Protein Family IF00932
Metagenome
Isolate
123
Members
43
Samples
120
Scaffolds
246.15
Avg Length
Representative Sequence
- ID
- 3300002834|JGI24696J40584_12925051|JGI24696J40584_129250512
- Length
- 274 aa
- Sequence
- MGFISFFEFFTQIVLLLCVKKRGESIMLPIEVINVKKSFKDVRAVRGISLAIQSGEFVALLGPNGAGKTTMVEMMEGLRKPDSGEIRVMGKTWDKNEKELRKIIGLSLQETRFAEKLSVRETLHLFASFFELVTTRVDEVISLTGLEEKQKSMVGTLSGGQRQRLALAVALLNNPQILFLDEPTTGLDPHSRFDFWNILKELKARGETTLILTTHYMEEAESLCDRIIIMDEGVILKEGKLEDLLDEKTHNLDELFINLTGKTLNEDMNVISE*
Sample Types
Isolate
2.4%
Metagenome
97.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
51.2%
Kalotermitidae
23.3%
Unclassified
11.6%
Rhinotermitidae
7.0%
Termopsidae
7.0%
Taxonomy
Archaea
0
Bacteria
118
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 5 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 6 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 7 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 8 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 9 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 10 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 11 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 12 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 13 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 14 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 15 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 16 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 17 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 18 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 19 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 20 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 21 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 22 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 23 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 24 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 25 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 26 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 27 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 28 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 29 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 30 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 31 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 32 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 33 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 34 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 35 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 36 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 37 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 38 | 2820781750 | Unclassified Bacteroidetes Emb289P3bin89 | Isolate | Unclassified |
| 39 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 40 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 41 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 42 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 43 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_107336 | 3300042611 | Bacteria | 1457 |
| 2 | Ga0466705_222288 | 3300042612 | Bacteria | 12631 |
| 3 | Ga0123357_10289957 | 3300009784 | Bacteria | 1673 |
