Protein Family IF00931

Metagenome Isolate
181 Members
73 Samples
156 Scaffolds
305.98 Avg Length

🧬 Representative Sequence

ID
3300002834|JGI24696J40584_12913498|JGI24696J40584_129134982
Length
351 aa
Sequence
MGLFCKNIGFNRSHENCERLIFTTFHKLFFINFFLKSHIPDIRIWFFFVVMGKYELITILGPTACGKTQLAAALAAKLRSEVISADSRQVYRRMDIGTGKDLDDYIVDGRPIPYHLVDICEPGTKYNVFRYQHDFFTIFNKLKNAGLIPVLCGGTGMYIEAVLKGYKLLDVPPNPALRRSLAGKSLEELEQKLANYKTLHNKTDVDSAQRAIRAIEIEEYYQHEAPGNSEFVPLQSLIIGIDIDRELRREKISKLSEGMIDEVSRLLDDGIPPGDLIYYGLEYKYITQYLIGELTYDEMTSLLEIAIHQFAKRQMTWFRGMERRGFAIHWIDAAIALEEKIEKTLTFFNN*

📊 Sample Types

Isolate 13.8%
Metagenome 86.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 23.6%
Kalotermitidae 19.4%
Blattidae 19.4%
Unclassified 12.5%
Rhinotermitidae 6.9%
Termopsidae 5.6%
Passalidae 4.2%
Drosophilidae 2.8%
Hydrophilidae 2.8%
Elmidae 1.4%
Tenebrionidae 1.4%

🌳 Taxonomy

Archaea 0
Bacteria 179
Eukaryota 0
Viruses 0
Unclassified 2

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
2 3300007153 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut Metagenome Drosophilidae
3 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
4 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
5 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
6 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
7 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
8 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
9 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
10 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
11 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
12 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
13 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
14 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
15 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
16 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
17 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
18 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
19 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
20 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
21 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
22 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
23 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
24 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
25 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
26 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
27 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
28 2864836148 Arcicella rosea S00070 Isolate Elmidae
29 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
30 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
31 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
32 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
33 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
34 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
35 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
36 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
37 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
38 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
39 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
40 2820778767 Unclassified Bacteroidetes Emb289P4bin10 Isolate Unclassified
41 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
