Protein Family IF00902

Metagenome Isolate
121 Members
58 Samples
99 Scaffolds
141.35 Avg Length

🧬 Representative Sequence

ID
3300002504|JGI24705J35276_12238693|JGI24705J35276_122386935
Length
170 aa
Sequence
MKEASPYPPPKEGNXXXPLGEIEGVVNKKMNTITIKNLANIRLTAKEFIRQMDHRTVFAFHGIMGAGKTTFIKAICEELGVEDVINSPTFALINEYRSIESGELIYHFDFYRINKHSEAQDISVEDYFYSGALCFIEWPEKILPLLPDDTVHITIEEMENGMRELRIEN*

📊 Sample Types

Isolate 18.2%
Metagenome 81.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Blattidae 33.3%
Termitidae 19.3%
Kalotermitidae 19.3%
Unclassified 8.8%
Rhinotermitidae 7.0%
Termopsidae 5.3%
Passalidae 5.3%
Hodotermitidae 1.8%

🌳 Taxonomy

Archaea 0
Bacteria 117
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
2 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
3 3004667792 Bacteroides sp. 519 Isolate Blattidae
4 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
5 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
6 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
7 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
8 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
9 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
10 2609459943 Bacteroides reticulotermitis JCM 10512 Isolate Rhinotermitidae
11 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
12 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
13 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
14 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
15 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
16 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
17 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
18 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
19 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
20 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
21 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
22 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
23 2820751898 Unclassified Bacteroidetes Nc150P4bin22 Isolate Unclassified
24 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
25 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
26 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
27 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
28 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
29 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
30 2923982719 Parabacteroides sp. 52 Isolate Blattidae
31 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
32 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
33 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
34 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
35 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
36 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
37 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
38 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
39 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
40 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
41 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
42 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
43 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
44 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
45 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
46 2830041218 Bacteroides reticulotermitis DSM 105720 Isolate Unclassified
47 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
48 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
49 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
50 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
51 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
52 3004672520 Bacteroides sp. 51 Isolate Blattidae
53 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
54 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
55 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
56 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
57 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
58 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_077252 3300042612 Unclassified 1350
2 Ga0466693_404780 3300042592 Bacteria 2124
3 Ga0466701_012723 3300042598 Bacteria 34655
4 Ga0466703_247850 3300042636 Bacteria 1495
5 Ga0466706_113361 3300042599 Bacteria 1697
6 Ga0466707_320262 3300042601 Bacteria 11712
