Protein Family IF00954

Metagenome Isolate
170 Members
94 Samples
112 Scaffolds
262.77 Avg Length

🧬 Representative Sequence

ID
3300002931|CVPL010W_10001028|CVPL010W_1000102811
Length
295 aa
Sequence
MTGMDMRTAAPPQGAKAPSADSAAGQAAQPGGIPFALQCTDVRKTFDGGLPGARPATDGVTLTISPGEFVVVIGGNGAGKSTLLNLIAGAVLPDHGSITLAGRDVTHLAPHRRAGLVTRVFQDPMIGTAAAMTIEENLALAERRGKPHRARPLLTSARRARYRDALHALGLGLEDRLSTRVSLLSGGQRQALSLLMAVVSEPQLLLLDEHTAALDPRTAQRVMDATLHAVAAHKLTTLMVTHNMRHAIATGNRLLMMDAGRIRLDVRDAEKAALTPEALVEQFNIDNDRMRLAH*

📊 Sample Types

Isolate 34.1%
Metagenome 65.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 26.9%
Termitidae 20.4%
Blattidae 15.1%
Formicidae 8.6%
Kalotermitidae 6.5%
Termopsidae 4.3%
Passalidae 3.2%
Hydrophilidae 2.2%
Stratiomyidae 2.2%
Rhinotermitidae 2.2%
Armadillidiidae 1.1%
Pyrrhocoridae 1.1%
Libellulidae 1.1%
Ceratopogonidae 1.1%
Scarabaeidae 1.1%
Dytiscidae 1.1%
Vespidae 1.1%
Hodotermitidae 1.1%

🌳 Taxonomy

Archaea 0
Bacteria 167
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820942695 Unclassified Actinobacteria Cu122P5bin37 Isolate Unclassified
2 2940339133 Breznakia sp. PF5-3 Isolate Blattidae
3 2940361758 Breznakia sp. PFB1-14 Isolate Blattidae
4 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
5 2820378768 Unclassified Firmicutes Nt197P1bin7 Isolate Unclassified
6 2820573558 Unclassified Firmicutes Emb289P3bin140 Isolate Unclassified
7 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
8 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
9 2820940989 Unclassified Actinobacteria Emb289P1bin20 Isolate Unclassified
10 2873565274 Diaphorobacter sp. HDW4A Isolate Hydrophilidae
11 2940359323 Breznakia sp. PFB1-12 Isolate Blattidae
12 2940366561 Breznakia sp. PFB1-4 Isolate Blattidae
13 2503538010 Coriobacterium glomerans PW2, DSM 20642 Isolate Pyrrhocoridae
14 2820393573 Unclassified Firmicutes Nc150P1bin9 Isolate Unclassified
15 2820587002 Unclassified Firmicutes Emb289P1bin94 Isolate Unclassified
16 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
17 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
18 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
19 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
20 3300026175 Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 Metagenome Formicidae
21 8114541043 Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 Isolate Libellulidae
22 2963635624 Unclassified Bacilli bacterium PM5-9 Isolate Blattidae
23 2820702360 Unclassified Firmicutes Co191P1bin4 Isolate Unclassified
24 8030343600 Proteiniborus sp. MB09-C3 Isolate Stratiomyidae
25 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
26 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
27 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
28 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
29 2820833147 Unclassified Actinobacteria Lab288P4bin85 Isolate Unclassified
30 2821322763 Unclassified Actinobacteria Cu122P5bin19 Isolate Unclassified
31 2914375287 Culicoidibacter larvae CS-1 Isolate Ceratopogonidae
32 2940368928 Breznakia sp. PFB2-30 Isolate Blattidae
