Protein Family IF00941

Metagenome Isolate
139 Members
61 Samples
122 Scaffolds
352.05 Avg Length

🧬 Representative Sequence

ID
3300002834|JGI24696J40584_12961125|JGI24696J40584_129611253
Length
406 aa
Sequence
MSPGPIFVKLAKNFLHSFKWVMERGCGLFQGVVQEKRGRRCGVETEFPFGGVMAWQGIVAEYKSFLPISEKTPIVSLHEGNTPLIYARNLAKFLGCPFELYLKFEGLNPTGSFKDRGMTLAISKAQEEGARAVVCASTGNTSASAAAYAARAGMKAFVLIPDGKIALGKLAQAVIHGAEVLQIAGNFDEALEIVRVLSEKYPMTLVNSLNPFRIEGQKTAAFEICDVLKTAPDLHFLPLGNAGNITAYWKGYREYHSAGNAHHLPKMYGIQAEGAAPFLAGKPIANPETIATAIRIGNPASWDGAMAAKKESGGRFEAVSDEEILAAYQTIARTEGVFCEPASAASVAGLMKVLKAKELPTARVVVCTLTGHGLKDPDSACRISSLPTKLEAKLSAVEKQIEKML*

📊 Sample Types

Isolate 12.2%
Metagenome 87.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 31.6%
Kalotermitidae 24.6%
Termitidae 24.6%
Termopsidae 7.0%
Rhinotermitidae 5.3%
Calliphoridae 1.8%
Hodotermitidae 1.8%
Armadillidiidae 1.8%
Culicidae 1.8%

