Protein Family IF00932

Metagenome Isolate
123 Members
43 Samples
120 Scaffolds
246.15 Avg Length

🧬 Representative Sequence

ID
3300002834|JGI24696J40584_12925051|JGI24696J40584_129250512
Length
274 aa
Sequence
MGFISFFEFFTQIVLLLCVKKRGESIMLPIEVINVKKSFKDVRAVRGISLAIQSGEFVALLGPNGAGKTTMVEMMEGLRKPDSGEIRVMGKTWDKNEKELRKIIGLSLQETRFAEKLSVRETLHLFASFFELVTTRVDEVISLTGLEEKQKSMVGTLSGGQRQRLALAVALLNNPQILFLDEPTTGLDPHSRFDFWNILKELKARGETTLILTTHYMEEAESLCDRIIIMDEGVILKEGKLEDLLDEKTHNLDELFINLTGKTLNEDMNVISE*

📊 Sample Types

Isolate 2.4%
Metagenome 97.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 51.2%
Kalotermitidae 23.3%
Unclassified 11.6%
Rhinotermitidae 7.0%
Termopsidae 7.0%

🌳 Taxonomy

Archaea 0
Bacteria 118
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
2 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
3 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
4 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
5 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
6 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
7 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
8 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
9 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
10 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
11 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
12 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
13 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
14 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
15 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
16 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
17 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
18 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
19 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
20 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
21 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
22 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
23 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
24 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
25 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
26 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
27 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
28 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
29 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
30 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
31 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
32 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
33 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
34 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
35 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
36 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
37 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
38 2820781750 Unclassified Bacteroidetes Emb289P3bin89 Isolate Unclassified
39 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
40 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
41 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
42 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
43 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466697_107336 3300042611 Bacteria 1457
2 Ga0466705_222288 3300042612 Bacteria 12631
3 Ga0123357_10289957 3300009784 Bacteria 1673
4 Ga0123356_10047034 3300010049 Bacteria 4015
5 Ga0123356_10096710 3300010049 Bacteria 2824
6 Ga0123354_10153283 3300010882 Bacteria 2779
7 Ga0123354_10354527 3300010882 Bacteria 1303
8 JGI24696J40584_12925051 3300002834 Bacteria 1395
9 Ga0466710_305502 3300042613 Bacteria 1527
10 Ga0466715_223934 3300042616 Bacteria 10658
11 Ga0466734_038611 3300042623 Bacteria 1123
12 Ga0466735_184564 3300042624 Bacteria 2424
13 Ga0466735_205363 3300042624 Bacteria 3293
14 Ga0466735_233768 3300042624 Bacteria 1238
15 Ga0123357_10047410 3300009784 Bacteria 5824
16 Ga0123357_10263126 3300009784 Unclassified 1819
17 Ga0123354_10000231 3300010882 Bacteria 49858
18 Ga0466711_070305 3300042615 Bacteria 19616
19 Ga0466711_211363 3300042615 Bacteria 9394
20 Ga0466693_357536 3300042592 Bacteria 1255
21 Ga0466707_285562 3300042601 Bacteria 8700
22 Ga0466725_405038 3300042654 Bacteria 17206
23 Ga0466697_150161 3300042611 Bacteria 2118
24 JGI24699J35502_11134110 3300002509 Bacteria 31696
25 JGI24696J40584_12954462 3300002834 Bacteria 2642
26 Ga0466711_283506 3300042615 Bacteria 5158