33 2820353569 Unclassified Firmicutes Nt197P3bin28 Isolate Unclassified
34 2820385248 Unclassified Firmicutes Nt197P1bin19 Isolate Unclassified
35 2820431532 Unclassified Firmicutes Lab288P3bin230 Isolate Unclassified
36 2820539610 Unclassified Firmicutes Lab288P1bin136 Isolate Unclassified
37 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
38 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
39 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
40 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
41 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
42 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
43 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
44 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
45 2820525019 Unclassified Firmicutes Lab288P1bin2 Isolate Unclassified
46 2820630457 Unclassified Firmicutes Emb289P1bin119 Isolate Unclassified
47 2820637417 Unclassified Firmicutes Emb289P1bin108 Isolate Unclassified
48 2820639607 Unclassified Firmicutes Cu122P5bin9 Isolate Unclassified
49 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
50 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
51 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
52 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
53 8114537524 Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 Isolate
54 2940343849 Breznakia sp. PH5-24 Isolate Blattidae
55 2940352027 Breznakia sp. PH1-1 Isolate Blattidae
56 2508501067 Opitutaceae bacterium TAV1 Isolate Unclassified
57 2529293168 Ruminiclostridium cellobioparum termitidis CT1112 Isolate Termitidae
58 2634166424 Clostridium sp. L74 Isolate Scarabaeidae
59 2820389254 Unclassified Firmicutes Nc150P4bin19 Isolate Unclassified
60 2820533259 Unclassified Firmicutes Lab288P1bin140 Isolate Unclassified
61 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
62 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
63 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
64 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
65 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
66 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
67 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
68 3300007042 Ant gut microbial communities from Cephalotes pusillus, Brazil Metagenome Formicidae
69 2940354458 Breznakia sp. PF1-11 Isolate Blattidae
70 2873632256 Weissella coleopterorum HDW19 Isolate Dytiscidae
71 2788499854 Breznakia blatticola DSM 28867 Isolate Unclassified
72 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
73 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Formicidae
74 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
75 2873571580 Diaphorobacter sp. HDW4B Isolate Hydrophilidae
76 2881375749 Vagococcus entomophilus DSM 24756 Isolate Vespidae
77 2940236825 Breznakia sp. PM6-1 Isolate Blattidae
78 2940341480 Breznakia sp. PFB2-8 Isolate Blattidae
79 2940356891 Breznakia sp. PFB1-11 Isolate Blattidae
80 2940364193 Breznakia sp. PFB1-19 Isolate Blattidae
81 2963634138 Unclassified Bacilli bacterium PM5-3 Isolate Blattidae
82 2820907832 Unclassified Actinobacteria Emb289P4bin29 Isolate Unclassified