42 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
43 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
44 3004672520 Bacteroides sp. 51 Isolate Blattidae
45 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
46 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
47 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
48 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
49 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
50 2820776227 Unclassified Bacteroidetes Emb289P4bin3 Isolate Unclassified
51 2695420314 Dysgonomonas sp. BGC7 Isolate Unclassified
52 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
53 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
54 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
55 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
56 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
57 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
58 2910926975 Dysgonomonas sp. 25 Isolate Blattidae
59 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
60 2940336608 Dysgonomonas sp. PH5-37 Isolate Blattidae
61 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
62 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
63 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
64 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
65 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
66 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
67 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
68 2940193328 Dysgonomonas sp. PH5-45 Isolate Blattidae
69 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
70 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
71 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
72 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
73 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_132072 3300042612 Bacteria 8395
2 Ga0466733_210608 3300042659 Bacteria 40939
3 Ga0123357_10006965 3300009784 Bacteria 13898
4 Ga0123356_10707743 3300010049 Bacteria 1176
5 Ga0466723_239231 3300042618 Bacteria 2811
6 Ga0466700_373334 3300042600 Bacteria 80469
7 Ga0466707_155022 3300042601 Bacteria 6129
8 Ga0466707_404342 3300042601 Bacteria 2787
9 Ga0466713_043591 3300042602 Bacteria 53812
10 Ga0466713_122827 3300042602 Bacteria 174567
11 Ga0466716_494654 3300042605 Bacteria 6477
12 Ga0466722_244529 3300042609 Bacteria 1968
13 Ga0466709_047096 3300042648 Bacteria 173163
14 Ga0466727_102563 3300042655 Bacteria 12294
15 Ga0466656_138456 3300042550 Bacteria 1182
16 Ga0466696_110710 3300042596 Bacteria 2563
17 JGI24705J35276_12234823 3300002504 Bacteria 5887
18 Ga0466705_083430 3300042612 Bacteria 16371
19 Ga0466732_110914 3300042656 Bacteria 1884
20 Ga0466732_116143 3300042656 Bacteria 1529
21 Ga0123353_10663435 3300010167 Bacteria 1473
22 Ga0123354_10202022 3300010882 Unclassified 2181
23 Ga0466705_528456 3300042612 Bacteria 2107
24 Ga0466711_115367 3300042615 Bacteria 12045
25 Ga0466715_015382 3300042616 Bacteria 25238
26 Ga0466723_053883 3300042618 Bacteria 24209
27 Ga0466728_196439 3300042620 Bacteria 1398
28 Ga0466707_097852 3300042601 Bacteria 26513
29 Ga0466707_290683 3300042601 Bacteria 3812
30 Ga0466713_053120 3300042602 Bacteria 1526
31 Ga0466713_108443 3300042602 Bacteria 74837
32 Ga0466719_157724 3300042606 Bacteria 3512
33 Ga0466729_280150 3300042621 Bacteria 10011
