Protein Family IF00957

Metagenome Isolate
220 Members
168 Samples
74 Scaffolds
525.8 Avg Length

🧬 Representative Sequence

ID
3300002931|CVPL010W_10003099|CVPL010W_1000309917
Length
634 aa
Sequence
MTTGSDFRLTGDMLIGFSSVRGNAGSQRALNPATHSEIADPVFGMGDAQHVEQAARLAAQAFDTYRNLPLARRAAFLEAIAANIEDIGDALIDRAHAETGLPIARLQGERGRTVGQLRLFAKVVRDGHFLNATVDTAQPERTPLPRADLRLVNIPLGPVVVFGASNFPLAFSVAGGDTASALAAGAPVIVKAHSAHPGTCELVGRAIQKAVQDQGLPEGVFSLLFGAGRTLGEALVAHPAIKAVGFTGSRQGGLAILRIANARPEPIPVYAEMSSINPVFLLPAALASRAEKIAAAFADSLTMGAGQFCTNPGLILAVDGADLARFIQAAMLTPGIHAAYTDATAQVDSVAGVAKVAQGLGAGDQPNAAQAALYVTDAARLLATPQLLSEMFGPAAIVVRARSQEELLQVAEHLEGQLTATLQLDAADHAAAQQLLPVLERKAGRILANGFPTGVEVCHAMVHGGPFPSTSNAMFTSVGATAIARFLRPVCYQDLPEALRPAALQDANPLGLRRMTDGDHIRAGEERRPGGQRRSRRVCQRHYVVHTWLPSPAQQYGTGLLSDKCDHTSRPGNFQHASLACQYRPVRACGRRSGRKIREDRAPDAGRTGVRRPEKPVAGGRGRARAALYPAGA*

📊 Sample Types

Isolate 65.9%
Metagenome 34.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Coreidae 50.3%
Anthocoridae 8.3%
Culicidae 6.4%
Unclassified 5.1%
Curculionidae 5.1%
Formicidae 4.5%
Elmidae 3.8%
Armadillidiidae 3.8%
Apidae 2.5%
Termitidae 1.9%
Cerambycidae 1.9%
Berytidae 1.3%
Drosophilidae 1.3%
Largidae 1.3%
Alydidae 1.3%
Siricidae 0.6%
Crambidae 0.6%

🌳 Taxonomy

Archaea 0
Bacteria 209
Eukaryota 0
Viruses 0
Unclassified 11

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2065487013 Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm Metagenome
2 2718217944 Serratia marcescens AS1 Isolate Culicidae
3 2864853652 Pseudomonas rhodesiae S00114 Isolate Elmidae
4 2874434233 Serratia marcescens ADJS-2C_Red Isolate Unclassified
5 2961232173 Serratia sp. OLLOLW30 Isolate Anthocoridae
6 2970791725 Serratia sp. OLBL1 Isolate Anthocoridae
7 2996467878 Serratia sp. OLFL2 Isolate Anthocoridae
8 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
9 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
10 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
11 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
12 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
13 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
14 8025716094 Caballeronia zhejiangensis LZ028 Isolate Coreidae
15 8101960468 Caballeronia sp. AAUFL_F2_KS46 Isolate Coreidae
16 8101988189 Caballeronia sp. ATUFL_F1_KS4A Isolate Coreidae
17 8102014801 Caballeronia sp. ATUFL_M2_KS44 Isolate Coreidae
18 8102060671 Caballeronia sp. GAFFF2 Isolate Coreidae
19 8102152052 Caballeronia sp. LZ001 Isolate Coreidae
20 8102208438 Caballeronia sp. LZ032 Isolate Coreidae
21 8102251710 Caballeronia sp. LZ065 Isolate Coreidae
22 8102279326 Caballeronia sp. NCTM1 Isolate Coreidae
23 2032320009 Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine Metagenome Curculionidae
24 2864903489 Pseudomonas aeuginosa S00161 Isolate Elmidae
25 2922113941 Serratia sp. OLEL1 Isolate Anthocoridae
26 2937751072 Serratia sp. OLMTLW26 Isolate Anthocoridae
27 2958255616 Serratia marcescens TM Isolate
28 2965197371 Serratia sp. OLCL1 Isolate Anthocoridae
29 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
30 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
31 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
32 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
33 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