83 2820620956 Unclassified Firmicutes Emb289P1bin128 Isolate Unclassified
84 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
85 8030337018 Tissierella sp. Yu-01 Isolate Stratiomyidae
86 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
87 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
88 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
89 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
90 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
91 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
92 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
93 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
94 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466735_022237 3300042624 Bacteria 3836
2 Ga0466735_048575 3300042624 Bacteria 1570
3 Ga0123357_10005927 3300009784 Bacteria 14758
4 Ga0123357_10234223 3300009784 Bacteria 2004
5 Ga0123355_10194383 3300009826 Bacteria 2979
6 Ga0123353_10770946 3300010167 Bacteria 1334
7 Ga0123354_10027684 3300010882 Bacteria 8930
8 Ga0466701_100639 3300042598 Bacteria 3141
9 2227072186 2225789003 Bacteria 2560
10 2227115554 2225789004 Bacteria 1723
11 JGI24703J35330_11748066 3300002501 Bacteria 10346
12 Ga0068302_10457066 3300005071 Bacteria 2468
13 Ga0466715_008074 3300042616 Bacteria 42016
14 Ga0466704_147808 3300042643 Bacteria 1326
15 Ga0466727_144312 3300042655 Bacteria 40021
16 Ga0466727_335517 3300042655 Bacteria 3398
17 Ga0123355_10001558 3300009826 Bacteria 32004
18 Ga0123355_10014146 3300009826 Bacteria 12457
19 Ga0123355_10052135 3300009826 Bacteria 6638
20 Ga0123353_10913527 3300010167 Bacteria 1193
21 Ga0123354_10000016 3300010882 Bacteria 143427
22 Ga0123354_10026142 3300010882 Bacteria 9205
23 Ga0466706_004781 3300042599 Bacteria 2338
24 2227308576 2225789004 Bacteria 6536
25 IMNBL1DRAFT_c0001187 3300000062 Bacteria 19810
26 IMNBL1DRAFT_c0005035 3300000062 Bacteria 7705
27 Ga0103263_100136 3300007042 Bacteria 12716
28 Ga0102739_1000513 3300007095 Bacteria 7759
29 Ga0466733_222834 3300042659 Bacteria 2968
30 Ga0466696_333768 3300042596 Bacteria 19814
31 Ga0123356_10004078 3300010049 Bacteria 15176
32 Ga0123356_10071043 3300010049 Bacteria 3267
33 Ga0123353_10106926 3300010167 Bacteria 4507
34 Ga0123353_10478324 3300010167 Bacteria 1823
35 Ga0466707_121593 3300042601 Bacteria 1393
36 Ga0466719_055626 3300042606 Bacteria 3419
37 IMNBL1DRAFT_c0000008 3300000062 Bacteria 244959
38 IMNBL1DRAFT_c0001200 3300000062 Bacteria 19626
39 Ga0072940_1315738 3300005200 Bacteria 1133
40 Ga0103268_1000275 3300007192 Bacteria 16926
41 Ga0466711_085577 3300042615 Bacteria 1700
42 Ga0466711_274582 3300042615 Bacteria 1278
43 Ga0466723_334651 3300042618 Bacteria 3078
44 Ga0466729_054432 3300042621 Bacteria 18016
45 Ga0466657_157131 3300042582 Bacteria 2119
46 Ga0466724_25196 3300042649 Bacteria 102119
47 Ga0123357_10189462 3300009784 Bacteria 2375
48 Ga0123355_10000813 3300009826 Bacteria 42746
49 Ga0123355_10515933 3300009826 Bacteria 1465
50 Ga0123356_10292866 3300010049 Bacteria 1729
51 Ga0466706_285890 3300042599 Bacteria 2044