34 Ga0466735_022781 3300042624 Bacteria 3707
35 Ga0466735_217254 3300042624 Bacteria 2527
36 Ga0466704_305943 3300042643 Bacteria 4300
37 Ga0466709_066569 3300042648 Bacteria 14891
38 Ga0466656_048535 3300042550 Bacteria 1795
39 2227219681 2225789004 Bacteria 33222
40 2227590445 2225789004 Bacteria 2427
41 IMNBL1DRAFT_c0001047 3300000062 Bacteria 21395
42 Ga0072941_1328562 3300005201 Bacteria 4547
43 Ga0466705_375359 3300042612 Bacteria 8509
44 Ga0466733_150639 3300042659 Bacteria 185699
45 Ga0123353_10110979 3300010167 Bacteria 4417
46 Ga0123353_10218942 3300010167 Bacteria 2979
47 Ga0123354_10000089 3300010882 Bacteria 67418
48 Ga0466711_001110 3300042615 Bacteria 4120
49 Ga0466711_043535 3300042615 Bacteria 2813
50 Ga0466726_324871 3300042619 Bacteria 9558
51 Ga0466713_094824 3300042602 Bacteria 7740
52 Ga0466722_085395 3300042609 Bacteria 6738
53 Ga0466729_242909 3300042621 Bacteria 9408
54 Ga0466731_074700 3300042622 Bacteria 1773
55 Ga0466735_016539 3300042624 Bacteria 2786
56 Ga0466735_042327 3300042624 Bacteria 6599
57 Ga0466735_214120 3300042624 Bacteria 2395
58 Ga0466704_477034 3300042643 Bacteria 56056
59 Ga0466709_292580 3300042648 Bacteria 8167
60 Ga0466708_158188 3300042652 Bacteria 11597
61 Ga0466656_064855 3300042550 Bacteria 7925
62 Ga0466690_372984 3300042590 Bacteria 6524
63 Ga0466696_282740 3300042596 Bacteria 3311
64 2227194692 2225789004 Bacteria 7872
65 2227208575 2225789004 Bacteria 7661
66 2227624343 2225789004 Bacteria 2166
67 IMNBL1DRAFT_c0001301 3300000062 Bacteria 18778
68 IMNBL1DRAFT_c0012863 3300000062 Bacteria 3796
69 Ga0072941_1100677 3300005201 Bacteria 1076
70 Ga0466726_194939 3300042619 Bacteria 5588
71 Ga0466729_037737 3300042621 Bacteria 5312
72 Ga0466713_122611 3300042602 Bacteria 62960
73 Ga0466713_151541 3300042602 Bacteria 1876
74 Ga0466722_219492 3300042609 Bacteria 63959
75 Ga0466735_117983 3300042624 Bacteria 1149
76 Ga0466704_249834 3300042643 Bacteria 14240
77 Ga0466704_461175 3300042643 Bacteria 21896
78 Ga0466709_181932 3300042648 Bacteria 8400
79 JGI24702J35022_10019340 3300002462 Bacteria 3704
80 Ga0466705_246819 3300042612 Bacteria 3216
81 Ga0466733_095748 3300042659 Bacteria 6918
82 Ga0123353_10290670 3300010167 Bacteria 2502
83 Ga0466723_087560 3300042618 Bacteria 3559
84 Ga0466713_153072 3300042602 Bacteria 7373
85 Ga0466716_105802 3300042605 Bacteria 11974
86 Ga0466704_594161 3300042643 Bacteria 15028
87 Ga0466709_099822 3300042648 Bacteria 2618
88 Ga0466708_042034 3300042652 Bacteria 19165
89 Ga0466727_176210 3300042655 Bacteria 12726
90 Ga0466727_221672 3300042655 Bacteria 9440
91 Ga0466691_013448 3300042593 Bacteria 43223
92 Ga0466696_182096 3300042596 Bacteria 20260
93 2227047025 2225789003 Bacteria 4065
94 IMNBL1DRAFT_c0000445 3300000062 Bacteria 34629
95 Ga0068302_10162501 3300005071 Bacteria 9312
96 Ga0068305_10003714 3300005083 Bacteria 240854
97 Ga0466733_191183 3300042659 Bacteria 11165
98 Ga0562377_0004 3300056842 Bacteria 3525959
99 Ga0123356_10107660 3300010049 Bacteria 2686
100 Ga0466711_231770 3300042615 Bacteria 8785
101 Ga0466723_139149 3300042618 Bacteria 10549
102 Ga0466723_156953 3300042618 Bacteria 17921
103 Ga0466726_462348 3300042619 Bacteria 3178
104 Ga0466700_366422 3300042600 Bacteria 11322
105 Ga0466707_123870 3300042601 Bacteria 6339