| 4 | Ga0123356_10047034 | 3300010049 | Bacteria | 4015 |
| 5 | Ga0123356_10096710 | 3300010049 | Bacteria | 2824 |
| 6 | Ga0123354_10153283 | 3300010882 | Bacteria | 2779 |
| 7 | Ga0123354_10354527 | 3300010882 | Bacteria | 1303 |
| 8 | JGI24696J40584_12925051 | 3300002834 | Bacteria | 1395 |
| 9 | Ga0466710_305502 | 3300042613 | Bacteria | 1527 |
| 10 | Ga0466715_223934 | 3300042616 | Bacteria | 10658 |
| 11 | Ga0466734_038611 | 3300042623 | Bacteria | 1123 |
| 12 | Ga0466735_184564 | 3300042624 | Bacteria | 2424 |
| 13 | Ga0466735_205363 | 3300042624 | Bacteria | 3293 |
| 14 | Ga0466735_233768 | 3300042624 | Bacteria | 1238 |
| 15 | Ga0123357_10047410 | 3300009784 | Bacteria | 5824 |
| 16 | Ga0123357_10263126 | 3300009784 | Unclassified | 1819 |
| 17 | Ga0123354_10000231 | 3300010882 | Bacteria | 49858 |
| 18 | Ga0466711_070305 | 3300042615 | Bacteria | 19616 |
| 19 | Ga0466711_211363 | 3300042615 | Bacteria | 9394 |
| 20 | Ga0466693_357536 | 3300042592 | Bacteria | 1255 |
| 21 | Ga0466707_285562 | 3300042601 | Bacteria | 8700 |
| 22 | Ga0466725_405038 | 3300042654 | Bacteria | 17206 |
| 23 | Ga0466697_150161 | 3300042611 | Bacteria | 2118 |
| 24 | JGI24699J35502_11134110 | 3300002509 | Bacteria | 31696 |
| 25 | JGI24696J40584_12954462 | 3300002834 | Bacteria | 2642 |
| 26 | Ga0466711_283506 | 3300042615 | Bacteria | 5158 |
| 27 | Ga0466707_038429 | 3300042601 | Bacteria | 31367 |
| 28 | Ga0466707_171331 | 3300042601 | Bacteria | 8704 |
| 29 | Ga0466719_266899 | 3300042606 | Bacteria | 2707 |
| 30 | Ga0466719_392710 | 3300042606 | Bacteria | 3731 |
| 31 | Ga0466698_166475 | 3300042610 | Bacteria | 1164 |
| 32 | Ga0466703_226455 | 3300042636 | Bacteria | 3274 |
| 33 | Ga0466727_240319 | 3300042655 | Bacteria | 3682 |
| 34 | Ga0123357_10021747 | 3300009784 | Bacteria | 8587 |
| 35 | Ga0123356_10013240 | 3300010049 | Bacteria | 7972 |
| 36 | Ga0123353_10075999 | 3300010167 | Bacteria | 5397 |
| 37 | Ga0123353_10899843 | 3300010167 | Bacteria | 1205 |
| 38 | JGI24702J35022_10042999 | 3300002462 | Bacteria | 2405 |
| 39 | JGI24696J40584_12885828 | 3300002834 | Bacteria | 1106 |
| 40 | Ga0466712_022819 | 3300042614 | Bacteria | 1568 |
| 41 | Ga0466711_090944 | 3300042615 | Bacteria | 9574 |
| 42 | Ga0466715_208973 | 3300042616 | Bacteria | 4735 |
| 43 | Ga0466729_013438 | 3300042621 | Bacteria | 20155 |
| 44 | Ga0466692_190403 | 3300042591 | Bacteria | 7652 |
| 45 | Ga0466691_150343 | 3300042593 | Bacteria | 3303 |
| 46 | Ga0466699_391919 | 3300042597 | Unclassified | 3036 |
| 47 | Ga0466707_198277 | 3300042601 | Bacteria | 1103 |
| 48 | Ga0466707_303412 | 3300042601 | Bacteria | 16171 |
| 49 | Ga0466713_021849 | 3300042602 | Bacteria | 33152 |
| 50 | Ga0466719_238468 | 3300042606 | Bacteria | 8524 |
| 51 | Ga0466735_041209 | 3300042624 | Bacteria | 2970 |
| 52 | Ga0466735_042814 | 3300042624 | Bacteria | 1267 |
| 53 | Ga0466735_052115 | 3300042624 | Bacteria | 23286 |
| 54 | Ga0466735_092670 | 3300042624 | Bacteria | 2034 |
| 55 | Ga0466735_122650 | 3300042624 | Bacteria | 1027 |
| 56 | Ga0466703_402764 | 3300042636 | Bacteria | 9092 |
| 57 | Ga0466704_494108 | 3300042643 | Bacteria | 2654 |
| 58 | Ga0466709_133004 | 3300042648 | Bacteria | 188114 |
