1239978 285
78 3300007129 Ga0102734_1000259 Ga0102734_100025913 285
79 3300012819 Ga0160468_105167 Ga0160468_1051672 285
80 3300042602 Ga0466713_034072 Ga0466713_034072_40458_41315 285
81 3300042625 Ga0466730_035437 Ga0466730_035437_2240_3097 285
82 3300042625 Ga0466730_063581 Ga0466730_063581_4017_4874 285
83 3300042649 Ga0466724_19220 Ga0466724_19220_4694_5551 285
84 iso_pr_bacteria 2519899623 2520392906 285
85 iso_pr_bacteria 2588253791 2588728317 285
86 iso_pr_bacteria 2687453742 2689989676 285
87 iso_pr_bacteria 2822856742 2822860055 285
88 iso_pr_bacteria 2824588292 2824592129 285
89 iso_pr_bacteria 2835143510 2835144054 285
90 iso_pr_bacteria 2938192669 2938193190 285
91 iso_pr_bacteria 648861007 648921483 285
92 iso_pr_bacteria 8004118532 8004119312 285
93 iso_pr_bacteria 8018312681 8018315349 285
94 iso_pr_bacteria 8103002986 8103003907 285
95 iso_pr_bacteria 8103008710 8103010809 285
96 3300002934 CVPL005W_1000298 CVPL005W_10002986 286
97 3300003973 Ga0063521_1000253 Ga0063521_100025334 286
98 3300005319 Ga0074304_1034497 Ga0074304_10344971 286
99 3300007052 Ga0102736_1001476 Ga0102736_10014763 286
100 3300007083 Ga0103261_1002658 Ga0103261_10026582 286
101 3300007106 Ga0104041_1110212 Ga0104041_11102122 286
102 3300007139 Ga0103260_1005860 Ga0103260_10058602 286
103 3300007140 Ga0102740_1008740 Ga0102740_10087401 286
104 3300007141 Ga0102738_1000371 Ga0102738_10003715 286
105 3300007142 Ga0102737_1000520 Ga0102737_10005202 286
106 3300007142 Ga0102737_1000683 Ga0102737_10006839 286
107 3300007188 Ga0103264_1000055 Ga0103264_100005538 286
108 3300007188 Ga0103264_1003128 Ga0103264_10031289 286
109 3300007190 Ga0103267_1000011 Ga0103267_100001139 286
110 3300007192 Ga0103268_1001147 Ga0103268_100114727 286
111 3300007767 Ga0105553_1034052 Ga0105553_10340525 286
112 3300009453 Ga0127656_100526 Ga0127656_10052615 286
113 3300042582 Ga0466657_216185 Ga0466657_216185_3280_4140 286
114 3300042598 Ga0466701_040221 Ga0466701_040221_60398_61258 286
115 iso_pr_bacteria 2537561600 2537923932 286
116 iso_pr_bacteria 2619619082 2620610567 286
117 iso_pr_bacteria 2871760914 2871765235 286
118 iso_pr_bacteria 2876358570 2876360200 286
119 iso_pr_bacteria 2937751072 2937751118 286
120 iso_pr_bacteria 3004010258 3004010612 286
121 iso_pr_bacteria 3007478678 3007483665 286
122 iso_pr_bacteria 648276708 648766953 286
123 iso_pr_bacteria 8099192374 8099196518 286
124 3300002931 CVPL010W_10000310 CVPL010W_100003107 287
125 3300002934 CVPL005W_1001322 CVPL005W_10013226 287
126 3300003973 Ga0063521_1000588 Ga0063521_100058814 287
127 3300007129 Ga0102734_1001187 Ga0102734_10011878 287
128 3300007149 Ga0104040_1142877 Ga0104040_11428772 287
129 3300007188 Ga0103264_1000568 Ga0103264_100056815 287
130 3300012812 Ga0160471_100129 Ga0160471_10012913 287
131 3300012837 Ga0160455_100873 Ga0160455_1008734 287
132 3300012845 Ga0160460_100353 Ga0160460_10035323 287
133 3300012854 Ga0160448_106834 Ga0160448_1068342 287
134 3300026175 Ga0255572_1000003 Ga0255572_100000342 287
135 3300042598 Ga0466701_091420 Ga0466701_091420_1404_2267 287
136 3300042649 Ga0466724_29344 Ga0466724_29344_5459_6349 287
137 iso_pr_bacteria 2806310572 2806767562 287
138 iso_pr_bacteria 8102982778 8102986775 287
139 3300002931 CVPL010W_10000599 CVPL010W_1000059939 288
140 3300007080 Ga0102735_1000090 Ga0102735_100009016 288
141 3300007080 Ga0102735_1001219 Ga0102735_10012194 288
142 3300007095 Ga0102739_1000270 Ga0102739_10002708 288
143 3300007106 Ga0104041_1001673 Ga0104041_100167312 288
144 3300007505 Ga0105005_1283228 Ga0105005_12832282 288
145 3300030930 Ga0316159_10001 Ga0316159_10001163 288
146 3300030930 Ga0316159_10081 Ga0316159_1008114 288
147 iso_pr_bacteria 2513020017 2513102136 288
148 iso_pr_bacteria 2531839602 2534152976 288
149 iso_pr_bacteria 2687453753 2690037879 288
150 iso_pr_bacteria 2836714267 2836717925 288