106 Ga0466707_201232 3300042601 Bacteria 18378
107 Ga0466707_217250 3300042601 Bacteria 4926
108 Ga0466713_045311 3300042602 Bacteria 10275
109 Ga0466714_121243 3300042603 Bacteria 51129
110 Ga0466698_186782 3300042610 Bacteria 5035
111 Ga0466735_169458 3300042624 Bacteria 5199
112 Ga0466703_112018 3300042636 Bacteria 5343
113 Ga0466703_170391 3300042636 Bacteria 1387
114 Ga0466708_090677 3300042652 Bacteria 10969
115 Ga0466725_043597 3300042654 Bacteria 2777
116 Ga0466727_102846 3300042655 Bacteria 3188
117 Ga0466696_217568 3300042596 Bacteria 3354
118 2227498242 2225789004 Bacteria 3874
119 IMNBL1DRAFT_c0000531 3300000062 Bacteria 31199
120 IMNBL1DRAFT_c0004317 3300000062 Bacteria 8590
121 IMNBL1DRAFT_c0004926 3300000062 Bacteria 7823
122 JGI24702J35022_10005949 3300002462 Bacteria 7089
123 Ga0068305_10007915 3300005083 Bacteria 15522
124 Ga0466732_107536 3300042656 Bacteria 2115
125 Ga0466715_397426 3300042616 Bacteria 7446
126 Ga0466728_119130 3300042620 Bacteria 6221
127 Ga0466707_294616 3300042601 Bacteria 11241
128 Ga0466716_228227 3300042605 Bacteria 1123
129 Ga0466703_216689 3300042636 Bacteria 4203
130 Ga0466704_179371 3300042643 Bacteria 2502
131 Ga0466704_204492 3300042643 Bacteria 7540
132 Ga0466704_410802 3300042643 Bacteria 7905
133 Ga0466708_115755 3300042652 Bacteria 3876
134 Ga0466690_198924 3300042590 Bacteria 34985
135 Ga0466692_021569 3300042591 Bacteria 21084
136 Ga0466692_178028 3300042591 Bacteria 52823
137 JGI24702J35022_10000263 3300002462 Bacteria 30153
138 JGI24696J40584_12913498 3300002834 Bacteria 1277
139 Ga0104045_1002683 3300007085 Bacteria 10439
140 Ga0104050_1026244 3300007153 Unclassified 5093
141 Ga0123357_10002435 3300009784 Bacteria 20755
142 Ga0466733_194561 3300042659 Bacteria 3706
143 Ga0123353_10000423 3300010167 Bacteria 52369
144 Ga0466705_476770 3300042612 Bacteria 2615
145 Ga0466715_042870 3300042616 Bacteria 20678
146 Ga0466701_040623 3300042598 Bacteria 5837
147 Ga0466735_003202 3300042624 Bacteria 2408
148 Ga0466735_127635 3300042624 Bacteria 5896
149 Ga0466703_281297 3300042636 Bacteria 25783
150 Ga0466692_055993 3300042591 Bacteria 22917
151 Ga0466695_018344 3300042595 Bacteria 1225
152 Ga0466696_010340 3300042596 Bacteria 2105
153 Ga0466696_347362 3300042596 Bacteria 2340
154 2227549628 2225789004 Bacteria 15100
155 IMNBL1DRAFT_c0023340 3300000062 Bacteria 2425
156 Ga0068305_10022352 3300005083 Bacteria 4759

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042656 Ga0466732_110914 Ga0466732_110914_1048_1833 261
2 3300042595 Ga0466695_018344 Ga0466695_018344_427_1215 262
3 3300010049 Ga0123356_10107660 Ga0123356_101076602 282
4 3300042616 Ga0466715_397426 Ga0466715_397426_6509_7435 282
5 3300042550 Ga0466656_138456 Ga0466656_138456_23_937 285
6 3300002462 JGI24702J35022_10019340 JGI24702J35022_100193403 286
7 3300042624 Ga0466735_169458 Ga0466735_169458_267_1127 286
8 iso_pr_bacteria 2967483437 2967485847 286
9 3300002462 JGI24702J35022_10000263 JGI24702J35022_1000026315 287
10 3300002504 JGI24705J35276_12234823 JGI24705J35276_122348233 287
11 3300042656 Ga0466732_116143 Ga0466732_116143_545_1456 290
12 3300042602 Ga0466713_094824 Ga0466713_094824_2708_3589 293
13 3300005083 Ga0068305_10022352 Ga0068305_100223522 294
14 3300042596 Ga0466696_347362 Ga0466696_347362_1253_2188 294
15 3300042624 Ga0466735_127635 Ga0466735_127635_1390_2274 294