34 8025650824 Caballeronia hypogeia LZ032 Isolate Coreidae
35 8025671076 Caballeronia cordobensis LZ034LL Isolate Coreidae
36 8025735396 Caballeronia zhejiangensis LZ016 Isolate Coreidae
37 8102047609 Caballeronia sp. GACF5 Isolate Coreidae
38 8102074813 Caballeronia sp. GAWG1-1 Isolate Coreidae
39 8102081745 Caballeronia sp. GAWG1-5s-s Isolate Coreidae
40 8102117041 Caballeronia sp. INML3 Isolate Coreidae
41 8102131453 Caballeronia sp. INML5 Isolate Coreidae
42 8102138357 Caballeronia sp. INSB1 Isolate Coreidae
43 8102216467 Caballeronia sp. LZ033 Isolate Coreidae
44 8102230706 Caballeronia sp. LZ035 Isolate Coreidae
45 8102239244 Caballeronia sp. LZ043 Isolate Coreidae
46 2100351016 Sirex noctilio microbial communities from Pennsylvania, USA - adult community Metagenome Siricidae
47 2687453742 Burkholderiales bacterium B_Cag20 Isolate Unclassified
48 2833053935 Buttiauxella sp. 3AFRM03 Isolate Cerambycidae
49 2878947168 Serratia marcescens ADJS-2D_White Isolate Unclassified
50 2937735258 Serratia marcescens KZ11 Isolate Apidae
51 2961247850 Serratia sp. OLAL2 Isolate Anthocoridae
52 2978102237 Serratia fonticola AeS1 Isolate Culicidae
53 3300002464 Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 Metagenome Culicidae
54 3300012806 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG Metagenome
55 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
56 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
57 8004307473 Serratia sp. OLIL2 Isolate Anthocoridae
58 8004571736 Serratia sp. OLDL1 Isolate Anthocoridae
59 8023757577 Caballeronia peredens LP006 Isolate Coreidae
60 8023764196 Caballeronia peredens LZ001 Isolate Coreidae
61 8025678175 Caballeronia hypogeia LZ043 Isolate Coreidae
62 8025728939 Caballeronia telluris LZ024 Isolate Coreidae
63 8025747911 Caballeronia peredens LZ003 Isolate Coreidae
64 8035321120 Pseudomonas prosekii A2-NA12 Isolate Curculionidae
65 8069755105 Caballeronia sp. LZ003 Isolate Coreidae
66 8069775773 Caballeronia sp. LZ062 Isolate Coreidae
67 8101951471 Caballeronia sp. AAUFL_F1_KS45 Isolate Coreidae
68 8101974301 Caballeronia sp. ASUFL_F2_KS49 Isolate Coreidae
69 8101981714 Caballeronia sp. ATUFL_F1_KS39 Isolate Coreidae
70 8102026984 Caballeronia sp. AZ1_KS37 Isolate Coreidae
71 8102067727 Caballeronia sp. GAFFF3 Isolate Coreidae
72 2044078006 Dendroctonus frontalis bacterial communities from Mississippi, USA Metagenome Curculionidae
73 2847708326 Serratia liquefaciens P2ACOL2 Isolate Cerambycidae
74 2864745180 Pseudomonas rhodesiae S00002 Isolate Elmidae
75 2864847319 Pseudomonas alcaligenes S00099 Isolate Elmidae
76 2874504452 Serratia marcescens ADJS-2C_Purple Isolate Unclassified
77 2996406003 Serratia sp. OLJL1 Isolate Anthocoridae
78 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
79 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
80 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
81 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
82 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
83 8023724303 Caballeronia zhejiangensis LP003 Isolate Coreidae
84 8024001094 Caballeronia sp. TF1N1 Isolate Berytidae
85 8025666332 Caballeronia grimmiae LZ050 Isolate Coreidae
86 8025694439 Caballeronia cordobensis LZ033 Isolate Coreidae