52 Ga0466714_098602 3300042603 Bacteria 2113
53 Ga0466719_123098 3300042606 Bacteria 142874
54 Ga0466719_456917 3300042606 Bacteria 3521
55 2227480187 2225789004 Bacteria 78142
56 IMNBL1DRAFT_c0007159 3300000062 Bacteria 5931
57 Ga0103264_1001635 3300007188 Bacteria 10640
58 Ga0466697_135808 3300042611 Bacteria 4063
59 Ga0466733_037464 3300042659 Bacteria 9749
60 Ga0466715_045534 3300042616 Bacteria 2021
61 Ga0466723_057032 3300042618 Bacteria 7164
62 Ga0466726_311275 3300042619 Bacteria 2485
63 Ga0160457_1018483 3300012858 Bacteria 979
64 Ga0466693_286303 3300042592 Bacteria 2004
65 Ga0466727_014447 3300042655 Bacteria 1736
66 Ga0123357_10184851 3300009784 Bacteria 2421
67 Ga0123355_10005323 3300009826 Bacteria 18809
68 Ga0466706_153978 3300042599 Unclassified 2807
69 2227541309 2225789004 Bacteria 15551
70 JGI24702J35022_10101384 3300002462 Bacteria 1576
71 Ga0103266_1000005 3300007067 Bacteria 128947
72 Ga0103267_1000277 3300007190 Bacteria 35660
73 Ga0123357_10000425 3300009784 Bacteria 40381
74 Ga0466715_031756 3300042616 Bacteria 47286
75 Ga0466715_552182 3300042616 Bacteria 4534
76 Ga0466723_015328 3300042618 Bacteria 8700
77 Ga0466723_315478 3300042618 Bacteria 2305
78 Ga0415639_033821 3300038395 Bacteria 4471
79 Ga0466725_267115 3300042654 Bacteria 1067
80 Ga0123355_10074984 3300009826 Unclassified 5417
81 Ga0123353_10187863 3300010167 Bacteria 3265
82 Ga0123353_11060548 3300010167 Bacteria 1081
83 Ga0466706_231091 3300042599 Unclassified 2665
84 Ga0466713_038929 3300042602 Bacteria 3702
85 Ga0466713_067268 3300042602 Bacteria 78584
86 Ga0466722_151666 3300042609 Bacteria 4382
87 IMNBL1DRAFT_c0000163 3300000062 Bacteria 59088
88 Ga0466733_176311 3300042659 Bacteria 1459
89 Ga0466711_071420 3300042615 Bacteria 2137
90 Ga0466729_206256 3300042621 Bacteria 13126
91 Ga0466702_129129 3300042635 Bacteria 1421
92 Ga0466724_37047 3300042649 Bacteria 249029
93 Ga0466727_069449 3300042655 Bacteria 3472
94 Ga0123357_10009026 3300009784 Bacteria 12543
95 Ga0123355_10217669 3300009826 Bacteria 2753
96 Ga0123356_10043994 3300010049 Bacteria 4157
97 Ga0123353_10632952 3300010167 Bacteria 1519
98 Ga0466706_090661 3300042599 Bacteria 13437
99 Ga0466706_275266 3300042599 Bacteria 2533
100 Ga0466713_061714 3300042602 Bacteria 16984
101 2227108611 2225789004 Bacteria 9454
102 JGI24703J35330_11746861 3300002501 Bacteria 5751
103 Ga0466733_020056 3300042659 Bacteria 1030
104 Ga0255572_1000058 3300026175 Bacteria 107648
105 Ga0123357_10049152 3300009784 Bacteria 5712
106 Ga0123355_10010528 3300009826 Bacteria 14189
107 Ga0466706_035905 3300042599 Bacteria 10172
108 Ga0466719_195390 3300042606 Bacteria 8446
109 2227330769 2225789004 Bacteria 29043
110 2227507402 2225789004 Bacteria 3640
111 IMNBL1DRAFT_c0002746 3300000062 Bacteria 11963
112 CVPL010W_10001028 3300002931 Bacteria 31984

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300009784 Ga0123357_10009026 Ga0123357_100090262 237
2 3300042601 Ga0466707_121593 Ga0466707_121593_660_1382 240
3 3300042582 Ga0466657_157131 Ga0466657_157131_1101_1886 244
4 3300010049 Ga0123356_10043994 Ga0123356_100439943 249