7 Ga0466714_096666 3300042603 Bacteria 172614
8 Ga0466722_124104 3300042609 Bacteria 3997
9 Ga0466715_181682 3300042616 Bacteria 20637
10 Ga0466715_481062 3300042616 Bacteria 3674
11 Ga0123356_10054630 3300010049 Bacteria 3720
12 Ga0466657_396857 3300042582 Bacteria 1264
13 Ga0466691_049099 3300042593 Bacteria 6686
14 Ga0466735_005137 3300042624 Bacteria 1287
15 Ga0466735_193143 3300042624 Bacteria 5647
16 Ga0466706_075458 3300042599 Bacteria 3480
17 Ga0466722_238740 3300042609 Bacteria 4442
18 JGI24702J35022_10241622 3300002462 Bacteria 1048
19 Ga0068305_10122783 3300005083 Unclassified 3911
20 Ga0466733_035995 3300042659 Bacteria 21364
21 Ga0466733_055799 3300042659 Bacteria 106016
22 Ga0466715_301468 3300042616 Bacteria 5529
23 Ga0466691_145457 3300042593 Bacteria 34874
24 Ga0466696_468919 3300042596 Bacteria 1391
25 Ga0466704_047612 3300042643 Bacteria 21473
26 Ga0466725_225704 3300042654 Bacteria 18706
27 Ga0466706_044418 3300042599 Bacteria 19614
28 Ga0466706_096120 3300042599 Bacteria 10775
29 Ga0466706_107879 3300042599 Bacteria 14964
30 Ga0466707_367694 3300042601 Bacteria 1055
31 Ga0466713_089753 3300042602 Bacteria 35618
32 Ga0466716_027932 3300042605 Bacteria 1079
33 Ga0466716_087157 3300042605 Bacteria 5167
34 Ga0466719_457011 3300042606 Bacteria 4492
35 JGI24702J35022_10022385 3300002462 Bacteria 3420
36 Ga0466705_052187 3300042612 Bacteria 37548
37 Ga0466696_052921 3300042596 Bacteria 29929
38 Ga0466703_008420 3300042636 Bacteria 9715
39 Ga0466703_154899 3300042636 Bacteria 15748
40 Ga0466713_022093 3300042602 Bacteria 13281
41 Ga0466719_084570 3300042606 Bacteria 7356
42 Ga0466722_073583 3300042609 Bacteria 2346
43 2227069126 2225789003 Unclassified 2887
44 2227175247 2225789004 Bacteria 8144
45 2227493813 2225789004 Bacteria 3999
46 2227547422 2225789004 Bacteria 2901
47 JGI24702J35022_10050810 3300002462 Bacteria 2209
48 Ga0072941_1525298 3300005201 Bacteria 634
49 Ga0466705_021372 3300042612 Bacteria 1120
50 Ga0466711_266678 3300042615 Bacteria 13430
51 Ga0466726_319631 3300042619 Bacteria 3020
52 Ga0466728_348809 3300042620 Bacteria 15447
53 Ga0123356_11264911 3300010049 Bacteria 902
54 Ga0466690_158539 3300042590 Bacteria 20384
55 Ga0466692_047378 3300042591 Bacteria 93081
56 Ga0466691_016966 3300042593 Bacteria 13327
57 Ga0466695_161488 3300042595 Bacteria 1517
58 Ga0466735_009647 3300042624 Bacteria 5484
59 Ga0466703_248560 3300042636 Bacteria 44932
60 Ga0466703_405571 3300042636 Bacteria 5874
61 Ga0466704_405525 3300042643 Bacteria 4406
62 Ga0466706_056255 3300042599 Bacteria 16301
63 2227336935 2225789004 Unclassified 1163
64 2227485211 2225789004 Bacteria 4271
65 IMNBL1DRAFT_c0003452 3300000062 Bacteria 10153
66 Ga0466705_188062 3300042612 Bacteria 12718
67 Ga0466733_037360 3300042659 Bacteria 17049
68 Ga0466715_463709 3300042616 Bacteria 1658
69 Ga0466726_155600 3300042619 Bacteria 2191
70 Ga0466729_191291 3300042621 Bacteria 5084
71 Ga0466656_086203 3300042550 Bacteria 1475
72 Ga0466735_170596 3300042624 Bacteria 3429
73 Ga0466704_282105 3300042643 Bacteria 17912
74 Ga0466704_355753 3300042643 Bacteria 30315
75 Ga0466722_262887 3300042609 Bacteria 6333
76 JGI24702J35022_10262224 3300002462 Bacteria 1008
77 JGI24702J35022_10749968 3300002462 Bacteria 607
78 JGI24705J35276_11369725 3300002504 Bacteria 519
79 JGI24705J35276_12204263 3300002504 Bacteria 1673
80 JGI24705J35276_12238693 3300002504 Bacteria 38242
81 Ga0068305_10008090 3300005083 Bacteria 27593
82 Ga0466733_111650 3300042659 Bacteria 3847
83 Ga0466726_259816 3300042619 Bacteria 17666
84 Ga0466704_446345 3300042643 Bacteria 18184
85 Ga0466706_035251 3300042599 Bacteria 6539
86 Ga0466707_006720 3300042601 Bacteria 2960
87 IMNBL1DRAFT_c0000112 3300000062 Bacteria 72967
88 IMNBL1DRAFT_c0002089 3300000062 Bacteria 14219
89 Ga0466728_173422 3300042620 Bacteria 14015
90 Ga0466728_464976 3300042620 Bacteria 20701
91 Ga0466735_117034 3300042624 Bacteria 2268
92 Ga0466735_138771 3300042624 Bacteria 3979
93 Ga0466735_151783 3300042624 Bacteria 4458
94 Ga0466703_214654 3300042636 Bacteria 3090
95 Ga0466704_183759 3300042643 Bacteria 13467
96 Ga0466725_256535 3300042654 Bacteria 3359
97 Ga0466727_042327 3300042655 Bacteria 27947
98 Ga0466701_077707 3300042598 Bacteria 1071
99 2227480190 2225789004 Bacteria 22361