87 8025701579 Caballeronia telluris LZ031 Isolate Coreidae
88 8052469819 Pseudomonas putida DZ-F23 Isolate
89 8101967387 Caballeronia sp. AAUFL_F3_KS11A Isolate Coreidae
90 8102007614 Caballeronia sp. ATUFL_M1_KS5A Isolate Coreidae
91 8102041249 Caballeronia sp. GACF4 Isolate Coreidae
92 8102087471 Caballeronia sp. GAWG2-1 Isolate Coreidae
93 8102201977 Caballeronia sp. LZ031 Isolate Coreidae
94 8102264549 Caballeronia sp. NCF2 Isolate Coreidae
95 2035918003 Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine Metagenome Curculionidae
96 2978161719 Serratia marcescens KZ2 Isolate Apidae
97 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
98 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
99 8024014383 Caballeronia sp. SL2Y3 Isolate Berytidae
100 8025740903 Caballeronia zhejiangensis LZ008 Isolate Coreidae
101 8069748016 Caballeronia sp. LP003 Isolate Coreidae
102 8102033761 Caballeronia sp. AZ7_KS35 Isolate Coreidae
103 8102094248 Caballeronia sp. GaOx3 Isolate Coreidae
104 8102109360 Caballeronia sp. INML2 Isolate Coreidae
105 8102145433 Caballeronia sp. LP006 Isolate Coreidae
106 8102186987 Caballeronia sp. LZ028 Isolate Coreidae
107 8102223607 Caballeronia sp. LZ034LL Isolate Coreidae
108 8102286609 Caballeronia sp. NCTM5 Isolate Coreidae
109 2603880172 Burkholderiales C Isolate Unclassified
110 2864751016 Pseudomonas oryzihabitans S00005 Isolate Elmidae
111 3007478678 Pseudomonas sp. S37 Isolate Curculionidae
112 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
113 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
114 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
115 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
116 3300012815 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG Metagenome
117 637000219 Pseudomonas entomophila L48 Isolate Unclassified
118 8025658853 Caballeronia temeraria LZ065 Isolate Coreidae
119 8025708040 Caballeronia jiangsuensis LZ029 Isolate Coreidae
120 8035326735 Pseudomonas prosekii A2-NA13 Isolate Curculionidae
121 8069770227 Caballeronia sp. LZ019 Isolate Coreidae
122 8101994502 Caballeronia sp. ATUFL_F2_KS42 Isolate Coreidae
123 8102124461 Caballeronia sp. INML3B Isolate Coreidae
124 8102193924 Caballeronia sp. LZ029 Isolate Coreidae
125 8102312426 Caballeronia sp. AAUFL_F1_KS47 Isolate Coreidae
126 2519899622 Pseudomonas sp. Ag1 Isolate Culicidae
127 2703719240 Serratia marcescens ano2 Isolate Unclassified
128 2864755708 Massilia timonae S00006 Isolate Elmidae
129 3003869270 Paraburkholderia sp. PGU16 Isolate Largidae
130 3006156446 Acinetobacter baretiae B10A Isolate Apidae
131 3007473699 Pseudomonas sp. S30 Isolate Curculionidae
132 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
133 8011329375 Pseudomonas sp. S31 Isolate Curculionidae
134 8023747282 Caballeronia zhejiangensis LZ019 Isolate Coreidae
135 8024025509 Caballeronia grimmiae Lep1A1 Isolate Coreidae
136 8024037630 Caballeronia zhejiangensis A33_M4_a Isolate Coreidae
137 8025685901 Caballeronia fortuita LZ035 Isolate Coreidae
138 8025723035 Caballeronia grimmiae LZ025 Isolate Coreidae
139 8025756023 Caballeronia peredens LZ002 Isolate Coreidae
140 8078130113 Caballeronia sp. INDeC2 Isolate Coreidae
141 8102054868 Caballeronia sp. GAFFF1 Isolate Coreidae