151 iso_pr_bacteria 2900132049 2900132691 288
152 iso_pr_bacteria 8067483258 8067484367 288
153 3300002931 CVPL010W_10000148 CVPL010W_1000014850 289
154 3300002931 CVPL010W_10000416 CVPL010W_1000041619 289
155 3300002934 CVPL005W_1000053 CVPL005W_10000534 289
156 3300003973 Ga0063521_1000071 Ga0063521_100007116 289
157 3300005316 Ga0074302_1024015 Ga0074302_10240153 289
158 3300007042 Ga0103263_100010 Ga0103263_10001035 289
159 3300007052 Ga0102736_1000023 Ga0102736_100002336 289
160 3300007052 Ga0102736_1003705 Ga0102736_10037052 289
161 3300007083 Ga0103261_1002360 Ga0103261_10023602 289
162 3300007106 Ga0104041_1110265 Ga0104041_11102652 289
163 3300007129 Ga0102734_1000524 Ga0102734_100052426 289
164 3300007139 Ga0103260_1000011 Ga0103260_100001110 289
165 3300007140 Ga0102740_1000001 Ga0102740_100000144 289
166 3300007142 Ga0102737_1003484 Ga0102737_10034843 289
167 3300007188 Ga0103264_1000138 Ga0103264_100013852 289
168 3300007188 Ga0103264_1000793 Ga0103264_10007934 289
169 iso_pr_bacteria 2603880170 2606028995 289
170 3300007083 Ga0103261_1000066 Ga0103261_100006625 290
171 3300007142 Ga0102737_1000013 Ga0102737_100001333 290
172 3300029809 Ga0309903_100004 Ga0309903_10000494 290
173 iso_pr_bacteria 2556921669 2558279918 290
174 iso_pr_bacteria 2651870110 2653795518 290
175 iso_pr_bacteria 2885043073 2885043463 290
176 iso_pr_bacteria 2885046828 2885047137 290
177 iso_pr_bacteria 2885050628 2885050761 290
178 iso_pr_bacteria 2885054481 2885058202 290
179 iso_pr_bacteria 2885058212 2885061464 290
180 iso_pr_bacteria 2885061987 2885062227 290
181 iso_pr_bacteria 2885065815 2885065942 290
182 3300007095 Ga0102739_1013182 Ga0102739_10131822 291
183 3300007141 Ga0102738_1000059 Ga0102738_10000598 291
184 3300029810 Ga0309904_1000017 Ga0309904_10000173 291
185 3300042598 Ga0466701_001909 Ga0466701_001909_21071_21946 291
186 iso_pr_bacteria 2609459925 2610643854 292
187 iso_pr_bacteria 2609459958 2610827720 292
188 iso_pr_bacteria 2627853677 2628496547 292
189 iso_pr_bacteria 2627854002 2629833027 292
190 iso_pr_bacteria 2630968716 2632958995 292
191 iso_pr_bacteria 2648501820 2651397444 292
192 iso_pr_bacteria 2896925746 2896929015 292
193 iso_pr_bacteria 8116627632 8116633439 292
194 3300002931 CVPL010W_10002473 CVPL010W_1000247311 293
195 3300003973 Ga0063521_1000033 Ga0063521_1000033101 294
196 iso_pr_bacteria 2971189173 2971190474 294
197 3300007140 Ga0102740_1000625 Ga0102740_10006259 295
198 3300007142 Ga0102737_1002406 Ga0102737_10024063 295
199 3300012841 Ga0160444_100017 Ga0160444_100017159 295
200 iso_pr_bacteria 2510065002 2510070057 296
201 iso_pr_bacteria 2529292851 2530234008 296
202 iso_pr_bacteria 2744054871 2745949724 296
203 iso_pr_bacteria 2836755666 2836757385 296
204 iso_pr_bacteria 2896187957 2896188952 296
205 iso_pr_bacteria 8101680043 8101680828 296
206 iso_pr_bacteria 8101683685 8101686316 296
207 iso_pr_bacteria 2844251356 2844254915 297
208 iso_pr_bacteria 2868883784 2868886418 297
209 3300007139 Ga0103260_1000378 Ga0103260_100037813 298
210 iso_pr_bacteria 2501651205 2501714414 301
211 iso_pr_bacteria 2585427605 2585888484 301
212 iso_pr_bacteria 2585428048 2587693182 301
213 iso_pr_bacteria 2531839005 2531868704 302
214 iso_pr_bacteria 2571042430 2572510987 302
215 iso_pr_bacteria 2636415586 2637166672 302
216 iso_pr_bacteria 2667527887 2669888135 302
217 iso_pr_bacteria 2731957638 2732529971 302
218 iso_pr_bacteria 8042061949 8042067373 302
219 iso_pr_bacteria 2832037495 2832037959 309
220 iso_pr_bacteria 8065338428 8065338810 309
221 3300002931 CVPL010W_10011331 CVPL010W_100113317 315

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00950 ABC-3 ABC 3 transport family 42 296 0.99
PF01032 FecCD FecCD transport family 85 293 0.79

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.78 0.84 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.