27 Ga0466707_038429 3300042601 Bacteria 31367
28 Ga0466707_171331 3300042601 Bacteria 8704
29 Ga0466719_266899 3300042606 Bacteria 2707
30 Ga0466719_392710 3300042606 Bacteria 3731
31 Ga0466698_166475 3300042610 Bacteria 1164
32 Ga0466703_226455 3300042636 Bacteria 3274
33 Ga0466727_240319 3300042655 Bacteria 3682
34 Ga0123357_10021747 3300009784 Bacteria 8587
35 Ga0123356_10013240 3300010049 Bacteria 7972
36 Ga0123353_10075999 3300010167 Bacteria 5397
37 Ga0123353_10899843 3300010167 Bacteria 1205
38 JGI24702J35022_10042999 3300002462 Bacteria 2405
39 JGI24696J40584_12885828 3300002834 Bacteria 1106
40 Ga0466712_022819 3300042614 Bacteria 1568
41 Ga0466711_090944 3300042615 Bacteria 9574
42 Ga0466715_208973 3300042616 Bacteria 4735
43 Ga0466729_013438 3300042621 Bacteria 20155
44 Ga0466692_190403 3300042591 Bacteria 7652
45 Ga0466691_150343 3300042593 Bacteria 3303
46 Ga0466699_391919 3300042597 Unclassified 3036
47 Ga0466707_198277 3300042601 Bacteria 1103
48 Ga0466707_303412 3300042601 Bacteria 16171
49 Ga0466713_021849 3300042602 Bacteria 33152
50 Ga0466719_238468 3300042606 Bacteria 8524
51 Ga0466735_041209 3300042624 Bacteria 2970
52 Ga0466735_042814 3300042624 Bacteria 1267
53 Ga0466735_052115 3300042624 Bacteria 23286
54 Ga0466735_092670 3300042624 Bacteria 2034
55 Ga0466735_122650 3300042624 Bacteria 1027
56 Ga0466703_402764 3300042636 Bacteria 9092
57 Ga0466704_494108 3300042643 Bacteria 2654
58 Ga0466709_133004 3300042648 Bacteria 188114
59 Ga0466727_048561 3300042655 Bacteria 4611
60 Ga0466727_064569 3300042655 Bacteria 47217
61 Ga0123357_10145573 3300009784 Unclassified 2896
62 Ga0123356_10007720 3300010049 Bacteria 10712
63 JGI24702J35022_10181873 3300002462 Bacteria 1195
64 JGI24699J35502_11131536 3300002509 Bacteria 5784
65 Ga0466711_174189 3300042615 Bacteria 4435
66 Ga0466726_287212 3300042619 Bacteria 3127
67 Ga0466728_103641 3300042620 Bacteria 2142
68 Ga0466693_192960 3300042592 Bacteria 2821
69 Ga0466691_016200 3300042593 Bacteria 5108
70 Ga0466700_193127 3300042600 Bacteria 4826
71 Ga0466731_087827 3300042622 Bacteria 1092
72 Ga0466734_007127 3300042623 Bacteria 1219
73 Ga0466735_031090 3300042624 Bacteria 2845
74 Ga0466703_194794 3300042636 Bacteria 11339
75 Ga0466703_321867 3300042636 Bacteria 6462
76 Ga0466709_277602 3300042648 Bacteria 3339
77 Ga0123357_10602944 3300009784 Unclassified 842
78 Ga0123356_10009068 3300010049 Bacteria 9837
79 Ga0123356_10072359 3300010049 Bacteria 3239
80 Ga0123353_10093209 3300010167 Bacteria 4852
81 Ga0123354_10335434 3300010882 Bacteria 1371
82 JGI24696J40584_12952261 3300002834 Bacteria 2326
83 Ga0466711_423922 3300042615 Bacteria 4599
84 Ga0466728_340975 3300042620 Bacteria 2134
85 Ga0466701_016618 3300042598 Bacteria 1183
86 Ga0466707_271826 3300042601 Bacteria 4095
87 Ga0466707_351028 3300042601 Bacteria 46236
88 Ga0466719_357342 3300042606 Bacteria 3570
89 Ga0466722_228305 3300042609 Bacteria 1447
90 Ga0466735_041751 3300042624 Bacteria 10920
91 Ga0466735_156709 3300042624 Bacteria 1871
92 Ga0466735_161248 3300042624 Bacteria 1925
93 Ga0466703_430981 3300042636 Bacteria 2862
94 Ga0123354_10488494 3300010882 Unclassified 968
95 JGI24702J35022_10025767 3300002462 Bacteria 3170
96 Ga0123357_10001099 3300009784 Bacteria 28004
97 Ga0466710_117809 3300042613 Bacteria 1019
98 Ga0466711_228571 3300042615 Bacteria 4861
99 Ga0466718_023933 3300042617 Bacteria 2480
100 Ga0466693_158107 3300042592 Bacteria 2630
101 Ga0466700_040163 3300042600 Bacteria 3184
102 Ga0466707_150366 3300042601 Bacteria 4868
103 Ga0466707_306634 3300042601 Bacteria 1970
104 Ga0466707_388357 3300042601 Bacteria 2920
105 Ga0466717_291119 3300042604 Bacteria 1823
106 Ga0466716_296888 3300042605 Bacteria 12415
107 Ga0466729_273974 3300042621 Bacteria 6059
108 Ga0123356_10924095 3300010049 Bacteria 1044
109 JGI24702J35022_10000560 3300002462 Bacteria 22482
110 JGI24705J35276_12194389 3300002504 Bacteria 1511
111 Ga0466705_489495 3300042612 Bacteria 2710
112 Ga0466711_010624 3300042615 Bacteria 5414
113 Ga0466711_374284 3300042615 Bacteria 8076
114 Ga0466656_032277 3300042550 Bacteria 2210
115 Ga0466693_405338 3300042592 Bacteria 3088
116 Ga0466701_074447 3300042598 Bacteria 2988
117 Ga0466735_110024 3300042624 Bacteria 5631
118 Ga0466704_133981 3300042643 Bacteria 5175
119 Ga0466704_329764 3300042643 Bacteria 6913
120 Ga0466727_152017 3300042655 Bacteria 6086