16 3300010167 Ga0123353_10000423 Ga0123353_1000042318 295
17 3300042605 Ga0466716_228227 Ga0466716_228227_49_936 295
18 3300042659 Ga0466733_095748 Ga0466733_095748_3143_4030 295
19 3300042618 Ga0466723_139149 Ga0466723_139149_5088_6029 297
20 3300042618 Ga0466723_053883 Ga0466723_053883_153_1094 299
21 3300042598 Ga0466701_040623 Ga0466701_040623_4440_5342 300
22 3300042601 Ga0466707_217250 Ga0466707_217250_2321_3223 300
23 3300042618 Ga0466723_087560 Ga0466723_087560_213_1115 300
24 3300042624 Ga0466735_016539 Ga0466735_016539_1676_2578 300
25 3300042624 Ga0466735_217254 Ga0466735_217254_148_1050 300
26 2225789004 2227208575 2227636702 301
27 3300007085 Ga0104045_1002683 Ga0104045_10026836 301
28 3300007153 Ga0104050_1026244 Ga0104050_10262446 301
29 3300042590 Ga0466690_372984 Ga0466690_372984_4671_5603 301
30 3300042596 Ga0466696_182096 Ga0466696_182096_12138_13043 301
31 3300042619 Ga0466726_194939 Ga0466726_194939_2998_3903 301
32 3300042621 Ga0466729_242909 Ga0466729_242909_3219_4154 301
33 3300042655 Ga0466727_102563 Ga0466727_102563_7355_8260 301
34 iso_pr_bacteria 2940216256 2940217585 301
35 3300042591 Ga0466692_178028 Ga0466692_178028_46545_47453 302
36 3300042624 Ga0466735_042327 Ga0466735_042327_501_1409 302
37 3300042643 Ga0466704_305943 Ga0466704_305943_1702_2610 302
38 3300042602 Ga0466713_153072 Ga0466713_153072_6210_7121 303
39 3300042615 Ga0466711_001110 Ga0466711_001110_2462_3373 303
40 3300042659 Ga0466733_210608 Ga0466733_210608_18343_19254 303
41 iso_pr_bacteria 2820762746 2820764937 303
42 iso_pr_bacteria 2940195863 2940196040 303
43 2225789003 2227047025 2227405821 304
44 3300042601 Ga0466707_097852 Ga0466707_097852_305_1219 304
45 3300042601 Ga0466707_201232 Ga0466707_201232_305_1219 304
46 3300042602 Ga0466713_043591 Ga0466713_043591_32980_33894 304
47 3300042602 Ga0466713_122611 Ga0466713_122611_3152_4066 304
48 3300042603 Ga0466714_121243 Ga0466714_121243_13261_14175 304
49 3300042605 Ga0466716_494654 Ga0466716_494654_472_1386 304
50 3300042612 Ga0466705_132072 Ga0466705_132072_4426_5340 304
51 3300042612 Ga0466705_476770 Ga0466705_476770_1579_2493 304
52 3300042615 Ga0466711_043535 Ga0466711_043535_1028_1942 304
53 3300042619 Ga0466726_324871 Ga0466726_324871_939_1853 304
54 3300042620 Ga0466728_119130 Ga0466728_119130_4043_4957 304
55 3300042622 Ga0466731_074700 Ga0466731_074700_188_1102 304
56 3300042636 Ga0466703_112018 Ga0466703_112018_1826_2740 304
57 3300042643 Ga0466704_410802 Ga0466704_410802_2163_3077 304
58 3300042643 Ga0466704_594161 Ga0466704_594161_7732_8646 304
59 3300042648 Ga0466709_047096 Ga0466709_047096_3205_4119 304
60 3300042648 Ga0466709_181932 Ga0466709_181932_3622_4536 304
61 3300042652 Ga0466708_158188 Ga0466708_158188_3547_4461 304
62 3300042656 Ga0466732_107536 Ga0466732_107536_566_1480 304
63 2225789004 2227194692 2227618009 305
64 2225789004 2227219681 2227651821 305
65 2225789004 2227624343 2228204809 305
66 3300000062 IMNBL1DRAFT_c0000445 IMNBL1DRAFT_000044531 305
67 3300000062 IMNBL1DRAFT_c0001301 IMNBL1DRAFT_000130113 305
68 3300042550 Ga0466656_048535 Ga0466656_048535_115_1032 305
69 3300042550 Ga0466656_064855 Ga0466656_064855_1067_1984 305
70 3300042596 Ga0466696_217568 Ga0466696_217568_300_1217 305
71 3300042602 Ga0466713_053120 Ga0466713_053120_67_984 305
