Protein Family IF00973
Metagenome
Isolate
221
Members
149
Samples
121
Scaffolds
286.53
Avg Length
Representative Sequence
- ID
- 3300002931|CVPL010W_10011331|CVPL010W_100113317
- Length
- 315 aa
- Sequence
- VPLRWDQASAQDTVNQISHPHPAMGAGSQHLFMELILEPFHYHYMQTAIWVCALVGAVCAFLSAYLMLKGWSLIGDALSHSIVPGVAGAWMLGLPFSLGAFAAGGLAASTMLFLRQRTRLREDVVIGLIFTSFFGLGLFMVSLSPMPINVNTIIMGNVLAITREDTVQLALIGVVSLALLMWKWRDLLAVFFDEQHAQSIGLNPFRLKLLFFALLSACTVAAMMTVGAFLVIAMVVTPGATAYLLSDRFLRLLAISVAIGAGSGALGAFISYFLDGATGGIIVLLQTALFLLAFFFSPSHGRLAARWRMRRAAP*
Sample Types
Isolate
45.2%
Metagenome
54.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
23.6%
Formicidae
16.7%
Apidae
11.8%
Drosophilidae
6.9%
Anthocoridae
6.2%
Curculionidae
4.9%
Termitidae
2.8%
Armadillidiidae
2.8%
Culicidae
2.8%
Tenebrionidae
2.1%
Talitridae
2.1%
Tephritidae
2.1%
Pteromalidae
1.4%
Nephropidae
1.4%
Aphididae
1.4%
Pentatomidae
1.4%
Sarcophagidae
1.4%
Calliphoridae
1.4%
Thripidae
0.7%
Muscidae
0.7%
Lysianassidae
0.7%
Daphniidae
0.7%
Rhopalidae
0.7%
Carabidae
0.7%
Plutellidae
0.7%
Crambidae
0.7%
Elmidae
0.7%
Cerambycidae
0.7%
Taxonomy
Archaea
0
Bacteria
181
Eukaryota
0
Viruses
0
Unclassified
40
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 2 | 2551306516 | Enterobacter hormaechei YT3 | Isolate | Tenebrionidae |
| 3 | 2571042430 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 4 | 2627854002 | Vibrio nigripulchritudo ENn2 | Isolate | Unclassified |
| 5 | 2871760914 | Pantoea ananatis PANS 01-2 | Isolate | Thripidae |
| 6 | 2937751072 | Serratia sp. OLMTLW26 | Isolate | Anthocoridae |
| 7 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 8 | 8073624232 | Bartonella sp. W8151 | Isolate | Apidae |
| 9 | 8102982778 | Erwinia sp. S63 | Isolate | Curculionidae |
| 10 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 11 | 2510065002 | Arsenophonus sp. ArN | Isolate | Pteromalidae |
| 12 | 2519899623 | Enterobacter sp. Ag1 | Isolate | Culicidae |
| 13 | 2531839005 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 14 | 2537561600 | Salmonella enterica enterica sv. Newport CVM 19443 | Isolate | Unclassified |
| 15 | 2588253791 | Yokenella regensburgei F. Haas DC-1, ATCC 49455 | Isolate | Unclassified |
| 16 | 2885050628 | Erwinia sp. OLMTSP26 | Isolate | Anthocoridae |
| 17 | 2885061987 | Erwinia sp. OLFS4 | Isolate | Anthocoridae |
| 18 | 2885065815 | Erwinia sp. OAMSP11 | Isolate | Anthocoridae |
| 19 | 2898991528 | Erwinia sp. OLMDLW33 | Isolate | Anthocoridae |
| 20 | 2900132049 | Bartonella massiliensis OS09 | Isolate | Unclassified |
| 21 | 8067483258 | Ochrobactrum soli MTP-C0764 | Isolate | Muscidae |
| 22 | 8068950955 | Bartonella apihabitans W8097 | Isolate | Apidae |
| 23 | 8073621894 | Bartonella apis W8099 | Isolate | Apidae |
| 24 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 25 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 26 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 27 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 28 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 29 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 30 | 2501651205 | Colwellia sp. MT41 | Isolate | Lysianassidae |
| 31 | 2531839602 | Shimwellia blattae NBRC 105725 | Isolate | Unclassified |