🌳 Taxonomy

Archaea 0
Bacteria 123
Eukaryota 0
Viruses 0
Unclassified 16

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
2 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
3 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
4 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
5 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
6 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
7 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
8 2754412483 Unclassified Elusimicrobia Lab288P4bin38 Isolate Unclassified
9 2772190893 Unclassified Elusimicrobia Nt197P4_bin29 Isolate Unclassified
10 2820168331 Unclassified Proteobacteria Co191P3bin57 Isolate Unclassified
11 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
12 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
13 2772190891 Unclassified Elusimicrobia Emb289P1_bin41 Isolate Unclassified
14 2820134530 Unclassified Proteobacteria Emb289P3bin65 Isolate Unclassified
15 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
16 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
17 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
18 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
19 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
20 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
21 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
22 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
23 2772190892 Unclassified Elusimicrobia Lab288P3_bin37 Isolate Unclassified
24 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
25 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
26 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
27 2772190889 Unclassified Elusimicrobia Cu122P5_bin43 Isolate Unclassified
28 2820170025 Unclassified Proteobacteria Co191P1bin43 Isolate Unclassified
29 2852431164 Brevibacillus laterosporus BON707 Isolate Calliphoridae
30 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
31 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
32 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
33 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
34 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
35 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
36 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
37 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
38 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
39 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
40 2754412482 Unclassified Elusimicrobia Emb289P3bin85 Isolate Unclassified
41 2820053807 Unclassified Proteobacteria Th196P3bin117 Isolate Unclassified
42 2820818506 Unclassified Actinobacteria Nt197P3bin3 Isolate Unclassified
43 2820849606 Unclassified Actinobacteria Lab288P3bin39 Isolate Unclassified
44 2820922474 Unclassified Actinobacteria Emb289P3bin154 Isolate Unclassified
45 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
46 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
47 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
48 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
49 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
50 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
51 3300012806 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG Metagenome
52 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
53 642555172 Endomicrobium trichonymphae Rs-D17 Isolate Unclassified
54 2772190894 Unclassified Elusimicrobia Th196P4_bin33 Isolate Unclassified
55 2820166269 Unclassified Proteobacteria Co191P4bin16 Isolate Unclassified
56 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
57 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
58 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
59 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
60 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
61 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123356_10081872 3300010049 Bacteria 3055
2 Ga0123353_10001182 3300010167 Unclassified 31925
3 Ga0160457_1000068 3300012858 Bacteria 166662
4 Ga0466690_357085 3300042590 Bacteria 8208
5 Ga0466692_156593 3300042591 Bacteria 10262
6 Ga0466696_377217 3300042596 Unclassified 13142
7 AustNasuHG_c1005099 3300000089 Bacteria 4696
8 JGI24702J35022_10001028 3300002462 Bacteria 17444
9 JGI24699J35502_11124952 3300002509 Bacteria 3727
10 Ga0466706_263249 3300042599 Bacteria 2405
11 Ga0466716_483786 3300042605 Bacteria 13090
12 Ga0466715_312179 3300042616 Bacteria 29200
13 Ga0466723_141993 3300042618 Bacteria 7496
14 Ga0466726_437684 3300042619 Bacteria 18840
15 Ga0466704_342819 3300042643 Bacteria 15146
16 Ga0123354_10001270 3300010882 Bacteria 29971
17 JGI24699J35502_11133765 3300002509 Bacteria 15037
18 Ga0466706_254954 3300042599 Bacteria 21529
19 Ga0466722_005768 3300042609 Bacteria 9297
20 Ga0466715_213326 3300042616 Bacteria 1469