| 59 | Ga0466727_048561 | 3300042655 | Bacteria | 4611 |
| 60 | Ga0466727_064569 | 3300042655 | Bacteria | 47217 |
| 61 | Ga0123357_10145573 | 3300009784 | Unclassified | 2896 |
| 62 | Ga0123356_10007720 | 3300010049 | Bacteria | 10712 |
| 63 | JGI24702J35022_10181873 | 3300002462 | Bacteria | 1195 |
| 64 | JGI24699J35502_11131536 | 3300002509 | Bacteria | 5784 |
| 65 | Ga0466711_174189 | 3300042615 | Bacteria | 4435 |
| 66 | Ga0466726_287212 | 3300042619 | Bacteria | 3127 |
| 67 | Ga0466728_103641 | 3300042620 | Bacteria | 2142 |
| 68 | Ga0466693_192960 | 3300042592 | Bacteria | 2821 |
| 69 | Ga0466691_016200 | 3300042593 | Bacteria | 5108 |
| 70 | Ga0466700_193127 | 3300042600 | Bacteria | 4826 |
| 71 | Ga0466731_087827 | 3300042622 | Bacteria | 1092 |
| 72 | Ga0466734_007127 | 3300042623 | Bacteria | 1219 |
| 73 | Ga0466735_031090 | 3300042624 | Bacteria | 2845 |
| 74 | Ga0466703_194794 | 3300042636 | Bacteria | 11339 |
| 75 | Ga0466703_321867 | 3300042636 | Bacteria | 6462 |
| 76 | Ga0466709_277602 | 3300042648 | Bacteria | 3339 |
| 77 | Ga0123357_10602944 | 3300009784 | Unclassified | 842 |
| 78 | Ga0123356_10009068 | 3300010049 | Bacteria | 9837 |
| 79 | Ga0123356_10072359 | 3300010049 | Bacteria | 3239 |
| 80 | Ga0123353_10093209 | 3300010167 | Bacteria | 4852 |
| 81 | Ga0123354_10335434 | 3300010882 | Bacteria | 1371 |
| 82 | JGI24696J40584_12952261 | 3300002834 | Bacteria | 2326 |
| 83 | Ga0466711_423922 | 3300042615 | Bacteria | 4599 |
| 84 | Ga0466728_340975 | 3300042620 | Bacteria | 2134 |
| 85 | Ga0466701_016618 | 3300042598 | Bacteria | 1183 |
| 86 | Ga0466707_271826 | 3300042601 | Bacteria | 4095 |
| 87 | Ga0466707_351028 | 3300042601 | Bacteria | 46236 |
| 88 | Ga0466719_357342 | 3300042606 | Bacteria | 3570 |
| 89 | Ga0466722_228305 | 3300042609 | Bacteria | 1447 |
| 90 | Ga0466735_041751 | 3300042624 | Bacteria | 10920 |
| 91 | Ga0466735_156709 | 3300042624 | Bacteria | 1871 |
| 92 | Ga0466735_161248 | 3300042624 | Bacteria | 1925 |
| 93 | Ga0466703_430981 | 3300042636 | Bacteria | 2862 |
| 94 | Ga0123354_10488494 | 3300010882 | Unclassified | 968 |
| 95 | JGI24702J35022_10025767 | 3300002462 | Bacteria | 3170 |
| 96 | Ga0123357_10001099 | 3300009784 | Bacteria | 28004 |
| 97 | Ga0466710_117809 | 3300042613 | Bacteria | 1019 |
| 98 | Ga0466711_228571 | 3300042615 | Bacteria | 4861 |
| 99 | Ga0466718_023933 | 3300042617 | Bacteria | 2480 |
| 100 | Ga0466693_158107 | 3300042592 | Bacteria | 2630 |
| 101 | Ga0466700_040163 | 3300042600 | Bacteria | 3184 |
| 102 | Ga0466707_150366 | 3300042601 | Bacteria | 4868 |
| 103 | Ga0466707_306634 | 3300042601 | Bacteria | 1970 |
| 104 | Ga0466707_388357 | 3300042601 | Bacteria | 2920 |
| 105 | Ga0466717_291119 | 3300042604 | Bacteria | 1823 |
| 106 | Ga0466716_296888 | 3300042605 | Bacteria | 12415 |
| 107 | Ga0466729_273974 | 3300042621 | Bacteria | 6059 |
| 108 | Ga0123356_10924095 | 3300010049 | Bacteria | 1044 |
| 109 | JGI24702J35022_10000560 | 3300002462 | Bacteria | 22482 |
| 110 | JGI24705J35276_12194389 | 3300002504 | Bacteria | 1511 |
| 111 | Ga0466705_489495 | 3300042612 | Bacteria | 2710 |
| 112 | Ga0466711_010624 | 3300042615 | Bacteria | 5414 |