| 32 | 2556921669 | Shinella sp. DD12 | Isolate | Daphniidae |
| 33 | 2609459958 | Vibrio nigripulchritudo Wn13 | Isolate | Unclassified |
| 34 | 2630968716 | Vibrio nigripulchritudo AM115 | Isolate | Unclassified |
| 35 | 2806310572 | Pukyongiella litopenaei SH-1 | Isolate | Unclassified |
| 36 | 2835143510 | Yoonia maritima YPC211 | Isolate | Nephropidae |
| 37 | 2844251356 | Photobacterium leiognathi mandapamensis ajapo.3.1 | Isolate | Unclassified |
| 38 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 39 | 8068946563 | Bartonella apihabitans M0187 | Isolate | Apidae |
| 40 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 41 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 42 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 43 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 44 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 45 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 46 | 3300009453 | Microbial communities of aphids from Cornus sp. in New Haven, CT, USA - Anoecia fulviabdominalis seqcov | Metagenome | |
| 47 | 2507262005 | Candidatus Regiella insecticola R5.15 | Isolate | Aphididae |
| 48 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 49 | 2651870110 | Izhakiella capsodis N6PO6 | Isolate | Unclassified |
| 50 | 2751185856 | Bartonella apis BBC0244 | Isolate | Apidae |
| 51 | 2885046828 | Erwinia sp. OLCASP19 | Isolate | Anthocoridae |
| 52 | 2885054481 | Erwinia sp. OLMDSP33 | Isolate | Anthocoridae |
| 53 | 648276708 | Pantoea sp. aB | Isolate | Unclassified |
| 54 | 8073617375 | Bartonella apis W8098 | Isolate | Apidae |
| 55 | 8082291289 | Bartonella apihabitans K-FP28 | Isolate | Apidae |
| 56 | 3004010258 | Citrobacter sp. JGM124 | Isolate | Drosophilidae |
| 57 | 3300005319 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 2 gut | Metagenome | Drosophilidae |
| 58 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 59 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 60 | 3300007149 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut | Metagenome | Drosophilidae |
| 61 | 3300028918 | Ant gut bacterial community from Dolichoderus sp. 2-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC085 | Metagenome | Formicidae |
| 62 | 3300029810 | Ant gut bacterial community from Dolichoderus sp. 4-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC189 | Metagenome | Formicidae |
| 63 | 2585428048 | Colwellia sp. NBT2012 | Isolate | |
| 64 | 2588253732 | Klebsiella pneumoniae pneumoniae KP5-1 | Isolate | Pentatomidae |
| 65 | 2609459925 | Vibrio nigripulchritudo SO65 | Isolate | Unclassified |
| 66 | 2627853677 | Vibrio nigripulchritudo FTn2 | Isolate | Unclassified |
| 67 | 2648501628 | Xanthomonas sp. Cag60 | Isolate | Unclassified |
| 68 | 2731957638 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 69 | 2824588292 | Yokenella regensburgei WCD67 | Isolate | Rhopalidae |
| 70 | 2885058212 | Erwinia sp. OLTSP20 | Isolate | Anthocoridae |
| 71 | 2896925746 | Vibrio nigripulchritudo SFn27 | Isolate | Unclassified |
| 72 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 73 | 8065338428 | Ignatzschineria indica KCTC 22643 | Isolate | Sarcophagidae |