142 8102102351 Caballeronia sp. INML1 Isolate Coreidae
143 8102161003 Caballeronia sp. LZ002 Isolate Coreidae
144 8102174626 Caballeronia sp. LZ024 Isolate Coreidae
145 8102246966 Caballeronia sp. LZ050 Isolate Coreidae
146 2597489944 Caballeronia insecticola RPE64 Isolate Alydidae
147 2703719239 Serratia marcescens ano1 Isolate Unclassified
148 2855798354 Achromobacter insolitus AR476-2 Isolate Crambidae
149 2859315706 Serratia sp. 3ACOL1 Isolate Cerambycidae
150 2961206375 Serratia sp. OMLW3 Isolate Anthocoridae
151 3003878002 Paraburkholderia sp. PGU19 Isolate Largidae
152 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
153 3300005318 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut Metagenome Drosophilidae
154 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
155 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
156 8004285568 Serratia sp. OLHL2 Isolate Anthocoridae
157 8004541719 Serratia marcescens KZ19 Isolate Apidae
158 8004582426 Serratia sp. OSPLW9 Isolate Anthocoridae
159 8023752828 Caballeronia grimmiae LZ062 Isolate Coreidae
160 8024019580 Caballeronia sp. Lep1P3 Isolate Coreidae
161 8024031916 Cupriavidus pauculus BHJ32i Isolate Alydidae
162 8024044713 Caballeronia sp. Sq4a Isolate Coreidae
163 8035422605 Pseudomonas monteilii CY06 Isolate
164 8069763219 Caballeronia sp. LZ008 Isolate Coreidae
165 8102001125 Caballeronia sp. ATUFL_F2_KS9A Isolate Coreidae
166 8102169119 Caballeronia sp. LZ016 Isolate Coreidae
167 8102181083 Caballeronia sp. LZ025 Isolate Coreidae
168 8102271933 Caballeronia sp. NCF4 Isolate Coreidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0160470_100937 3300012813 Bacteria 8375
2 Ga0160441_100607 3300012825 Bacteria 22598
3 Ga0160435_1000856 3300012857 Unclassified 8388
4 Ga0466701_023976 3300042598 Bacteria 23279
5 Meta3P_1000404 3300002464 Bacteria 26174
6 CVPL010W_10000310 3300002931 Bacteria 47641
7 Ga0074188_1000430 3300005318 Bacteria 8763
8 Ga0102737_1003384 3300007142 Bacteria 3654
9 Ga0160470_104910 3300012813 Bacteria 1780
10 Ga0160453_100885 3300012814 Bacteria 14871
11 Ga0160467_101223 3300012829 Unclassified 11624
12 Ga0160444_100403 3300012841 Unclassified 22090
13 Ga0160433_100023 3300012846 Bacteria 189127
14 Ga0160433_100065 3300012846 Bacteria 116418
15 Ga0160433_100194 3300012846 Bacteria 49862
16 Ga0160448_104594 3300012854 Unclassified 3805
17 Ga0160457_1000507 3300012858 Bacteria 17099
18 Ga0466701_005142 3300042598 Bacteria 81661
19 Ga0466701_041012 3300042598 Bacteria 318638
20 CVPL010W_10003099 3300002931 Bacteria 26611
21 CVPL005W_1000053 3300002934 Bacteria 43713
22 CVPL005W_1000338 3300002934 Bacteria 21227
23 Ga0160466_100828 3300012809 Bacteria 11704
24 Ga0160440_100912 3300012815 Unclassified 5299
25 Ga0160446_100097 3300012835 Bacteria 83029
26 Ga0160448_100673 3300012854 Bacteria 11523
27 Ga0466701_025086 3300042598 Bacteria 26396
28 Ga0466724_20849 3300042649 Bacteria 16503
29 SPBB_contig10681 2044078006 Bacteria 147815
30 Ga0102734_1000420 3300007129 Bacteria 12172
31 Ga0160442_100084 3300012806 Bacteria 116419
32 Ga0160472_100316 3300012839 Bacteria 48018
33 Ga0160433_100223 3300012846 Bacteria 42423
34 Ga0466730_055452 3300042625 Bacteria 6156
35 DPO_contig00077 2032320009 Bacteria 49472