| 113 | Ga0466711_374284 | 3300042615 | Bacteria | 8076 |
| 114 | Ga0466656_032277 | 3300042550 | Bacteria | 2210 |
| 115 | Ga0466693_405338 | 3300042592 | Bacteria | 3088 |
| 116 | Ga0466701_074447 | 3300042598 | Bacteria | 2988 |
| 117 | Ga0466735_110024 | 3300042624 | Bacteria | 5631 |
| 118 | Ga0466704_133981 | 3300042643 | Bacteria | 5175 |
| 119 | Ga0466704_329764 | 3300042643 | Bacteria | 6913 |
| 120 | Ga0466727_152017 | 3300042655 | Bacteria | 6086 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042623 | Ga0466734_038611 | Ga0466734_038611_46_729 | 227 |
| 2 | 3300002462 | JGI24702J35022_10025767 | JGI24702J35022_100257673 | 230 |
| 3 | 3300009784 | Ga0123357_10602944 | Ga0123357_106029441 | 230 |
| 4 | 3300042601 | Ga0466707_306634 | Ga0466707_306634_1262_1954 | 230 |
| 5 | 3300042592 | Ga0466693_192960 | Ga0466693_192960_1985_2701 | 238 |
| 6 | 3300042615 | Ga0466711_174189 | Ga0466711_174189_1038_1757 | 239 |
| 7 | iso_pr_bacteria | 2820781750 | 2820782547 | 239 |
| 8 | 3300042592 | Ga0466693_405338 | Ga0466693_405338_276_998 | 240 |
| 9 | 3300042609 | Ga0466722_228305 | Ga0466722_228305_332_1054 | 240 |
| 10 | 3300042611 | Ga0466697_107336 | Ga0466697_107336_555_1277 | 240 |
| 11 | 3300042613 | Ga0466710_117809 | Ga0466710_117809_164_886 | 240 |
| 12 | 3300042615 | Ga0466711_423922 | Ga0466711_423922_1921_2643 | 240 |
| 13 | 3300042624 | Ga0466735_233768 | Ga0466735_233768_367_1089 | 240 |
| 14 | 3300010049 | Ga0123356_10096710 | Ga0123356_100967102 | 241 |
| 15 | 3300010167 | Ga0123353_10075999 | Ga0123353_100759995 | 241 |
| 16 | 3300010167 | Ga0123353_10899843 | Ga0123353_108998432 | 241 |
| 17 | 3300042624 | Ga0466735_184564 | Ga0466735_184564_882_1607 | 241 |
| 18 | 3300042593 | Ga0466691_150343 | Ga0466691_150343_913_1641 | 242 |
| 19 | 3300042597 | Ga0466699_391919 | Ga0466699_391919_2078_2809 | 243 |
| 20 | 3300042601 | Ga0466707_351028 | Ga0466707_351028_15570_16301 | 243 |
| 21 | 3300042610 | Ga0466698_166475 | Ga0466698_166475_38_769 | 243 |
| 22 | 3300002462 | JGI24702J35022_10181873 | JGI24702J35022_101818731 | 244 |
| 23 | 3300010049 | Ga0123356_10072359 | Ga0123356_100723592 | 244 |
| 24 | 3300042598 | Ga0466701_016618 | Ga0466701_016618_367_1101 | 244 |
| 25 | 3300042615 | Ga0466711_070305 | Ga0466711_070305_18194_18928 | 244 |
| 26 | 3300042615 | Ga0466711_228571 | Ga0466711_228571_1337_2071 | 244 |
| 27 | 3300042619 | Ga0466726_287212 | Ga0466726_287212_1434_2168 | 244 |
| 28 | 3300042624 | Ga0466735_156709 | Ga0466735_156709_284_1018 | 244 |
| 29 | 3300042655 | Ga0466727_240319 | Ga0466727_240319_2003_2737 | 244 |
| 30 | 3300042592 | Ga0466693_158107 | Ga0466693_158107_878_1615 | 245 |
| 31 | 3300042601 | Ga0466707_150366 | Ga0466707_150366_2296_3033 | 245 |
| 32 | 3300042601 | Ga0466707_271826 | Ga0466707_271826_2623_3360 | 245 |
| 33 | 3300042601 | Ga0466707_388357 | Ga0466707_388357_656_1393 | 245 |
| 34 | 3300042604 | Ga0466717_291119 | Ga0466717_291119_434_1171 | 245 |
| 35 | 3300042612 | Ga0466705_222288 | Ga0466705_222288_3550_4287 | 245 |
| 36 | 3300042615 | Ga0466711_010624 | Ga0466711_010624_74_811 | 245 |
| 37 | 3300042617 | Ga0466718_023933 | Ga0466718_023933_690_1427 | 245 |