21 Ga0466715_297517 3300042616 Bacteria 34381
22 Ga0466728_035165 3300042620 Bacteria 39347
23 Ga0466728_126837 3300042620 Bacteria 6677
24 Ga0466729_240520 3300042621 Bacteria 2410
25 Ga0466704_286239 3300042643 Unclassified 6725
26 Ga0466704_546462 3300042643 Bacteria 26528
27 Ga0466704_552082 3300042643 Bacteria 15742
28 Ga0123356_10004106 3300010049 Bacteria 15123
29 Ga0123356_10341736 3300010049 Bacteria 1617
30 JGI24696J40584_12961125 3300002834 Bacteria 11022
31 Ga0068305_10000924 3300005083 Unclassified 65035
32 Ga0466719_110680 3300042606 Bacteria 14333
33 Ga0466719_163396 3300042606 Bacteria 5601
34 Ga0466711_127527 3300042615 Bacteria 31105
35 Ga0466711_386870 3300042615 Bacteria 27275
36 Ga0466715_046636 3300042616 Bacteria 70768
37 Ga0466715_340214 3300042616 Unclassified 3147
38 Ga0466728_336939 3300042620 Bacteria 13341
39 Ga0466729_016754 3300042621 Bacteria 37408
40 Ga0466705_373837 3300042612 Bacteria 12583
41 Ga0466729_268858 3300042621 Bacteria 59050
42 Ga0466735_039712 3300042624 Bacteria 14788
43 Ga0466703_205020 3300042636 Bacteria 117626
44 Ga0466704_104107 3300042643 Bacteria 6460
45 Ga0466727_298426 3300042655 Bacteria 81478
46 Ga0160452_100091 3300012834 Bacteria 119942
47 Ga0466656_055034 3300042550 Bacteria 1562
48 Ga0466691_015920 3300042593 Bacteria 62881
49 JGI24705J35276_12238736 3300002504 Bacteria 48239
50 Ga0466707_057336 3300042601 Bacteria 145123
51 Ga0466716_081603 3300042605 Bacteria 7289
52 Ga0466719_068744 3300042606 Bacteria 48898
53 Ga0466711_117944 3300042615 Bacteria 215972
54 Ga0466711_449830 3300042615 Bacteria 1649
55 Ga0466723_085453 3300042618 Bacteria 73497
56 Ga0466723_289367 3300042618 Bacteria 62014
57 Ga0466705_163529 3300042612 Bacteria 36737
58 Ga0466703_245834 3300042636 Bacteria 11270
59 Ga0466703_395188 3300042636 Bacteria 299836
60 Ga0466709_233182 3300042648 Bacteria 91749
61 Ga0264413_119869 3300024493 Bacteria 7158
62 Ga0466690_027505 3300042590 Bacteria 56259
63 Ga0466690_328962 3300042590 Bacteria 9147
64 Ga0466693_218291 3300042592 Bacteria 114325
65 Ga0068302_10014963 3300005071 Bacteria 5674
66 Ga0466706_037575 3300042599 Bacteria 87054
67 Ga0466719_033732 3300042606 Bacteria 51056
68 Ga0466728_134295 3300042620 Bacteria 11818
69 Ga0466735_033751 3300042624 Bacteria 5071
70 Ga0466704_284247 3300042643 Unclassified 4960
71 Ga0466725_426626 3300042654 Bacteria 2534
72 Ga0123357_10048511 3300009784 Bacteria 5754
73 Ga0123356_10004747 3300010049 Unclassified 14003
74 Ga0123356_10160050 3300010049 Unclassified 2247
75 Ga0160442_100214 3300012806 Bacteria 45764
76 Ga0160447_100025 3300012849 Bacteria 240193
77 Ga0466690_012951 3300042590 Bacteria 1605
78 Ga0466690_152083 3300042590 Bacteria 3409
79 Ga0466690_228886 3300042590 Bacteria 7745
80 Ga0466691_128099 3300042593 Unclassified 7720
81 Ga0466696_233593 3300042596 Bacteria 3453
82 Ga0466722_060636 3300042609 Bacteria 6497
83 Ga0466705_388248 3300042612 Bacteria 16143
84 Ga0466715_026286 3300042616 Bacteria 37068
85 Ga0466723_179660 3300042618 Bacteria 5516
86 Ga0466726_057733 3300042619 Bacteria 7920
87 Ga0466726_186470 3300042619 Bacteria 4299
88 Ga0466726_284750 3300042619 Unclassified 20964
89 Ga0466704_524423 3300042643 Unclassified 11486
90 Ga0466708_240445 3300042652 Bacteria 4310
91 Ga0123356_10145359 3300010049 Bacteria 2345
92 Ga0466691_051057 3300042593 Bacteria 5095
93 Ga0068305_10205850 3300005083 Bacteria 3051
94 Ga0466707_096029 3300042601 Bacteria 9378
95 Ga0466722_009279 3300042609 Bacteria 1715
96 Ga0466711_089711 3300042615 Bacteria 19674
97 Ga0466715_115336 3300042616 Bacteria 10605
98 Ga0466723_264127 3300042618 Bacteria 16085
99 Ga0466726_047707 3300042619 Bacteria 62318
100 Ga0466726_099748 3300042619 Bacteria 172717
101 Ga0466728_070494 3300042620 Bacteria 11218
102 Ga0466704_086571 3300042643 Bacteria 65985
103 Ga0466704_201577 3300042643 Bacteria 32720
104 Ga0123356_10001429 3300010049 Unclassified 26418
105 Ga0123353_10227625 3300010167 Bacteria 2910
106 Ga0160453_104278 3300012814 Bacteria 2668
107 Ga0466690_053135 3300042590 Unclassified 11667
108 Ga0068302_10150201 3300005071 Bacteria 1260
109 Ga0466714_019678 3300042603 Bacteria 23480
110 Ga0466716_209027 3300042605 Bacteria 15630
111 Ga0466711_152179 3300042615 Unclassified 19214
112 Ga0466711_303978 3300042615 Bacteria 4904
113 Ga0466723_080144 3300042618 Bacteria 15273
114 Ga0466723_106583 3300042618 Bacteria 10042
115 Ga0466723_152504 3300042618 Unclassified 10651
116 Ga0466726_130216 3300042619 Bacteria 1868
117 Ga0466729_080834 3300042621 Bacteria 4399
118 Ga0466705_143986 3300042612 Bacteria 113378
119 Ga0466705_358949 3300042612 Unclassified 4795
120 Ga0466734_164085 3300042623 Bacteria 8480
121 Ga0466704_459543 3300042643 Bacteria 5809
122 Ga0466725_364818 3300042654 Bacteria 6515