36 DPO_contig06335 2032320009 Bacteria 6146
37 DPOL_contig10521 2035918003 Unclassified 8190
38 DPOL_contig16646 2035918003 Unclassified 13262
39 SWWA_contig21926__length_2527___numreads_31 2100351016 Bacteria 2527
40 CVPL010L_1002112 3300002932 Unclassified 3418
41 Ga0102737_1000092 3300007142 Bacteria 27741
42 Ga0160469_100169 3300012824 Bacteria 66413
43 Ga0160441_101060 3300012825 Bacteria 11292
44 Ga0160444_100077 3300012841 Bacteria 130363
45 Ga0160443_103367 3300012848 Bacteria 2834
46 Ga0466701_044241 3300042598 Bacteria 190116
47 Ga0466724_45022 3300042649 Bacteria 46194
48 DPOL_contig00408 2035918003 Bacteria 77322
49 SWWA_contig29428__length_84023___numreads_4226 2100351016 Bacteria 84023
50 Meta3P_1000398 3300002464 Bacteria 24268
51 Ga0103264_1003187 3300007188 Bacteria 12898
52 Ga0160466_100141 3300012809 Bacteria 58648
53 Ga0160448_101060 3300012854 Unclassified 9065
54 Ga0466724_69469 3300042649 Bacteria 29864
55 DPO_contig03928 2032320009 Bacteria 7554
56 DPO_contig07325 2032320009 Bacteria 29497
57 Ga0105005_1032061 3300007505 Bacteria 24375
58 Ga0160464_100136 3300012805 Unclassified 80736
59 Ga0160442_100111 3300012806 Bacteria 91568
60 Ga0160469_100447 3300012824 Bacteria 19755
61 Ga0160447_102547 3300012849 Bacteria 6319
62 Ga0466730_020561 3300042625 Bacteria 24098
63 Ga0466724_10289 3300042649 Bacteria 7831
64 DPO_contig00097 2032320009 Bacteria 75068
65 SPBB_contig00035 2044078006 Bacteria 249649
66 FGTW_contig30505 2065487013 Bacteria 21168
67 Ga0160464_100052 3300012805 Bacteria 139907
68 Ga0160452_100070 3300012834 Bacteria 137182
69 Ga0160472_100439 3300012839 Bacteria 30779
70 Ga0160433_100014 3300012846 Bacteria 237201
71 Ga0466724_14140 3300042649 Bacteria 36535
72 SPBB_contig11508 2044078006 Bacteria 176712
73 Ga0103264_1001007 3300007188 Bacteria 12610
74 Ga0103268_1001914 3300007192 Unclassified 4846

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 iso_pr_bacteria 8025658853 8025665127 436
2 iso_pr_bacteria 8102251710 8102257984 436
3 3300012846 Ga0160433_100023 Ga0160433_10002392 458
4 2044078006 SPBB_contig00035 SPBB_271060 469
5 3300012841 Ga0160444_100403 Ga0160444_10040320 489
6 3300012846 Ga0160433_100014 Ga0160433_100014266 491
7 3300012809 Ga0160466_100141 Ga0160466_10014120 498
8 3300007188 Ga0103264_1001007 Ga0103264_100100711 502
9 3300012815 Ga0160440_100912 Ga0160440_1009124 503
10 3300002464 Meta3P_1000404 Meta3P_100040414 508
11 3300002934 CVPL005W_1000053 CVPL005W_100005334 509
12 3300012848 Ga0160443_103367 Ga0160443_1033673 510
13 3300012824 Ga0160469_100447 Ga0160469_10044715 511
14 2035918003 DPOL_contig00408 DPOLB_1906240 512
15 2032320009 DPO_contig03928 DPOB_461900 513
16 2044078006 SPBB_contig11508 SPBB_279860 513
17 3300042649 Ga0466724_45022 Ga0466724_45022_17814_19391 515
18 iso_pr_bacteria 2859315706 2859317153 516
19 3300012806 Ga0160442_100111 Ga0160442_10011152 517
20 3300012806 Ga0160442_100084 Ga0160442_10008462 519
21 3300012825 Ga0160441_100607 Ga0160441_1006077 520
22 3300005318 Ga0074188_1000430 Ga0074188_10004304 522
23 2032320009 DPO_contig00077 DPOB_89230 523
24 2032320009 DPO_contig07325 DPOB_134660 523
25 2035918003 DPOL_contig16646 DPOLB_683920 523
26 2044078006 SPBB_contig10681 SPBB_1189970 523