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042623 Ga0466734_038611 Ga0466734_038611_46_729 227
2 3300002462 JGI24702J35022_10025767 JGI24702J35022_100257673 230
3 3300009784 Ga0123357_10602944 Ga0123357_106029441 230
4 3300042601 Ga0466707_306634 Ga0466707_306634_1262_1954 230
5 3300042592 Ga0466693_192960 Ga0466693_192960_1985_2701 238
6 3300042615 Ga0466711_174189 Ga0466711_174189_1038_1757 239
7 iso_pr_bacteria 2820781750 2820782547 239
8 3300042592 Ga0466693_405338 Ga0466693_405338_276_998 240
9 3300042609 Ga0466722_228305 Ga0466722_228305_332_1054 240
10 3300042611 Ga0466697_107336 Ga0466697_107336_555_1277 240
11 3300042613 Ga0466710_117809 Ga0466710_117809_164_886 240
12 3300042615 Ga0466711_423922 Ga0466711_423922_1921_2643 240
13 3300042624 Ga0466735_233768 Ga0466735_233768_367_1089 240
14 3300010049 Ga0123356_10096710 Ga0123356_100967102 241
15 3300010167 Ga0123353_10075999 Ga0123353_100759995 241
16 3300010167 Ga0123353_10899843 Ga0123353_108998432 241
17 3300042624 Ga0466735_184564 Ga0466735_184564_882_1607 241
18 3300042593 Ga0466691_150343 Ga0466691_150343_913_1641 242
19 3300042597 Ga0466699_391919 Ga0466699_391919_2078_2809 243
20 3300042601 Ga0466707_351028 Ga0466707_351028_15570_16301 243
21 3300042610 Ga0466698_166475 Ga0466698_166475_38_769 243
22 3300002462 JGI24702J35022_10181873 JGI24702J35022_101818731 244
23 3300010049 Ga0123356_10072359 Ga0123356_100723592 244
24 3300042598 Ga0466701_016618 Ga0466701_016618_367_1101 244
25 3300042615 Ga0466711_070305 Ga0466711_070305_18194_18928 244
26 3300042615 Ga0466711_228571 Ga0466711_228571_1337_2071 244
27 3300042619 Ga0466726_287212 Ga0466726_287212_1434_2168 244
28 3300042624 Ga0466735_156709 Ga0466735_156709_284_1018 244
29 3300042655 Ga0466727_240319 Ga0466727_240319_2003_2737 244
30 3300042592 Ga0466693_158107 Ga0466693_158107_878_1615 245
31 3300042601 Ga0466707_150366 Ga0466707_150366_2296_3033 245
32 3300042601 Ga0466707_271826 Ga0466707_271826_2623_3360 245
33 3300042601 Ga0466707_388357 Ga0466707_388357_656_1393 245
34 3300042604 Ga0466717_291119 Ga0466717_291119_434_1171 245
35 3300042612 Ga0466705_222288 Ga0466705_222288_3550_4287 245
36 3300042615 Ga0466711_010624 Ga0466711_010624_74_811 245
37 3300042617 Ga0466718_023933 Ga0466718_023933_690_1427 245
38 3300042620 Ga0466728_340975 Ga0466728_340975_844_1581 245
39 3300042621 Ga0466729_273974 Ga0466729_273974_1488_2225 245
40 3300042623 Ga0466734_007127 Ga0466734_007127_140_877 245
41 3300042624 Ga0466735_031090 Ga0466735_031090_957_1694 245
42 3300042624 Ga0466735_041209 Ga0466735_041209_1971_2708 245