| 74 | 8068953321 | Bartonella apihabitans M0190 | Isolate | Apidae |
| 75 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
| 76 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 77 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 78 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 79 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 80 | 3300035363 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut | Metagenome | Plutellidae |
| 81 | 2551306531 | Enterobacter hormaechei YT2 | Isolate | Tenebrionidae |
| 82 | 2648501820 | Vibrio nigripulchritudo BLFn1 | Isolate | Unclassified |
| 83 | 2687453742 | Burkholderiales bacterium B_Cag20 | Isolate | Unclassified |
| 84 | 2744054871 | Candidatus Arsenophonus triatominarum ATi | Isolate | Unclassified |
| 85 | 2751185853 | Bartonella apis BBC0178 | Isolate | Apidae |
| 86 | 2837516909 | Rahnella bruchi DSM 27398 | Isolate | Unclassified |
| 87 | 2885043073 | Erwinia sp. OLSSP12 | Isolate | Anthocoridae |
| 88 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 89 | 648861007 | Candidatus Regiella insecticola LSR1 | Isolate | Aphididae |
| 90 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 91 | 8042061949 | Vibrio harveyi Hep-2a-10 | Isolate | Unclassified |
| 92 | 8068944069 | Bartonella choladocola W8125 | Isolate | Apidae |
| 93 | 8068955631 | Bartonella apihabitans M0280 | Isolate | Apidae |
| 94 | 8073628750 | Bartonella sp. W8167 | Isolate | Apidae |
| 95 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 96 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 97 | 3300007224 | Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut | Metagenome | Unclassified |
| 98 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 99 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 100 | 3300028910 | Ant gut bacterial community from Dolichoderus sp. 1-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC161 | Metagenome | Formicidae |
| 101 | 2513020017 | Shimwellia blattae DSM 4481 | Isolate | Unclassified |
| 102 | 2603880170 | Burkholderiales A2 | Isolate | Unclassified |
| 103 | 2751185858 | Bartonella apis BBC0122 | Isolate | Apidae |
| 104 | 2836714267 | Shimwellia blattae NCTC10965 | Isolate | |
| 105 | 2836755666 | Arsenophonus nasoniae FIN | Isolate | Pteromalidae |
| 106 | 2846386538 | Rahnella sp. AN3-3W3 | Isolate | Pentatomidae |
| 107 | 2864751016 | Pseudomonas oryzihabitans S00005 | Isolate | Elmidae |
| 108 | 2868883784 | Photobacterium leiognathi mandapamensis AJ-1a | Isolate | Unclassified |
| 109 | 2876358570 | Cronobacter sakazakii MOD1-Ls15g | Isolate | Calliphoridae |
| 110 | 2938192669 | Citrobacter sp. TSA-1 | Isolate | Unclassified |
| 111 | 8021546568 | Klebsiella sp. Kps | Isolate | Tephritidae |
| 112 | 8068941587 | Bartonella choladocola B10834H15 | Isolate | Apidae |
| 113 | 8073619611 | Bartonella apis B10834G6 | Isolate | Apidae |
| 114 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 115 | 8103002986 | Erwinia sp. S38 | Isolate | Curculionidae |
| 116 | 8103008710 | Erwinia sp. S43 | Isolate | Curculionidae |
| 117 | 2971189173 | Yersinia pestis A-1249 | Isolate | Unclassified |
| 118 | 3007478678 | Pseudomonas sp. S37 | Isolate | Curculionidae |