| 38 | 3300042620 | Ga0466728_340975 | Ga0466728_340975_844_1581 | 245 |
| 39 | 3300042621 | Ga0466729_273974 | Ga0466729_273974_1488_2225 | 245 |
| 40 | 3300042623 | Ga0466734_007127 | Ga0466734_007127_140_877 | 245 |
| 41 | 3300042624 | Ga0466735_031090 | Ga0466735_031090_957_1694 | 245 |
| 42 | 3300042624 | Ga0466735_041209 | Ga0466735_041209_1971_2708 | 245 |
| 43 | 3300042624 | Ga0466735_052115 | Ga0466735_052115_14461_15198 | 245 |
| 44 | 3300042624 | Ga0466735_110024 | Ga0466735_110024_4842_5579 | 245 |
| 45 | 3300042624 | Ga0466735_161248 | Ga0466735_161248_620_1357 | 245 |
| 46 | 3300042624 | Ga0466735_205363 | Ga0466735_205363_923_1660 | 245 |
| 47 | 3300042654 | Ga0466725_405038 | Ga0466725_405038_3577_4314 | 245 |
| 48 | 3300002462 | JGI24702J35022_10000560 | JGI24702J35022_1000056011 | 246 |
| 49 | 3300002504 | JGI24705J35276_12194389 | JGI24705J35276_121943891 | 246 |
| 50 | 3300010049 | Ga0123356_10009068 | Ga0123356_100090688 | 246 |
| 51 | 3300010049 | Ga0123356_10013240 | Ga0123356_100132404 | 246 |
| 52 | 3300010049 | Ga0123356_10047034 | Ga0123356_100470342 | 246 |
| 53 | 3300010167 | Ga0123353_10093209 | Ga0123353_100932092 | 246 |
| 54 | 3300042550 | Ga0466656_032277 | Ga0466656_032277_440_1180 | 246 |
| 55 | 3300042593 | Ga0466691_016200 | Ga0466691_016200_4224_4964 | 246 |
| 56 | 3300042598 | Ga0466701_074447 | Ga0466701_074447_1184_1924 | 246 |
| 57 | 3300042601 | Ga0466707_198277 | Ga0466707_198277_25_765 | 246 |
| 58 | 3300042602 | Ga0466713_021849 | Ga0466713_021849_26606_27346 | 246 |
| 59 | 3300042615 | Ga0466711_090944 | Ga0466711_090944_8412_9152 | 246 |
| 60 | 3300042615 | Ga0466711_211363 | Ga0466711_211363_8200_8940 | 246 |
| 61 | 3300042615 | Ga0466711_374284 | Ga0466711_374284_5419_6159 | 246 |
| 62 | 3300042616 | Ga0466715_208973 | Ga0466715_208973_216_956 | 246 |
| 63 | 3300042616 | Ga0466715_223934 | Ga0466715_223934_1586_2326 | 246 |
| 64 | 3300042621 | Ga0466729_013438 | Ga0466729_013438_4714_5454 | 246 |
| 65 | 3300042624 | Ga0466735_042814 | Ga0466735_042814_432_1172 | 246 |
| 66 | 3300042643 | Ga0466704_133981 | Ga0466704_133981_2861_3601 | 246 |
| 67 | 3300042643 | Ga0466704_329764 | Ga0466704_329764_4968_5708 | 246 |
| 68 | 3300042648 | Ga0466709_133004 | Ga0466709_133004_50197_50937 | 246 |
| 69 | 3300042655 | Ga0466727_064569 | Ga0466727_064569_35247_35987 | 246 |
| 70 | 3300042655 | Ga0466727_152017 | Ga0466727_152017_1485_2225 | 246 |
| 71 | iso_pr_bacteria | 2820762746 | 2820764035 | 246 |
| 72 | 3300002509 | JGI24699J35502_11134110 | JGI24699J35502_111341105 | 247 |
| 73 | 3300002834 | JGI24696J40584_12954462 | JGI24696J40584_129544622 | 247 |
| 74 | 3300010049 | Ga0123356_10924095 | Ga0123356_109240951 | 247 |
| 75 | 3300010882 | Ga0123354_10153283 | Ga0123354_101532832 | 247 |
| 76 | 3300042592 | Ga0466693_357536 | Ga0466693_357536_320_1063 | 247 |
| 77 | 3300042600 | Ga0466700_040163 | Ga0466700_040163_2411_3154 | 247 |
| 78 | 3300042600 | Ga0466700_193127 | Ga0466700_193127_2668_3411 | 247 |
| 79 | 3300042601 | Ga0466707_303412 | Ga0466707_303412_4574_5317 | 247 |
| 80 | 3300042605 | Ga0466716_296888 | Ga0466716_296888_3505_4248 | 247 |
| 81 | 3300042606 | Ga0466719_357342 | Ga0466719_357342_1770_2513 | 247 |