43 3300042624 Ga0466735_052115 Ga0466735_052115_14461_15198 245
44 3300042624 Ga0466735_110024 Ga0466735_110024_4842_5579 245
45 3300042624 Ga0466735_161248 Ga0466735_161248_620_1357 245
46 3300042624 Ga0466735_205363 Ga0466735_205363_923_1660 245
47 3300042654 Ga0466725_405038 Ga0466725_405038_3577_4314 245
48 3300002462 JGI24702J35022_10000560 JGI24702J35022_1000056011 246
49 3300002504 JGI24705J35276_12194389 JGI24705J35276_121943891 246
50 3300010049 Ga0123356_10009068 Ga0123356_100090688 246
51 3300010049 Ga0123356_10013240 Ga0123356_100132404 246
52 3300010049 Ga0123356_10047034 Ga0123356_100470342 246
53 3300010167 Ga0123353_10093209 Ga0123353_100932092 246
54 3300042550 Ga0466656_032277 Ga0466656_032277_440_1180 246
55 3300042593 Ga0466691_016200 Ga0466691_016200_4224_4964 246
56 3300042598 Ga0466701_074447 Ga0466701_074447_1184_1924 246
57 3300042601 Ga0466707_198277 Ga0466707_198277_25_765 246
58 3300042602 Ga0466713_021849 Ga0466713_021849_26606_27346 246
59 3300042615 Ga0466711_090944 Ga0466711_090944_8412_9152 246
60 3300042615 Ga0466711_211363 Ga0466711_211363_8200_8940 246
61 3300042615 Ga0466711_374284 Ga0466711_374284_5419_6159 246
62 3300042616 Ga0466715_208973 Ga0466715_208973_216_956 246
63 3300042616 Ga0466715_223934 Ga0466715_223934_1586_2326 246
64 3300042621 Ga0466729_013438 Ga0466729_013438_4714_5454 246
65 3300042624 Ga0466735_042814 Ga0466735_042814_432_1172 246
66 3300042643 Ga0466704_133981 Ga0466704_133981_2861_3601 246
67 3300042643 Ga0466704_329764 Ga0466704_329764_4968_5708 246
68 3300042648 Ga0466709_133004 Ga0466709_133004_50197_50937 246
69 3300042655 Ga0466727_064569 Ga0466727_064569_35247_35987 246
70 3300042655 Ga0466727_152017 Ga0466727_152017_1485_2225 246
71 iso_pr_bacteria 2820762746 2820764035 246
72 3300002509 JGI24699J35502_11134110 JGI24699J35502_111341105 247
73 3300002834 JGI24696J40584_12954462 JGI24696J40584_129544622 247
74 3300010049 Ga0123356_10924095 Ga0123356_109240951 247
75 3300010882 Ga0123354_10153283 Ga0123354_101532832 247
76 3300042592 Ga0466693_357536 Ga0466693_357536_320_1063 247
77 3300042600 Ga0466700_040163 Ga0466700_040163_2411_3154 247
78 3300042600 Ga0466700_193127 Ga0466700_193127_2668_3411 247
79 3300042601 Ga0466707_303412 Ga0466707_303412_4574_5317 247
80 3300042605 Ga0466716_296888 Ga0466716_296888_3505_4248 247
81 3300042606 Ga0466719_357342 Ga0466719_357342_1770_2513 247
82 3300042606 Ga0466719_392710 Ga0466719_392710_2163_2906 247
83 3300042611 Ga0466697_150161 Ga0466697_150161_336_1079 247
84 3300042613 Ga0466710_305502 Ga0466710_305502_512_1255 247
85 3300042614 Ga0466712_022819 Ga0466712_022819_711_1454 247