| 119 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 120 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 121 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 122 | 3300026175 | Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 | Metagenome | Formicidae |
| 123 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 124 | 8116627632 | Vibrio penaeicida NBRC 15640 | Isolate | Unclassified |
| 125 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 126 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 127 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 128 | 2547132185 | Enterobacter cancerogenus YZ1 | Isolate | Tenebrionidae |
| 129 | 2585427605 | Colwellia sp. MT2012 | Isolate | |
| 130 | 2619619082 | Pantoea agglomerans SL1_M5 | Isolate | Unclassified |
| 131 | 2636415586 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 132 | 2667527887 | Vibrio harveyi LMG 4044 | Isolate | Unclassified |
| 133 | 2687453753 | Burkholderiales bacterium B_Cag25 | Isolate | Unclassified |
| 134 | 2822856742 | Enterobacter cancerogenus CR-Eb1 | Isolate | Unclassified |
| 135 | 2832037495 | Ignatzschineria indica KCTC 22643 | Isolate | Sarcophagidae |
| 136 | 2839785767 | Thalassobius sp. I31.1 | Isolate | Nephropidae |
| 137 | 2874880541 | Enterobacter hormaechei E3442 | Isolate | Unclassified |
| 138 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 139 | 8021540981 | Klebsiella sp. Kpp | Isolate | Tephritidae |
| 140 | 8028002147 | Enterobacter sp. 10-1 | Isolate | Cerambycidae |
| 141 | 8073626464 | Bartonella apis W8152 | Isolate | Apidae |
| 142 | 8099192374 | Erwinia typographi IC4 | Isolate | Curculionidae |
| 143 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 144 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 145 | 3300005316 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 2 gut | Metagenome | Drosophilidae |
| 146 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 147 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 148 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 149 | 3300029809 | Ant gut bacterial community from Dolichoderus sp. 3-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC188 | Metagenome | Formicidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | CVPL010W_10000310 | 3300002931 | Bacteria | 47641 |
| 2 | CVPL005L_10006291 | 3300002938 | Unclassified | 12760 |
| 3 | Ga0104041_1001673 | 3300007106 | Bacteria | 13613 |
| 4 | Ga0103260_1000378 | 3300007139 | Bacteria | 11064 |
| 5 | Ga0102737_1000013 | 3300007142 | Bacteria | 54146 |
| 6 | Ga0103264_1000568 | 3300007188 | Unclassified | 18212 |
| 7 | Ga0104147_1013471 | 3300007224 | Bacteria | 22083 |
| 8 | FGTW_contig13745 | 2065487013 | Bacteria | 27070 |
| 9 | CVPL010W_10000416 | 3300002931 | Bacteria | 44245 |
| 10 | CVPL010L_1000020 | 3300002932 | Bacteria | 56498 |
| 11 | CVPL005W_1000298 | 3300002934 | Bacteria | 41676 |
| 12 | Ga0103266_1000067 | 3300007067 | Bacteria | 40296 |
| 13 | Ga0102735_1000090 | 3300007080 | Bacteria | 37625 |
| 14 | Ga0102739_1000270 | 3300007095 | Bacteria | 12300 |
| 15 | Ga0102734_1001187 | 3300007129 | Bacteria | 8121 |
| 16 | Ga0102737_1007154 | 3300007142 | Unclassified | 2057 |