27 iso_pr_bacteria 2519899622 2520392027 523
28 iso_pr_bacteria 3006156446 3006157062 523
29 iso_pr_bacteria 8025735396 8025739416 523
30 iso_pr_bacteria 8102169119 8102173139 523
31 2035918003 DPOL_contig10521 DPOLB_1974760 524
32 3300012805 Ga0160464_100136 Ga0160464_10013667 524
33 3300012809 Ga0160466_100828 Ga0160466_1008284 524
34 3300012846 Ga0160433_100223 Ga0160433_1002232 524
35 3300042598 Ga0466701_044241 Ga0466701_044241_107201_108775 524
36 iso_pr_bacteria 2597489944 2598061038 524
37 iso_pr_bacteria 8025650824 8025657473 524
38 iso_pr_bacteria 8025671076 8025677684 524
39 iso_pr_bacteria 8025678175 8025684778 524
40 iso_pr_bacteria 8025685901 8025693527 524
41 iso_pr_bacteria 8025694439 8025700907 524
42 iso_pr_bacteria 8025708040 8025714418 524
43 iso_pr_bacteria 8078130113 8078134108 524
44 iso_pr_bacteria 8102094248 8102098307 524
45 iso_pr_bacteria 8102102351 8102106220 524
46 iso_pr_bacteria 8102109360 8102113237 524
47 iso_pr_bacteria 8102117041 8102121036 524
48 iso_pr_bacteria 8102124461 8102128446 524
49 iso_pr_bacteria 8102138357 8102142219 524
50 iso_pr_bacteria 8102193924 8102200300 524
51 iso_pr_bacteria 8102208438 8102215087 524
52 iso_pr_bacteria 8102216467 8102222935 524
53 iso_pr_bacteria 8102223607 8102230215 524
54 iso_pr_bacteria 8102230706 8102238332 524
55 iso_pr_bacteria 8102239244 8102245845 524
56 2032320009 DPO_contig00097 DPOB_114730 525
57 3300002932 CVPL010L_1002112 CVPL010L_10021124 525
58 3300012834 Ga0160452_100070 Ga0160452_10007048 525
59 3300042598 Ga0466701_005142 Ga0466701_005142_55762_57339 525
60 3300042598 Ga0466701_023976 Ga0466701_023976_8309_9886 525
61 3300042598 Ga0466701_044241 Ga0466701_044241_121954_123531 525
62 3300042649 Ga0466724_10289 Ga0466724_10289_2873_4450 525
63 3300042649 Ga0466724_20849 Ga0466724_20849_2890_4467 525
64 iso_pr_bacteria 2864751016 2864751323 525
65 iso_pr_bacteria 2864755708 2864756942 525
66 iso_pr_bacteria 2864847319 2864850123 525
67 iso_pr_bacteria 3003869270 3003874817 525
68 iso_pr_bacteria 3003878002 3003883088 525
69 iso_pr_bacteria 3007473699 3007476310 525
70 iso_pr_bacteria 3007478678 3007479463 525
71 iso_pr_bacteria 8011329375 8011331561 525
72 iso_pr_bacteria 8023747282 8023748342 525
73 iso_pr_bacteria 8023752828 8023753291 525
74 iso_pr_bacteria 8024014383 8024017940 525
75 iso_pr_bacteria 8024019580 8024023400 525
76 iso_pr_bacteria 8024025509 8024028649 525
77 iso_pr_bacteria 8024031916 8024032682 525
78 iso_pr_bacteria 8024037630 8024041619 525
79 iso_pr_bacteria 8024044713 8024047879 525
80 iso_pr_bacteria 8025666332 8025670874 525
81 iso_pr_bacteria 8025716094 8025721783 525
82 iso_pr_bacteria 8025723035 8025728276 525
83 iso_pr_bacteria 8025735396 8025738526 525
84 iso_pr_bacteria 8025740903 8025747146 525
85 iso_pr_bacteria 8035422605 8035426604 525
86 iso_pr_bacteria 8052469819 8052475396 525
87 iso_pr_bacteria 8069748016 8069752399 525
88 iso_pr_bacteria 8069763219 8069769462 525
89 iso_pr_bacteria 8069770227 8069771287 525
90 iso_pr_bacteria 8069775773 8069776236 525
91 iso_pr_bacteria 8101951471 8101955512 525
92 iso_pr_bacteria 8101960468 8101964467 525
93 iso_pr_bacteria 8101967387 8101971445 525
94 iso_pr_bacteria 8101974301 8101978245 525
95 iso_pr_bacteria 8101981714 8101985516 525