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 iso_pr_bacteria 2772190891 2773435107 296
2 3300042621 Ga0466729_016754 Ga0466729_016754_26576_27640 308
3 3300042599 Ga0466706_263249 Ga0466706_263249_253_1317 316
4 3300042621 Ga0466729_080834 Ga0466729_080834_247_1326 323
5 3300042612 Ga0466705_163529 Ga0466705_163529_10180_11271 328
6 3300042643 Ga0466704_552082 Ga0466704_552082_10036_11085 329
7 3300042615 Ga0466711_303978 Ga0466711_303978_2709_3794 330
8 3300042620 Ga0466728_134295 Ga0466728_134295_503_1594 330
9 3300042615 Ga0466711_089711 Ga0466711_089711_16740_17804 331
10 3300042654 Ga0466725_364818 Ga0466725_364818_3324_4394 331
11 3300012858 Ga0160457_1000068 Ga0160457_100006881 332
12 3300042601 Ga0466707_096029 Ga0466707_096029_7348_8412 332
13 3300042643 Ga0466704_201577 Ga0466704_201577_28894_29949 332
14 3300042616 Ga0466715_115336 Ga0466715_115336_230_1321 336
15 3300042618 Ga0466723_152504 Ga0466723_152504_9286_10377 336
16 3300042615 Ga0466711_449830 Ga0466711_449830_24_1043 339
17 3300042619 Ga0466726_284750 Ga0466726_284750_14662_15726 339
18 3300042654 Ga0466725_426626 Ga0466725_426626_202_1221 339
19 3300005071 Ga0068302_10150201 Ga0068302_101502011 340
20 3300042621 Ga0466729_268858 Ga0466729_268858_37149_38213 342
21 3300042621 Ga0466729_240520 Ga0466729_240520_289_1353 343
22 3300042636 Ga0466703_245834 Ga0466703_245834_7099_8154 345
23 3300010167 Ga0123353_10001182 Ga0123353_1000118231 346
24 3300042616 Ga0466715_046636 Ga0466715_046636_34260_35324 347
25 3300042643 Ga0466704_342819 Ga0466704_342819_1267_2331 347
26 3300042550 Ga0466656_055034 Ga0466656_055034_16_1101 348
27 3300042599 Ga0466706_254954 Ga0466706_254954_15868_16932 348
28 3300042605 Ga0466716_081603 Ga0466716_081603_5269_6333 348
29 3300042616 Ga0466715_340214 Ga0466715_340214_1970_3058 348
30 3300042619 Ga0466726_099748 Ga0466726_099748_71821_72885 348
31 3300005071 Ga0068302_10014963 Ga0068302_100149635 349
32 3300042590 Ga0466690_228886 Ga0466690_228886_1198_2247 349
33 3300042618 Ga0466723_289367 Ga0466723_289367_41374_42438 349
34 3300042643 Ga0466704_459543 Ga0466704_459543_2749_3798 349
35 3300002509 JGI24699J35502_11124952 JGI24699J35502_111249523 351
36 3300002509 JGI24699J35502_11133765 JGI24699J35502_111337658 351
37 3300005083 Ga0068305_10205850 Ga0068305_102058503 351
38 3300010049 Ga0123356_10004747 Ga0123356_100047476 351
39 3300042612 Ga0466705_373837 Ga0466705_373837_2033_3088 351
40 3300042615 Ga0466711_127527 Ga0466711_127527_4679_5734 351
41 3300024493 Ga0264413_119869 Ga0264413_1198695 352
42 3300042590 Ga0466690_357085 Ga0466690_357085_6502_7560 352
43 iso_pr_bacteria 2852431164 2852434218 352
44 3300042596 Ga0466696_233593 Ga0466696_233593_2137_3198 353
45 3300042606 Ga0466719_163396 Ga0466719_163396_905_1966 353
46 3300042616 Ga0466715_312179 Ga0466715_312179_4339_5400 353
47 3300042618 Ga0466723_141993 Ga0466723_141993_4418_5479 353
48 iso_pr_bacteria 2772190889 2773432449 353
49 3300042590 Ga0466690_012951 Ga0466690_012951_447_1511 354
50 3300042590 Ga0466690_027505 Ga0466690_027505_8185_9249 354
51 3300042590 Ga0466690_053135 Ga0466690_053135_8566_9630 354
52 3300042590 Ga0466690_152083 Ga0466690_152083_901_1965 354
53 3300042590 Ga0466690_328962 Ga0466690_328962_7874_8938 354
54 3300042593 Ga0466691_015920 Ga0466691_015920_7481_8545 354
55 3300042593 Ga0466691_051057 Ga0466691_051057_2050_3114 354
56 3300042593 Ga0466691_128099 Ga0466691_128099_2050_3114 354
57 3300042596 Ga0466696_377217 Ga0466696_377217_7306_8370 354
58 3300042606 Ga0466719_033732 Ga0466719_033732_7750_8814 354
59 3300042606 Ga0466719_068744 Ga0466719_068744_39974_41038 354
60 3300042609 Ga0466722_009279 Ga0466722_009279_141_1205 354
61 3300042612 Ga0466705_358949 Ga0466705_358949_2993_4057 354
62 3300042612 Ga0466705_388248 Ga0466705_388248_14841_15905 354
63 3300042615 Ga0466711_117944 Ga0466711_117944_27889_28953 354
64 3300042615 Ga0466711_152179 Ga0466711_152179_1653_2717 354
65 3300042616 Ga0466715_026286 Ga0466715_026286_23295_24359 354
66 3300042616 Ga0466715_213326 Ga0466715_213326_316_1380 354
67 3300042616 Ga0466715_297517 Ga0466715_297517_3467_4531 354
68 3300042618 Ga0466723_080144 Ga0466723_080144_4474_5538 354