5 iso_pr_bacteria 8030337018 8030339008 249
6 3300010167 Ga0123353_10913527 Ga0123353_109135272 250
7 3300042621 Ga0466729_054432 Ga0466729_054432_5545_6297 250
8 3300042659 Ga0466733_020056 Ga0466733_020056_158_910 250
9 3300042659 Ga0466733_222834 Ga0466733_222834_598_1350 250
10 iso_pr_bacteria 2634166424 2635614466 251
11 3300005200 Ga0072940_1315738 Ga0072940_13157381 252
12 3300010882 Ga0123354_10026142 Ga0123354_100261423 252
13 3300042618 Ga0466723_334651 Ga0466723_334651_943_1749 252
14 3300042606 Ga0466719_195390 Ga0466719_195390_4721_5482 253
15 3300042615 Ga0466711_071420 Ga0466711_071420_955_1716 253
16 2225789004 2227507402 2227996356 254
17 3300009784 Ga0123357_10184851 Ga0123357_101848513 254
18 3300042611 Ga0466697_135808 Ga0466697_135808_3157_3921 254
19 2225789004 2227108611 2227496499 255
20 3300010049 Ga0123356_10292866 Ga0123356_102928662 255
21 3300010882 Ga0123354_10027684 Ga0123354_100276847 255
22 3300026175 Ga0255572_1000058 Ga0255572_100005889 256
23 3300042606 Ga0466719_456917 Ga0466719_456917_1519_2289 256
24 3300042655 Ga0466727_144312 Ga0466727_144312_33920_34690 256
25 2225789004 2227115554 2227506296 257
26 3300038395 Ga0415639_033821 Ga0415639_033821_1711_2505 257
27 3300042598 Ga0466701_100639 Ga0466701_100639_177_950 257
28 3300042602 Ga0466713_067268 Ga0466713_067268_75366_76139 257
29 iso_pr_bacteria 2820353569 2820356203 257
30 iso_pr_bacteria 2820833147 2820833240 257
31 iso_pr_bacteria 2820940989 2820941705 257
32 iso_pr_bacteria 2820942695 2820943032 257
33 iso_pr_bacteria 2821322763 2821322903 257
34 3300000062 IMNBL1DRAFT_c0007159 IMNBL1DRAFT_00071594 258
35 3300002462 JGI24702J35022_10101384 JGI24702J35022_101013842 258
36 3300009784 Ga0123357_10005927 Ga0123357_100059275 258
37 3300009826 Ga0123355_10014146 Ga0123355_100141469 258
38 3300010167 Ga0123353_10770946 Ga0123353_107709461 258
39 iso_pr_bacteria 2820907832 2820908042 258
40 iso_pr_bacteria 2881375749 2881376323 258
41 3300009784 Ga0123357_10000425 Ga0123357_1000042510 259
42 3300009784 Ga0123357_10049152 Ga0123357_100491524 259
43 3300009784 Ga0123357_10234223 Ga0123357_102342232 259
44 3300010882 Ga0123354_10000016 Ga0123354_1000001693 259
45 3300042603 Ga0466714_098602 Ga0466714_098602_751_1530 259
46 3300042609 Ga0466722_151666 Ga0466722_151666_623_1402 259
47 3300042649 Ga0466724_37047 Ga0466724_37047_17826_18605 259
48 iso_pr_bacteria 2873565274 2873566703 259
49 iso_pr_bacteria 2873571580 2873576774 259
50 iso_pr_bacteria 2873632256 2873632902 259
51 3300012858 Ga0160457_1018483 Ga0160457_10184832 260
52 3300042599 Ga0466706_035905 Ga0466706_035905_7284_8069 261
53 3300042599 Ga0466706_090661 Ga0466706_090661_6489_7274 261
54 3300042599 Ga0466706_153978 Ga0466706_153978_437_1222 261
55 3300042615 Ga0466711_085577 Ga0466711_085577_239_1024 261
56 3300042616 Ga0466715_552182 Ga0466715_552182_503_1288 261
57 iso_pr_bacteria 2820431532 2820432333 261
58 iso_pr_bacteria 8030343600 8030343835 261
59 iso_pr_bacteria 8114537524 8114537957 261
60 iso_pr_bacteria 8114541043 8114541842 261
61 2225789004 2227541309 2228063312 262