96 iso_pr_bacteria 8101988189 8101992030 525
97 iso_pr_bacteria 8101994502 8101998549 525
98 iso_pr_bacteria 8102001125 8102004886 525
99 iso_pr_bacteria 8102007614 8102011595 525
100 iso_pr_bacteria 8102014801 8102018782 525
101 iso_pr_bacteria 8102026984 8102030862 525
102 iso_pr_bacteria 8102033761 8102038061 525
103 iso_pr_bacteria 8102047609 8102051562 525
104 iso_pr_bacteria 8102054868 8102058358 525
105 iso_pr_bacteria 8102067727 8102071746 525
106 iso_pr_bacteria 8102081745 8102085412 525
107 iso_pr_bacteria 8102131453 8102135163 525
108 iso_pr_bacteria 8102169119 8102172249 525
109 iso_pr_bacteria 8102181083 8102186324 525
110 iso_pr_bacteria 8102186987 8102192674 525
111 iso_pr_bacteria 8102246966 8102251508 525
112 iso_pr_bacteria 8102264549 8102268425 525
113 iso_pr_bacteria 8102271933 8102275814 525
114 iso_pr_bacteria 8102279326 8102283392 525
115 iso_pr_bacteria 8102286609 8102290680 525
116 iso_pr_bacteria 8102312426 8102316261 525
117 2032320009 DPO_contig06335 DPOB_320360 526
118 2065487013 FGTW_contig30505 FGTW_01093670 526
119 3300002464 Meta3P_1000398 Meta3P_100039825 526
120 3300007142 Ga0102737_1000092 Ga0102737_100009220 526
121 3300012813 Ga0160470_100937 Ga0160470_1009372 526
122 3300012813 Ga0160470_104910 Ga0160470_1049101 526
123 3300012814 Ga0160453_100885 Ga0160453_1008854 526
124 3300012825 Ga0160441_101060 Ga0160441_1010604 526
125 3300012846 Ga0160433_100065 Ga0160433_10006573 526
126 3300012854 Ga0160448_104594 Ga0160448_1045943 526
127 iso_pr_bacteria 2519899622 2520388285 526
128 iso_pr_bacteria 2864745180 2864750924 526
129 iso_pr_bacteria 2864853652 2864858352 526
130 iso_pr_bacteria 3003869270 3003874033 526
131 iso_pr_bacteria 3003878002 3003883423 526
132 iso_pr_bacteria 3007478678 3007483572 526
133 iso_pr_bacteria 637000219 638002954 526
134 iso_pr_bacteria 8035321120 8035324770 526
135 iso_pr_bacteria 8035326735 8035331784 526
136 2100351016 SWWA_contig21926__length_2527___numreads_31 SWWA_02927640 527
137 2100351016 SWWA_contig29428__length_84023___numreads_4226 SWWA_01156720 527
138 3300007505 Ga0105005_1032061 Ga0105005_103206121 527
139 3300012829 Ga0160467_101223 Ga0160467_1012233 527
140 3300012835 Ga0160446_100097 Ga0160446_10009721 527
141 3300012849 Ga0160447_102547 Ga0160447_1025472 527
142 3300012854 Ga0160448_100673 Ga0160448_1006733 527
143 3300012854 Ga0160448_101060 Ga0160448_1010602 527
144 3300012857 Ga0160435_1000856 Ga0160435_10008566 527
145 iso_pr_bacteria 2864903489 2864907101 527
146 iso_pr_bacteria 3003869270 3003876506 527
147 iso_pr_bacteria 3003878002 3003884907 527
148 iso_pr_bacteria 8011329375 8011335144 527
149 iso_pr_bacteria 8025701579 8025701581 527
150 iso_pr_bacteria 8025728939 8025734506 527
151 iso_pr_bacteria 8035422605 8035426658 527
152 iso_pr_bacteria 8052469819 8052471223 527
153 iso_pr_bacteria 8102174626 8102180193 527
154 iso_pr_bacteria 8102201977 8102201979 527
155 3300007188 Ga0103264_1003187 Ga0103264_100318712 528
156 iso_pr_bacteria 2855798354 2855803918 528
157 iso_pr_bacteria 2864755708 2864756681 528
158 iso_pr_bacteria 8023724303 8023726452 528
159 iso_pr_bacteria 8023757577 8023759726 528
160 iso_pr_bacteria 8023764196 8023768338 528
161 iso_pr_bacteria 8024001094 8024004996 528