86 3300042622 Ga0466731_087827 Ga0466731_087827_91_834 247
87 3300042624 Ga0466735_041751 Ga0466735_041751_5360_6103 247
88 3300042636 Ga0466703_194794 Ga0466703_194794_3791_4534 247
89 3300042636 Ga0466703_226455 Ga0466703_226455_2131_2874 247
90 3300042636 Ga0466703_321867 Ga0466703_321867_172_915 247
91 3300042636 Ga0466703_402764 Ga0466703_402764_4528_5271 247
92 3300042636 Ga0466703_430981 Ga0466703_430981_1264_2007 247
93 3300042648 Ga0466709_277602 Ga0466709_277602_622_1365 247
94 3300002462 JGI24702J35022_10042999 JGI24702J35022_100429992 248
95 3300002834 JGI24696J40584_12885828 JGI24696J40584_128858281 248
96 3300009784 Ga0123357_10001099 Ga0123357_1000109918 248
97 3300009784 Ga0123357_10021747 Ga0123357_100217474 248
98 3300009784 Ga0123357_10047410 Ga0123357_100474104 248
99 3300009784 Ga0123357_10145573 Ga0123357_101455733 248
100 3300009784 Ga0123357_10263126 Ga0123357_102631264 248
101 3300010049 Ga0123356_10007720 Ga0123356_100077203 248
102 3300010882 Ga0123354_10335434 Ga0123354_103354341 248
103 3300010882 Ga0123354_10354527 Ga0123354_103545271 248
104 3300010882 Ga0123354_10488494 Ga0123354_104884941 248
105 3300042591 Ga0466692_190403 Ga0466692_190403_473_1219 248
106 3300042601 Ga0466707_038429 Ga0466707_038429_21051_21797 248
107 3300042601 Ga0466707_285562 Ga0466707_285562_3289_4035 248
108 3300042606 Ga0466719_266899 Ga0466719_266899_1291_2037 248
109 3300042612 Ga0466705_489495 Ga0466705_489495_1652_2398 248
110 3300042643 Ga0466704_494108 Ga0466704_494108_1426_2172 248
111 3300042655 Ga0466727_048561 Ga0466727_048561_2911_3657 248
112 3300042624 Ga0466735_122650 Ga0466735_122650_193_942 249
113 iso_pr_bacteria 2820759988 2820760177 249
114 3300010882 Ga0123354_10000231 Ga0123354_1000023120 250
115 3300042606 Ga0466719_238468 Ga0466719_238468_1074_1826 250
116 3300042601 Ga0466707_171331 Ga0466707_171331_4597_5352 251
117 3300042620 Ga0466728_103641 Ga0466728_103641_1016_1771 251
118 3300042624 Ga0466735_092670 Ga0466735_092670_115_870 251
119 3300002509 JGI24699J35502_11131536 JGI24699J35502_111315362 254
120 3300042615 Ga0466711_283506 Ga0466711_283506_2067_2858 263
121 3300002834 JGI24696J40584_12952261 JGI24696J40584_129522612 264
122 3300002834 JGI24696J40584_12925051 JGI24696J40584_129250512 274
123 3300009784 Ga0123357_10289957 Ga0123357_102899572 299

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00005 ABC_tran ABC transporter 46 185 0.98
PF13304 AAA_21 AAA domain, putative AbiEii toxin, Type IV TA system 157 215 0.89

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.84 0.89 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.