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042609 Ga0466722_124104 Ga0466722_124104_3306_3716 136
2 3300042609 Ga0466722_238740 Ga0466722_238740_3280_3690 136
3 3300042659 Ga0466733_035995 Ga0466733_035995_18626_19036 136
4 3300042659 Ga0466733_111650 Ga0466733_111650_1515_1925 136
5 3300042599 Ga0466706_044418 Ga0466706_044418_16742_17155 137
6 3300042599 Ga0466706_056255 Ga0466706_056255_2080_2493 137
7 3300042599 Ga0466706_107879 Ga0466706_107879_7320_7733 137
8 3300042599 Ga0466706_113361 Ga0466706_113361_1125_1538 137
9 3300042601 Ga0466707_006720 Ga0466707_006720_2014_2427 137
10 3300042606 Ga0466719_084570 Ga0466719_084570_1783_2196 137
11 3300042606 Ga0466719_457011 Ga0466719_457011_1827_2240 137
12 3300042636 Ga0466703_008420 Ga0466703_008420_641_1054 137
13 3300042643 Ga0466704_405525 Ga0466704_405525_2878_3291 137
14 3300042654 Ga0466725_225704 Ga0466725_225704_4491_4904 137
15 iso_pr_bacteria 2609459943 2610743992 137
16 iso_pr_bacteria 2830041218 2830044980 137
17 3300042550 Ga0466656_086203 Ga0466656_086203_224_640 138
18 3300042602 Ga0466713_022093 Ga0466713_022093_6759_7175 138
19 3300042609 Ga0466722_262887 Ga0466722_262887_790_1206 138
20 3300042612 Ga0466705_188062 Ga0466705_188062_5296_5712 138
21 3300042616 Ga0466715_463709 Ga0466715_463709_206_622 138
22 3300042616 Ga0466715_481062 Ga0466715_481062_2382_2798 138
23 3300042620 Ga0466728_348809 Ga0466728_348809_8659_9075 138
24 3300042624 Ga0466735_005137 Ga0466735_005137_23_439 138
25 3300042624 Ga0466735_117034 Ga0466735_117034_1385_1801 138
26 3300042624 Ga0466735_151783 Ga0466735_151783_1762_2178 138
27 3300042636 Ga0466703_214654 Ga0466703_214654_2568_2984 138
28 3300042636 Ga0466703_405571 Ga0466703_405571_2022_2438 138
29 3300042643 Ga0466704_282105 Ga0466704_282105_12805_13221 138
30 3300042643 Ga0466704_355753 Ga0466704_355753_17908_18324 138
31 iso_pr_bacteria 3004667792 3004668723 138
32 2225789003 2227069126 2227429293 139
33 2225789004 2227175247 2227590946 139
34 2225789004 2227336935 2227784337 139
35 2225789004 2227493813 2227968703 139
36 3300002462 JGI24702J35022_10749968 JGI24702J35022_107499681 139
37 3300042593 Ga0466691_145457 Ga0466691_145457_22795_23214 139
38 3300042599 Ga0466706_096120 Ga0466706_096120_7253_7672 139
39 3300042602 Ga0466713_089753 Ga0466713_089753_34683_35102 139
40 3300042619 Ga0466726_155600 Ga0466726_155600_1023_1442 139
41 3300042624 Ga0466735_138771 Ga0466735_138771_3447_3866 139
42 3300042655 Ga0466727_042327 Ga0466727_042327_20213_20632 139
43 3300042659 Ga0466733_037360 Ga0466733_037360_10491_10910 139
44 iso_pr_bacteria 2940199050 2940201190 139
45 iso_pr_bacteria 2940205530 2940209044 139
46 iso_pr_bacteria 2940209341 2940210897 139
47 iso_pr_bacteria 2940212447 2940215931 139
48 iso_pr_bacteria 2940298504 2940302012 139
49 iso_pr_bacteria 2940302308 2940305815 139
50 iso_pr_bacteria 2940306115 2940309679 139
51 iso_pr_bacteria 2940309933 2940313591 139
52 iso_pr_bacteria 2940313741 2940317330 139
53 iso_pr_bacteria 2940317558 2940321171 139
54 iso_pr_bacteria 2940321370 2940324956 139
55 iso_pr_bacteria 2940325180 2940328685 139
56 iso_pr_bacteria 2940328985 2940332466 139
57 iso_pr_bacteria 2940332795 2940336381 139
58 iso_pr_bacteria 2940346213 2940347457 139
59 2225789004 2227480190 2227939339 140
60 2225789004 2227485211 2227950396 140
61 3300002462 JGI24702J35022_10241622 JGI24702J35022_102416221 140
62 3300005083 Ga0068305_10122783 Ga0068305_101227833 140
63 3300042582 Ga0466657_396857 Ga0466657_396857_681_1103 140
64 3300042592 Ga0466693_404780 Ga0466693_404780_117_539 140
65 3300042595 Ga0466695_161488 Ga0466695_161488_884_1306 140
66 3300042598 Ga0466701_012723 Ga0466701_012723_13277_13699 140