69 3300042618 Ga0466723_085453 Ga0466723_085453_34272_35336 354
70 3300042618 Ga0466723_106583 Ga0466723_106583_904_1968 354
71 3300042618 Ga0466723_179660 Ga0466723_179660_3542_4606 354
72 3300042619 Ga0466726_057733 Ga0466726_057733_5125_6189 354
73 3300042619 Ga0466726_130216 Ga0466726_130216_337_1401 354
74 3300042619 Ga0466726_186470 Ga0466726_186470_2217_3281 354
75 3300042619 Ga0466726_437684 Ga0466726_437684_17204_18268 354
76 3300042620 Ga0466728_035165 Ga0466728_035165_1213_2277 354
77 3300042620 Ga0466728_070494 Ga0466728_070494_8273_9337 354
78 3300042620 Ga0466728_126837 Ga0466728_126837_443_1507 354
79 3300042620 Ga0466728_336939 Ga0466728_336939_1927_2991 354
80 3300042636 Ga0466703_395188 Ga0466703_395188_154195_155259 354
81 3300042643 Ga0466704_086571 Ga0466704_086571_54721_55785 354
82 3300042643 Ga0466704_104107 Ga0466704_104107_1619_2683 354
83 3300042643 Ga0466704_284247 Ga0466704_284247_1400_2464 354
84 3300042643 Ga0466704_524423 Ga0466704_524423_2028_3092 354
85 3300042643 Ga0466704_546462 Ga0466704_546462_4249_5313 354
86 3300042648 Ga0466709_233182 Ga0466709_233182_81119_82183 354
87 3300042652 Ga0466708_240445 Ga0466708_240445_790_1854 354
88 3300042655 Ga0466727_298426 Ga0466727_298426_10968_12032 354
89 iso_pr_bacteria 2754412483 2755216954 354
90 iso_pr_bacteria 2772190892 2773436272 354
91 iso_pr_bacteria 2772190893 2773437263 354
92 iso_pr_bacteria 2772190894 2773439696 354
93 iso_pr_bacteria 642555172 642790794 354
94 3300002462 JGI24702J35022_10001028 JGI24702J35022_100010289 355
95 3300002504 JGI24705J35276_12238736 JGI24705J35276_1223873626 355
96 3300005083 Ga0068305_10000924 Ga0068305_1000092447 355
97 3300010882 Ga0123354_10001270 Ga0123354_1000127014 355
98 3300042636 Ga0466703_205020 Ga0466703_205020_58781_59848 355
99 iso_pr_bacteria 2754412482 2755216219 355
100 iso_pr_bacteria 2820818506 2820820487 355
101 3300010049 Ga0123356_10001429 Ga0123356_1000142916 356
102 3300010049 Ga0123356_10081872 Ga0123356_100818723 356
103 3300042591 Ga0466692_156593 Ga0466692_156593_4787_5857 356
104 3300042605 Ga0466716_209027 Ga0466716_209027_7290_8360 356
105 3300042615 Ga0466711_386870 Ga0466711_386870_8984_10054 356
106 3300042624 Ga0466735_033751 Ga0466735_033751_1120_2190 356
107 3300042643 Ga0466704_286239 Ga0466704_286239_1400_2470 356
108 iso_pr_bacteria 2820134530 2820136194 356
109 3300000089 AustNasuHG_c1005099 AustNasuHG_10050993 357
110 3300009784 Ga0123357_10048511 Ga0123357_100485114 357
111 3300010049 Ga0123356_10004106 Ga0123356_100041067 357
112 3300010049 Ga0123356_10145359 Ga0123356_101453591 357
113 3300010049 Ga0123356_10160050 Ga0123356_101600502 357
114 3300010049 Ga0123356_10341736 Ga0123356_103417363 357
115 3300012849 Ga0160447_100025 Ga0160447_10002547 357
116 3300042605 Ga0466716_483786 Ga0466716_483786_5149_6222 357
117 3300042619 Ga0466726_047707 Ga0466726_047707_47524_48597 357
118 iso_pr_bacteria 2820922474 2820924265 357
119 3300042623 Ga0466734_164085 Ga0466734_164085_3344_4420 358
120 iso_pr_bacteria 2820053807 2820054041 358
121 3300010167 Ga0123353_10227625 Ga0123353_102276252 359
122 3300042612 Ga0466705_143986 Ga0466705_143986_101923_103002 359
123 3300042592 Ga0466693_218291 Ga0466693_218291_89000_90082 360
124 3300042601 Ga0466707_057336 Ga0466707_057336_41460_42542 360
125 3300042603 Ga0466714_019678 Ga0466714_019678_720_1802 360
126 3300042618 Ga0466723_264127 Ga0466723_264127_12414_13502 362
127 3300042599 Ga0466706_037575 Ga0466706_037575_46747_47838 363
128 iso_pr_bacteria 2820849606 2820850908 363
129 3300042609 Ga0466722_060636 Ga0466722_060636_2630_3751 364
130 3300012814 Ga0160453_104278 Ga0160453_1042782 365
131 3300012834 Ga0160452_100091 Ga0160452_10009158 365
132 3300042609 Ga0466722_005768 Ga0466722_005768_1702_2835 366
133 3300042624 Ga0466735_039712 Ga0466735_039712_13625_14725 366
134 3300012806 Ga0160442_100214 Ga0160442_1002149 373
135 iso_pr_bacteria 2820166269 2820167283 373
136 iso_pr_bacteria 2820168331 2820169324 373
137 iso_pr_bacteria 2820170025 2820171123 373
138 3300042606 Ga0466719_110680 Ga0466719_110680_12943_14238 396
139 3300002834 JGI24696J40584_12961125 JGI24696J40584_129611253 406