62 3300010167 Ga0123353_10187863 Ga0123353_101878631 262
63 3300042619 Ga0466726_311275 Ga0466726_311275_937_1725 262
64 3300042624 Ga0466735_022237 Ga0466735_022237_1676_2464 262
65 3300042655 Ga0466727_069449 Ga0466727_069449_1907_2695 262
66 3300007192 Ga0103268_1000275 Ga0103268_10002752 263
67 3300010049 Ga0123356_10004078 Ga0123356_100040786 263
68 3300042621 Ga0466729_206256 Ga0466729_206256_8061_8852 263
69 iso_pr_bacteria 2820533259 2820535047 263
70 iso_pr_bacteria 2820639607 2820640758 263
71 2225789003 2227072186 2227434801 264
72 2225789004 2227330769 2227778168 264
73 3300005071 Ga0068302_10457066 Ga0068302_104570662 264
74 3300007188 Ga0103264_1001635 Ga0103264_100163512 264
75 3300009826 Ga0123355_10010528 Ga0123355_1001052814 264
76 3300009826 Ga0123355_10194383 Ga0123355_101943833 264
77 3300042592 Ga0466693_286303 Ga0466693_286303_1017_1811 264
78 3300042599 Ga0466706_004781 Ga0466706_004781_593_1387 264
79 3300042599 Ga0466706_231091 Ga0466706_231091_107_901 264
80 3300042599 Ga0466706_275266 Ga0466706_275266_209_1003 264
81 3300042606 Ga0466719_055626 Ga0466719_055626_1493_2287 264
82 3300042606 Ga0466719_123098 Ga0466719_123098_17737_18531 264
83 3300042615 Ga0466711_274582 Ga0466711_274582_355_1149 264
84 3300042616 Ga0466715_045534 Ga0466715_045534_206_1000 264
85 3300042624 Ga0466735_048575 Ga0466735_048575_481_1275 264
86 3300042643 Ga0466704_147808 Ga0466704_147808_367_1161 264
87 3300042654 Ga0466725_267115 Ga0466725_267115_211_1005 264
88 3300042655 Ga0466727_014447 Ga0466727_014447_894_1688 264
89 3300042659 Ga0466733_176311 Ga0466733_176311_260_1054 264
90 iso_pr_bacteria 2503538010 2503576177 264
91 iso_pr_bacteria 2529293168 2531454307 264
92 iso_pr_bacteria 2820378768 2820380210 264
93 iso_pr_bacteria 2820385248 2820386282 264
94 iso_pr_bacteria 2820525019 2820525382 264
95 iso_pr_bacteria 2820630457 2820631961 264
96 iso_pr_bacteria 2820702360 2820703756 264
97 2225789004 2227480187 2227939201 265
98 3300000062 IMNBL1DRAFT_c0000008 IMNBL1DRAFT_0000008197 265
99 3300000062 IMNBL1DRAFT_c0000163 IMNBL1DRAFT_000016319 265
100 3300000062 IMNBL1DRAFT_c0001200 IMNBL1DRAFT_00012002 265
101 3300000062 IMNBL1DRAFT_c0002746 IMNBL1DRAFT_000274611 265
102 3300002501 JGI24703J35330_11746861 JGI24703J35330_117468619 265
103 3300002501 JGI24703J35330_11748066 JGI24703J35330_1174806612 265
104 3300007095 Ga0102739_1000513 Ga0102739_10005133 265
105 3300009784 Ga0123357_10189462 Ga0123357_101894622 265
106 3300009826 Ga0123355_10000813 Ga0123355_1000081316 265
107 3300009826 Ga0123355_10001558 Ga0123355_1000155825 265
108 3300009826 Ga0123355_10052135 Ga0123355_100521356 265
109 3300009826 Ga0123355_10217669 Ga0123355_102176692 265
110 3300010167 Ga0123353_10632952 Ga0123353_106329522 265
111 3300042602 Ga0466713_061714 Ga0466713_061714_14735_15532 265
112 3300042659 Ga0466733_037464 Ga0466733_037464_7829_8626 265
113 iso_pr_bacteria 2820539610 2820540291 265
114 iso_pr_bacteria 2788499854 2788759207 266
115 iso_pr_bacteria 2820393573 2820394858 266
116 iso_pr_bacteria 2820587002 2820588614 266