| 17 | Ga0103264_1000294 | 3300007188 | Bacteria | 27491 |
| 18 | Ga0103264_1011929 | 3300007188 | Unclassified | 4258 |
| 19 | Ga0103268_1001147 | 3300007192 | Bacteria | 17672 |
| 20 | Ga0127656_100526 | 3300009453 | Bacteria | 33170 |
| 21 | Ga0160448_106834 | 3300012854 | Bacteria | 2799 |
| 22 | Ga0316159_10453 | 3300030930 | Unclassified | 6388 |
| 23 | Ga0247289_0139 | 3300035363 | Unclassified | 18899 |
| 24 | Ga0466657_216185 | 3300042582 | Bacteria | 22362 |
| 25 | CVPL010W_10001544 | 3300002931 | Bacteria | 27192 |
| 26 | Ga0074302_1024015 | 3300005316 | Bacteria | 2670 |
| 27 | Ga0102736_1000659 | 3300007052 | Unclassified | 7303 |
| 28 | Ga0102736_1003705 | 3300007052 | Bacteria | 2162 |
| 29 | Ga0103261_1002658 | 3300007083 | Unclassified | 2806 |
| 30 | Ga0104041_1110265 | 3300007106 | Unclassified | 3144 |
| 31 | Ga0102738_1000371 | 3300007141 | Unclassified | 7872 |
| 32 | Ga0103264_1003128 | 3300007188 | Bacteria | 10408 |
| 33 | Ga0466730_015559 | 3300042625 | Bacteria | 12801 |
| 34 | Ga0466701_040221 | 3300042598 | Bacteria | 71565 |
| 35 | Ga0466701_091420 | 3300042598 | Bacteria | 3300 |
| 36 | Ga0466713_034072 | 3300042602 | Bacteria | 82126 |
| 37 | Ga0466713_087423 | 3300042602 | Unclassified | 7667 |
| 38 | Ga0160455_100873 | 3300012837 | Bacteria | 11464 |
| 39 | Ga0160460_100353 | 3300012845 | Bacteria | 31451 |
| 40 | Ga0160433_101796 | 3300012846 | Unclassified | 5328 |
| 41 | FGTW_contig20739 | 2065487013 | Unclassified | 1440 |
| 42 | CVPL005W_1000053 | 3300002934 | Bacteria | 43713 |
| 43 | CVPL005W_1002750 | 3300002934 | Unclassified | 3230 |
| 44 | Ga0063521_1000253 | 3300003973 | Bacteria | 35555 |
| 45 | Ga0074278_123997 | 3300005721 | Bacteria | 11946 |
| 46 | Ga0103263_100010 | 3300007042 | Bacteria | 58538 |
| 47 | Ga0102736_1000668 | 3300007052 | Unclassified | 6624 |
| 48 | Ga0102736_1001476 | 3300007052 | Bacteria | 4125 |
| 49 | Ga0103261_1000510 | 3300007083 | Unclassified | 6341 |
| 50 | Ga0102739_1005546 | 3300007095 | Unclassified | 1721 |
| 51 | Ga0104041_1110212 | 3300007106 | Unclassified | 3341 |
| 52 | Ga0102734_1028000 | 3300007129 | Bacteria | 1969 |
| 53 | Ga0102740_1000625 | 3300007140 | Unclassified | 9659 |
| 54 | Ga0102740_1008740 | 3300007140 | Unclassified | 1656 |
| 55 | Ga0466724_29344 | 3300042649 | Unclassified | 10292 |
| 56 | Ga0255572_1000003 | 3300026175 | Bacteria | 262489 |
| 57 | Ga0247289_0148 | 3300035363 | Unclassified | 17928 |
| 58 | CVPL010W_10011331 | 3300002931 | Bacteria | 7956 |
| 59 | CVPL010W_10017285 | 3300002931 | Unclassified | 4721 |
| 60 | CVPL005W_1000207 | 3300002934 | Unclassified | 26220 |
| 61 | Ga0063521_1000071 | 3300003973 | Bacteria | 83397 |
| 62 | Ga0074278_104217 | 3300005721 | Unclassified | 4239 |
| 63 | Ga0102738_1000059 | 3300007141 | Bacteria | 45781 |
| 64 | Ga0102737_1007959 | 3300007142 | Bacteria | 1900 |
| 65 | Ga0103264_1000016 | 3300007188 | Bacteria | 116870 |
| 66 | Ga0103264_1000138 | 3300007188 | Bacteria | 73886 |
| 67 | Ga0103264_1000793 | 3300007188 | Bacteria | 14537 |
| 68 | Ga0103268_1005315 | 3300007192 | Bacteria | 2611 |
| 69 | DPOL_contig00004 | 2035918003 | Bacteria | 74609 |
| 70 | CVPL010W_10000308 | 3300002931 | Bacteria | 47673 |