67 3300042598 Ga0466701_077707 Ga0466701_077707_383_805 140
68 3300042601 Ga0466707_367694 Ga0466707_367694_369_791 140
69 3300042603 Ga0466714_096666 Ga0466714_096666_144864_145286 140
70 3300042605 Ga0466716_027932 Ga0466716_027932_202_624 140
71 3300042616 Ga0466715_301468 Ga0466715_301468_1358_1780 140
72 3300042619 Ga0466726_259816 Ga0466726_259816_8751_9173 140
73 3300042621 Ga0466729_191291 Ga0466729_191291_3095_3517 140
74 3300042624 Ga0466735_009647 Ga0466735_009647_592_1014 140
75 3300042643 Ga0466704_446345 Ga0466704_446345_1908_2330 140
76 3300000062 IMNBL1DRAFT_c0003452 IMNBL1DRAFT_00034528 141
77 3300002462 JGI24702J35022_10022385 JGI24702J35022_100223852 141
78 3300002462 JGI24702J35022_10050810 JGI24702J35022_100508102 141
79 3300002462 JGI24702J35022_10262224 JGI24702J35022_102622241 141
80 3300002504 JGI24705J35276_11369725 JGI24705J35276_113697251 141
81 3300005201 Ga0072941_1525298 Ga0072941_15252981 141
82 3300042599 Ga0466706_035251 Ga0466706_035251_2909_3334 141
83 3300042624 Ga0466735_170596 Ga0466735_170596_633_1058 141
84 3300042636 Ga0466703_154899 Ga0466703_154899_5323_5748 141
85 3300042636 Ga0466703_248560 Ga0466703_248560_44113_44538 141
86 iso_pr_bacteria 2820751898 2820752901 141
87 iso_pr_bacteria 3004672520 3004677169 141
88 3300002504 JGI24705J35276_12204263 JGI24705J35276_122042633 142
89 3300005083 Ga0068305_10008090 Ga0068305_100080904 142
90 3300010049 Ga0123356_11264911 Ga0123356_112649112 142
91 3300042593 Ga0466691_016966 Ga0466691_016966_2384_2812 142
92 3300042599 Ga0466706_075458 Ga0466706_075458_868_1296 142
93 3300042654 Ga0466725_256535 Ga0466725_256535_2311_2739 142
94 iso_pr_bacteria 2940216256 2940218341 142
95 2225789004 2227547422 2228074252 143
96 3300042591 Ga0466692_047378 Ga0466692_047378_36717_37148 143
97 3300042609 Ga0466722_073583 Ga0466722_073583_797_1228 143
98 3300042659 Ga0466733_055799 Ga0466733_055799_18744_19175 143
99 3300000062 IMNBL1DRAFT_c0000112 IMNBL1DRAFT_000011216 144
100 3300042615 Ga0466711_266678 Ga0466711_266678_6719_7153 144
101 3300042612 Ga0466705_052187 Ga0466705_052187_30461_30901 146
102 3300042636 Ga0466703_247850 Ga0466703_247850_661_1101 146
103 3300000062 IMNBL1DRAFT_c0002089 IMNBL1DRAFT_000208911 148
104 3300010049 Ga0123356_10054630 Ga0123356_100546303 148
105 3300042596 Ga0466696_052921 Ga0466696_052921_19776_20222 148
106 3300042601 Ga0466707_320262 Ga0466707_320262_9898_10344 148
107 3300042593 Ga0466691_049099 Ga0466691_049099_2411_2860 149
108 3300042616 Ga0466715_181682 Ga0466715_181682_2778_3227 149
109 3300042620 Ga0466728_173422 Ga0466728_173422_8408_8857 149
110 iso_pr_bacteria 2923982719 2923983007 149
111 3300042590 Ga0466690_158539 Ga0466690_158539_9640_10092 150
112 3300042596 Ga0466696_468919 Ga0466696_468919_587_1039 150
113 3300042620 Ga0466728_464976 Ga0466728_464976_17249_17701 150
114 3300042643 Ga0466704_047612 Ga0466704_047612_10688_11140 150
115 3300042643 Ga0466704_183759 Ga0466704_183759_7738_8217 150
116 3300042624 Ga0466735_193143 Ga0466735_193143_4433_4888 151
117 3300042612 Ga0466705_077252 Ga0466705_077252_294_752 152
118 3300042605 Ga0466716_087157 Ga0466716_087157_2497_2961 154
119 3300042619 Ga0466726_319631 Ga0466726_319631_1362_1826 154
120 3300042612 Ga0466705_021372 Ga0466705_021372_55_522 155
121 3300002504 JGI24705J35276_12238693 JGI24705J35276_122386935 170

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02367 TsaE Threonylcarbamoyl adenosine biosynthesis protein TsaE 37 163 0.91

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02367 GO:0002949 tRNA threonylcarbamoyladenosine modification BP

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.77 0.87 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.