117 iso_pr_bacteria 2820620956 2820621082 266
118 iso_pr_bacteria 2820637417 2820638515 266
119 iso_pr_bacteria 2940236825 2940237838 266
120 iso_pr_bacteria 2940339133 2940340343 266
121 iso_pr_bacteria 2940341480 2940342497 266
122 iso_pr_bacteria 2940343849 2940344704 266
123 iso_pr_bacteria 2940352027 2940353615 266
124 iso_pr_bacteria 2940354458 2940355469 266
125 iso_pr_bacteria 2940356891 2940357903 266
126 iso_pr_bacteria 2940359323 2940360335 266
127 iso_pr_bacteria 2940361758 2940363347 266
128 iso_pr_bacteria 2940364193 2940365015 266
129 iso_pr_bacteria 2940366561 2940367192 266
130 iso_pr_bacteria 2940368928 2940369613 266
131 3300007067 Ga0103266_1000005 Ga0103266_100000540 267
132 3300007190 Ga0103267_1000277 Ga0103267_100027731 267
133 3300009826 Ga0123355_10005323 Ga0123355_100053233 267
134 3300009826 Ga0123355_10074984 Ga0123355_100749846 267
135 3300010167 Ga0123353_10478324 Ga0123353_104783242 267
136 3300042602 Ga0466713_038929 Ga0466713_038929_1732_2535 267
137 3300042618 Ga0466723_015328 Ga0466723_015328_7320_8123 267
138 3300042618 Ga0466723_057032 Ga0466723_057032_4150_4953 267
139 3300042655 Ga0466727_335517 Ga0466727_335517_642_1445 267
140 iso_pr_bacteria 2820389254 2820389783 267
141 iso_pr_bacteria 2914375287 2914375945 267
142 iso_pr_bacteria 2963634138 2963634394 267
143 iso_pr_bacteria 2963635624 2963636095 267
144 2225789004 2227308576 2227758395 268
145 3300000062 IMNBL1DRAFT_c0001187 IMNBL1DRAFT_00011878 268
146 3300007042 Ga0103263_100136 Ga0103263_1001367 268
147 3300009826 Ga0123355_10515933 Ga0123355_105159332 268
148 3300042616 Ga0466715_031756 Ga0466715_031756_31068_31874 268
149 3300042618 Ga0466723_315478 Ga0466723_315478_647_1453 268
150 3300042635 Ga0466702_129129 Ga0466702_129129_148_954 268
151 3300000062 IMNBL1DRAFT_c0005035 IMNBL1DRAFT_00050356 269
152 iso_pr_bacteria 2788499854 2788758773 269
153 iso_pr_bacteria 2940352027 2940352372 269
154 iso_pr_bacteria 2940354458 2940354803 269
155 iso_pr_bacteria 2940356891 2940357237 269
156 iso_pr_bacteria 2940359323 2940359691 269
157 iso_pr_bacteria 2940361758 2940362103 269
158 iso_pr_bacteria 2940364193 2940364538 269
159 iso_pr_bacteria 2940366561 2940367317 269
160 iso_pr_bacteria 2940368928 2940369295 269
161 iso_pr_bacteria 2508501067 2508838512 270
162 iso_pr_bacteria 2820573558 2820575304 271
163 3300010049 Ga0123356_10071043 Ga0123356_100710433 272
164 3300010167 Ga0123353_11060548 Ga0123353_110605482 272
165 3300042599 Ga0466706_285890 Ga0466706_285890_1045_1863 272
166 3300010167 Ga0123353_10106926 Ga0123353_101069262 277
167 3300042616 Ga0466715_008074 Ga0466715_008074_11951_12784 277
168 3300042596 Ga0466696_333768 Ga0466696_333768_6071_6916 281
169 3300042649 Ga0466724_25196 Ga0466724_25196_64871_65731 286
170 3300002931 CVPL010W_10001028 CVPL010W_1000102811 295

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00005 ABC_tran ABC transporter 58 212 0.94
PF02463 SMC_N RecF/RecN/SMC N terminal domain 68 225 0.65

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.83 0.88 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.