162 iso_pr_bacteria 8025747911 8025753549 528
163 iso_pr_bacteria 8025756023 8025761663 528
164 iso_pr_bacteria 8069755105 8069760743 528
165 iso_pr_bacteria 8102041249 8102044366 528
166 iso_pr_bacteria 8102060671 8102064078 528
167 iso_pr_bacteria 8102074813 8102078201 528
168 iso_pr_bacteria 8102087471 8102091300 528
169 iso_pr_bacteria 8102145433 8102147582 528
170 iso_pr_bacteria 8102152052 8102156194 528
171 iso_pr_bacteria 8102161003 8102163649 528
172 3300042625 Ga0466730_055452 Ga0466730_055452_2759_4348 529
173 iso_pr_bacteria 3003869270 3003875389 529
174 3300012858 Ga0160457_1000507 Ga0160457_100050711 530
175 3300002931 CVPL010W_10000310 CVPL010W_1000031020 531
176 3300012824 Ga0160469_100169 Ga0160469_1001696 531
177 3300012841 Ga0160444_100077 Ga0160444_100077121 531
178 3300042598 Ga0466701_025086 Ga0466701_025086_9559_11154 531
179 3300042625 Ga0466730_020561 Ga0466730_020561_3020_4615 531
180 3300042649 Ga0466724_69469 Ga0466724_69469_175_1770 531
181 3300002934 CVPL005W_1000338 CVPL005W_10003386 532
182 3300007129 Ga0102734_1000420 Ga0102734_10004206 532
183 iso_pr_bacteria 2687453742 2689987181 532
184 iso_pr_bacteria 2864745180 2864749076 532
185 3300007142 Ga0102737_1003384 Ga0102737_10033843 533
186 3300007192 Ga0103268_1001914 Ga0103268_10019145 533
187 3300012805 Ga0160464_100052 Ga0160464_100052104 533
188 iso_pr_bacteria 2603880172 2606034917 534
189 3300042649 Ga0466724_14140 Ga0466724_14140_30938_32590 536
190 iso_pr_bacteria 2847708326 2847710134 536
191 3300012839 Ga0160472_100316 Ga0160472_10031612 538
192 iso_pr_bacteria 2703719239 2706048833 538
193 iso_pr_bacteria 2703719240 2706054111 538
194 iso_pr_bacteria 2718217944 2719462182 538
195 iso_pr_bacteria 2833053935 2833054322 538
196 iso_pr_bacteria 2874434233 2874434809 538
197 iso_pr_bacteria 2878947168 2878949286 538
198 iso_pr_bacteria 2922113941 2922117232 538
199 iso_pr_bacteria 2937751072 2937751676 538
200 iso_pr_bacteria 2958255616 2958257096 538
201 iso_pr_bacteria 2961206375 2961206611 538
202 iso_pr_bacteria 2961232173 2961232303 538
203 iso_pr_bacteria 2961247850 2961249109 538
204 iso_pr_bacteria 2965197371 2965201080 538
205 iso_pr_bacteria 2970791725 2970793277 538
206 iso_pr_bacteria 2996406003 2996407792 538
207 iso_pr_bacteria 2996467878 2996470816 538
208 iso_pr_bacteria 8004285568 8004286227 538
209 iso_pr_bacteria 8004307473 8004309483 538
210 iso_pr_bacteria 8004541719 8004543826 538
211 iso_pr_bacteria 8004571736 8004573476 538
212 iso_pr_bacteria 8004582426 8004583233 538
213 iso_pr_bacteria 2978102237 2978106728 539
214 iso_pr_bacteria 2874504452 2874506042 546
215 3300012839 Ga0160472_100439 Ga0160472_10043919 549
216 3300042598 Ga0466701_041012 Ga0466701_041012_100873_102522 549
217 iso_pr_bacteria 2937735258 2937736246 550
218 iso_pr_bacteria 2978161719 2978163489 550
219 3300012846 Ga0160433_100194 Ga0160433_10019420 557
220 3300002931 CVPL010W_10003099 CVPL010W_1000309917 634

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00171 Aldedh Aldehyde dehydrogenase family 26 317 0.89

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00171 GO:0016491 oxidoreductase activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.71 0.81 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.