| 82 | 3300042606 | Ga0466719_392710 | Ga0466719_392710_2163_2906 | 247 |
| 83 | 3300042611 | Ga0466697_150161 | Ga0466697_150161_336_1079 | 247 |
| 84 | 3300042613 | Ga0466710_305502 | Ga0466710_305502_512_1255 | 247 |
| 85 | 3300042614 | Ga0466712_022819 | Ga0466712_022819_711_1454 | 247 |
| 86 | 3300042622 | Ga0466731_087827 | Ga0466731_087827_91_834 | 247 |
| 87 | 3300042624 | Ga0466735_041751 | Ga0466735_041751_5360_6103 | 247 |
| 88 | 3300042636 | Ga0466703_194794 | Ga0466703_194794_3791_4534 | 247 |
| 89 | 3300042636 | Ga0466703_226455 | Ga0466703_226455_2131_2874 | 247 |
| 90 | 3300042636 | Ga0466703_321867 | Ga0466703_321867_172_915 | 247 |
| 91 | 3300042636 | Ga0466703_402764 | Ga0466703_402764_4528_5271 | 247 |
| 92 | 3300042636 | Ga0466703_430981 | Ga0466703_430981_1264_2007 | 247 |
| 93 | 3300042648 | Ga0466709_277602 | Ga0466709_277602_622_1365 | 247 |
| 94 | 3300002462 | JGI24702J35022_10042999 | JGI24702J35022_100429992 | 248 |
| 95 | 3300002834 | JGI24696J40584_12885828 | JGI24696J40584_128858281 | 248 |
| 96 | 3300009784 | Ga0123357_10001099 | Ga0123357_1000109918 | 248 |
| 97 | 3300009784 | Ga0123357_10021747 | Ga0123357_100217474 | 248 |
| 98 | 3300009784 | Ga0123357_10047410 | Ga0123357_100474104 | 248 |
| 99 | 3300009784 | Ga0123357_10145573 | Ga0123357_101455733 | 248 |
| 100 | 3300009784 | Ga0123357_10263126 | Ga0123357_102631264 | 248 |
| 101 | 3300010049 | Ga0123356_10007720 | Ga0123356_100077203 | 248 |
| 102 | 3300010882 | Ga0123354_10335434 | Ga0123354_103354341 | 248 |
| 103 | 3300010882 | Ga0123354_10354527 | Ga0123354_103545271 | 248 |
| 104 | 3300010882 | Ga0123354_10488494 | Ga0123354_104884941 | 248 |
| 105 | 3300042591 | Ga0466692_190403 | Ga0466692_190403_473_1219 | 248 |
| 106 | 3300042601 | Ga0466707_038429 | Ga0466707_038429_21051_21797 | 248 |
| 107 | 3300042601 | Ga0466707_285562 | Ga0466707_285562_3289_4035 | 248 |
| 108 | 3300042606 | Ga0466719_266899 | Ga0466719_266899_1291_2037 | 248 |
| 109 | 3300042612 | Ga0466705_489495 | Ga0466705_489495_1652_2398 | 248 |
| 110 | 3300042643 | Ga0466704_494108 | Ga0466704_494108_1426_2172 | 248 |
| 111 | 3300042655 | Ga0466727_048561 | Ga0466727_048561_2911_3657 | 248 |
| 112 | 3300042624 | Ga0466735_122650 | Ga0466735_122650_193_942 | 249 |
| 113 | iso_pr_bacteria | 2820759988 | 2820760177 | 249 |
| 114 | 3300010882 | Ga0123354_10000231 | Ga0123354_1000023120 | 250 |
| 115 | 3300042606 | Ga0466719_238468 | Ga0466719_238468_1074_1826 | 250 |
| 116 | 3300042601 | Ga0466707_171331 | Ga0466707_171331_4597_5352 | 251 |
| 117 | 3300042620 | Ga0466728_103641 | Ga0466728_103641_1016_1771 | 251 |
| 118 | 3300042624 | Ga0466735_092670 | Ga0466735_092670_115_870 | 251 |
| 119 | 3300002509 | JGI24699J35502_11131536 | JGI24699J35502_111315362 | 254 |
| 120 | 3300042615 | Ga0466711_283506 | Ga0466711_283506_2067_2858 | 263 |
| 121 | 3300002834 | JGI24696J40584_12952261 | JGI24696J40584_129522612 | 264 |
| 122 | 3300002834 | JGI24696J40584_12925051 | JGI24696J40584_129250512 | 274 |
| 123 | 3300009784 | Ga0123357_10289957 | Ga0123357_102899572 | 299 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.84 | 0.89 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.