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00291 PALP Pyridoxal-phosphate dependent enzyme 75 371 0.95

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
6cgq-assembly1.cif.gz_A Threonine synthase from Bacillus subtilis ATCC 6633 with PLP and PLP-Ala 0.969 57 402
6cgq-assembly1.cif.gz_B-2 Threonine synthase from Bacillus subtilis ATCC 6633 with PLP and PLP-Ala 0.96 55 400
2zsj-assembly2.cif.gz_D Crystal structure of threonine synthase from Aquifex aeolicus VF5 0.952 55 401
2d1f-assembly1.cif.gz_B Structure of Mycobacterium tuberculosis threonine synthase 0.952 55 401
2zsj-assembly2.cif.gz_C Crystal structure of threonine synthase from Aquifex aeolicus VF5 0.949 55 401
IDDescriptionScoreStartEndSuperfamily
2d1fB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9628 55 401 3.40.50.1100
2d1fA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9185 114 209 3.40.50.1100
af_A0A1D6M0B0_306_515_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8852 224 405 3.40.50.1100
af_Q9SSP5_269_516_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.88 185 404 3.40.50.1100
2jc3H02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8723 108 206 3.40.50.1100
IDDescriptionScoreStartEndGO Terms
AF-A0A150MZX6-F1-model_v4 Threonine synthase 0.9807 53 403 GO:0003941
GO:0030170
GO:0004794
GO:0004795
GO:0009097
GO:0006565
GO:0006567
GO:0009088

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.82 0.9 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.