72 3300042612 Ga0466705_083430 Ga0466705_083430_7353_8270 305
73 3300042612 Ga0466705_246819 Ga0466705_246819_769_1686 305
74 3300042615 Ga0466711_231770 Ga0466711_231770_4992_5909 305
75 3300042616 Ga0466715_015382 Ga0466715_015382_18121_19038 305
76 3300042616 Ga0466715_042870 Ga0466715_042870_4155_5072 305
77 3300042624 Ga0466735_003202 Ga0466735_003202_502_1419 305
78 3300042636 Ga0466703_170391 Ga0466703_170391_332_1249 305
79 3300042636 Ga0466703_281297 Ga0466703_281297_4601_5518 305
80 3300042643 Ga0466704_477034 Ga0466704_477034_35951_36868 305
81 3300042655 Ga0466727_102846 Ga0466727_102846_253_1170 305
82 3300042655 Ga0466727_221672 Ga0466727_221672_1379_2296 305
83 3300042659 Ga0466733_194561 Ga0466733_194561_2571_3488 305
84 3300056842 Ga0562377_0004 Ga0562377_0004_2458084_2459001 305
85 iso_pr_bacteria 2695420314 2695471495 305
86 iso_pr_bacteria 2940244548 2940247912 305
87 iso_pr_bacteria 2940248789 2940252102 305
88 iso_pr_bacteria 2940253009 2940256325 305
89 iso_pr_bacteria 2940257232 2940260535 305
90 iso_pr_bacteria 3004672520 3004675380 305
91 iso_pr_bacteria 8100166142 8100167232 305
92 3300000062 IMNBL1DRAFT_c0000531 IMNBL1DRAFT_00005313 306
93 3300010167 Ga0123353_10110979 Ga0123353_101109796 306
94 3300042596 Ga0466696_010340 Ga0466696_010340_1119_2039 306
95 3300042601 Ga0466707_123870 Ga0466707_123870_2295_3215 306
96 3300042602 Ga0466713_122827 Ga0466713_122827_47187_48107 306
97 3300042621 Ga0466729_280150 Ga0466729_280150_2756_3676 306
98 3300042652 Ga0466708_042034 Ga0466708_042034_964_1884 306
99 3300042654 Ga0466725_043597 Ga0466725_043597_1107_2027 306
100 3300042659 Ga0466733_150639 Ga0466733_150639_334_1254 306
101 iso_pr_bacteria 2695420317 2695486342 306
102 iso_pr_bacteria 2873600114 2873601014 306
103 iso_pr_bacteria 2873610414 2873611351 306
104 iso_pr_bacteria 2910926975 2910928561 306
105 iso_pr_bacteria 8100157865 8100160529 306
106 2225789004 2227498242 2227977955 307
107 3300005083 Ga0068305_10003714 Ga0068305_10003714131 307
108 3300005083 Ga0068305_10007915 Ga0068305_100079151 307
109 3300010167 Ga0123353_10663435 Ga0123353_106634352 307
110 3300010882 Ga0123354_10000089 Ga0123354_100000893 307
111 3300042590 Ga0466690_198924 Ga0466690_198924_9513_10436 307
112 3300042593 Ga0466691_013448 Ga0466691_013448_18874_19797 307
113 3300042601 Ga0466707_155022 Ga0466707_155022_1522_2445 307
114 3300042602 Ga0466713_108443 Ga0466713_108443_67036_67959 307
115 3300042605 Ga0466716_105802 Ga0466716_105802_7221_8144 307
116 3300042609 Ga0466722_085395 Ga0466722_085395_4260_5183 307
117 3300042609 Ga0466722_219492 Ga0466722_219492_24300_25223 307
118 3300042610 Ga0466698_186782 Ga0466698_186782_1720_2643 307
119 3300042615 Ga0466711_115367 Ga0466711_115367_4432_5355 307
120 3300042618 Ga0466723_156953 Ga0466723_156953_9173_10096 307
121 3300042620 Ga0466728_196439 Ga0466728_196439_169_1092 307
122 3300042624 Ga0466735_022781 Ga0466735_022781_1730_2653 307
123 3300042624 Ga0466735_117983 Ga0466735_117983_196_1119 307
124 3300042636 Ga0466703_216689 Ga0466703_216689_786_1709 307
125 3300042643 Ga0466704_179371 Ga0466704_179371_924_1847 307
126 3300042648 Ga0466709_292580 Ga0466709_292580_731_1654 307
127 iso_pr_bacteria 2864836148 2864840274 307
128 iso_pr_bacteria 2940193328 2940194026 307
129 iso_pr_bacteria 2940199050 2940200678 307