| 71 | CVPL010W_10002473 | 3300002931 | Bacteria | 22039 |
| 72 | Ga0063521_1000588 | 3300003973 | Bacteria | 15372 |
| 73 | Ga0063521_1000782 | 3300003973 | Unclassified | 11474 |
| 74 | Ga0074304_1034497 | 3300005319 | Unclassified | 2793 |
| 75 | Ga0102736_1000023 | 3300007052 | Bacteria | 70447 |
| 76 | Ga0103261_1002360 | 3300007083 | Bacteria | 2963 |
| 77 | Ga0103261_1007994 | 3300007083 | Unclassified | 1501 |
| 78 | Ga0102739_1013182 | 3300007095 | Bacteria | 1065 |
| 79 | Ga0102734_1000259 | 3300007129 | Bacteria | 16478 |
| 80 | Ga0102734_1000524 | 3300007129 | Bacteria | 27056 |
| 81 | Ga0102738_1011482 | 3300007141 | Bacteria | 1216 |
| 82 | Ga0102737_1003484 | 3300007142 | Bacteria | 3582 |
| 83 | Ga0160471_100129 | 3300012812 | Bacteria | 30780 |
| 84 | Ga0466724_19220 | 3300042649 | Unclassified | 15959 |
| 85 | Ga0466724_47083 | 3300042649 | Bacteria | 378486 |
| 86 | Ga0160468_105167 | 3300012819 | Bacteria | 1505 |
| 87 | Ga0316159_10081 | 3300030930 | Bacteria | 19428 |
| 88 | CVPL010W_10000148 | 3300002931 | Bacteria | 57471 |
| 89 | CVPL010L_1000466 | 3300002932 | Unclassified | 8915 |
| 90 | Ga0063521_1000033 | 3300003973 | Bacteria | 118552 |
| 91 | Ga0103260_1000011 | 3300007139 | Bacteria | 101836 |
| 92 | Ga0103260_1005860 | 3300007139 | Bacteria | 1790 |
| 93 | Ga0102740_1000001 | 3300007140 | Bacteria | 144366 |
| 94 | Ga0102740_1014350 | 3300007140 | Unclassified | 1222 |
| 95 | Ga0102737_1000683 | 3300007142 | Bacteria | 10788 |
| 96 | Ga0102737_1002406 | 3300007142 | Unclassified | 4655 |
| 97 | Ga0105005_1283228 | 3300007505 | Unclassified | 1764 |
| 98 | Ga0466730_035437 | 3300042625 | Unclassified | 24782 |
| 99 | Ga0466713_073462 | 3300042602 | Bacteria | 5818 |
| 100 | Ga0160444_100017 | 3300012841 | Bacteria | 336790 |
| 101 | Ga0309902_000001 | 3300028910 | Bacteria | 348555 |
| 102 | Ga0309903_100004 | 3300029809 | Bacteria | 108343 |
| 103 | Ga0309904_1000017 | 3300029810 | Bacteria | 25067 |
| 104 | Ga0466701_001909 | 3300042598 | Bacteria | 24724 |
| 105 | CVPL010W_10000599 | 3300002931 | Bacteria | 39468 |
| 106 | CVPL005W_1001322 | 3300002934 | Bacteria | 6738 |
| 107 | Ga0063521_1000004 | 3300003973 | Bacteria | 302382 |
| 108 | Ga0103266_1011815 | 3300007067 | Unclassified | 1041 |
| 109 | Ga0102735_1001219 | 3300007080 | Bacteria | 4504 |
| 110 | Ga0103261_1000066 | 3300007083 | Bacteria | 33889 |
| 111 | Ga0102734_1020940 | 3300007129 | Unclassified | 2169 |
| 112 | Ga0102737_1000520 | 3300007142 | Unclassified | 12571 |
| 113 | Ga0104040_1142877 | 3300007149 | Bacteria | 2340 |
| 114 | Ga0103264_1000030 | 3300007188 | Bacteria | 85624 |
| 115 | Ga0103264_1000055 | 3300007188 | Bacteria | 65906 |
| 116 | Ga0103267_1000011 | 3300007190 | Bacteria | 88011 |
| 117 | Ga0105553_1034052 | 3300007767 | Unclassified | 6641 |
| 118 | Ga0466730_063581 | 3300042625 | Unclassified | 8787 |
| 119 | Ga0466724_17050 | 3300042649 | Unclassified | 1434 |
| 120 | Ga0309901_1000016 | 3300028918 | Bacteria | 176007 |
| 121 | Ga0316159_10001 | 3300030930 | Bacteria | 1642808 |
Family Sequences
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.78 | 0.84 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.