130 iso_pr_bacteria 2940336608 2940337303 307
131 iso_pr_bacteria 2940346213 2940348702 307
132 3300000062 IMNBL1DRAFT_c0004317 IMNBL1DRAFT_00043174 308
133 3300000062 IMNBL1DRAFT_c0023340 IMNBL1DRAFT_00233402 308
134 3300005071 Ga0068302_10162501 Ga0068302_101625017 308
135 3300010167 Ga0123353_10290670 Ga0123353_102906701 308
136 3300042601 Ga0466707_294616 Ga0466707_294616_5208_6134 308
137 3300042624 Ga0466735_214120 Ga0466735_214120_1401_2327 308
138 3300042643 Ga0466704_204492 Ga0466704_204492_738_1664 308
139 3300042643 Ga0466704_249834 Ga0466704_249834_10143_11069 308
140 3300002462 JGI24702J35022_10005949 JGI24702J35022_100059498 309
141 3300010167 Ga0123353_10218942 Ga0123353_102189422 309
142 3300010882 Ga0123354_10202022 Ga0123354_102020222 309
143 3300042591 Ga0466692_021569 Ga0466692_021569_8247_9176 309
144 3300042601 Ga0466707_290683 Ga0466707_290683_2564_3493 309
145 3300042652 Ga0466708_090677 Ga0466708_090677_3910_4839 309
146 3300000062 IMNBL1DRAFT_c0004926 IMNBL1DRAFT_00049263 310
147 3300042596 Ga0466696_110710 Ga0466696_110710_1245_2177 310
148 iso_pr_bacteria 2910942425 2910945030 310
149 3300042600 Ga0466700_366422 Ga0466700_366422_365_1300 311
150 3300042648 Ga0466709_066569 Ga0466709_066569_13241_14176 311
151 3300042618 Ga0466723_239231 Ga0466723_239231_934_1872 312
152 iso_pr_bacteria 2820778767 2820780144 312
153 2225789004 2227590445 2228148475 313
154 3300009784 Ga0123357_10002435 Ga0123357_100024358 313
155 3300042612 Ga0466705_528456 Ga0466705_528456_109_1050 313
156 3300042619 Ga0466726_462348 Ga0466726_462348_645_1586 313
157 3300042655 Ga0466727_176210 Ga0466727_176210_7848_8789 313
158 3300042602 Ga0466713_151541 Ga0466713_151541_81_1025 314
159 3300042612 Ga0466705_375359 Ga0466705_375359_1688_2632 314
160 3300042652 Ga0466708_115755 Ga0466708_115755_1193_2137 314
161 iso_pr_bacteria 2820776227 2820777805 314
162 3300005201 Ga0072941_1100677 Ga0072941_11006771 315
163 3300009784 Ga0123357_10006965 Ga0123357_100069654 315
164 3300010049 Ga0123356_10707743 Ga0123356_107077432 315
165 3300042596 Ga0466696_282740 Ga0466696_282740_563_1510 315
166 3300042600 Ga0466700_373334 Ga0466700_373334_7650_8597 315
167 3300005201 Ga0072941_1328562 Ga0072941_13285623 316
168 iso_pr_bacteria 2940202316 2940205358 316
169 3300000062 IMNBL1DRAFT_c0012863 IMNBL1DRAFT_00128632 317
170 3300042591 Ga0466692_055993 Ga0466692_055993_8590_9549 319
171 3300042602 Ga0466713_045311 Ga0466713_045311_1677_2642 321
172 3300042606 Ga0466719_157724 Ga0466719_157724_1798_2763 321
173 3300042621 Ga0466729_037737 Ga0466729_037737_276_1244 322
174 2225789004 2227549628 2228078072 323
175 3300042601 Ga0466707_404342 Ga0466707_404342_220_1203 327
176 3300042659 Ga0466733_191183 Ga0466733_191183_7329_8321 330
177 3300000062 IMNBL1DRAFT_c0001047 IMNBL1DRAFT_00010477 333
178 3300042609 Ga0466722_244529 Ga0466722_244529_182_1189 335
179 3300042648 Ga0466709_099822 Ga0466709_099822_1601_2608 335
180 3300002834 JGI24696J40584_12913498 JGI24696J40584_129134982 351
181 3300042643 Ga0466704_461175 Ga0466704_461175_11596_12666 356

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01715 IPPT IPP transferase 89 320 0.89

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.79 0.86 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.