Protein Family IF00893

Metagenome Isolate
218 Members
73 Samples
206 Scaffolds
522.97 Avg Length

🧬 Representative Sequence

ID
3300002504|JGI24705J35276_12235710|JGI24705J35276_122357103
Length
484 aa
Sequence
MKREVDFLVIGSGLAGLSFALKVAPYGKVCLVSKTALEETNTRYAQGGIAAVIDAGDSYEKHVNDTLIAGDGLCDEMVVRMVVREAPEQIRQLIEWGTHFDKTREGVFDLAREGGHSEHRILHHKDNTGFEIQRALSNMAQRHPNIEILENHFAVDVITQHHLGRLVKRYHPDIECYGAYLLNVKTNKTFAVLSRVTMMATGGTGNLYTTTTNPHIATGDGIAMIYRAKGIIDNLEFVQFHPTSLYNPVEKPSFLISEAMRGFGAVLRNMDGNEFMHKYDPRGSLAPRDVVARAIDNEMKVRGDDHVYLDATATPHEELKNHFPNIYEKCLSLGIDITKDYIPVIPAAHYQCGGIRVDLHGHTSINRLYAEYIIPENIPDWNTEGTAHPEEMVLITQNFKELQQIMSNYVGIVRSNLRLKRALDRLQIIYDETEALYAKTTLSLQLCELRNIINAAYLVIKSAQARHESIGLHYTLDYPANGS*

📊 Sample Types

Isolate 5.5%
Metagenome 94.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 30.4%
Kalotermitidae 20.3%
Unclassified 15.9%
Termopsidae 5.8%
Armadillidiidae 4.3%
Rhinotermitidae 4.3%
Drosophilidae 4.3%
Blattidae 2.9%
Passalidae 2.9%
Culicidae 2.9%
Bombycidae 1.4%
Daphniidae 1.4%
Formicidae 1.4%
Hodotermitidae 1.4%

🌳 Taxonomy

Archaea 0
Bacteria 193
Eukaryota 0
Viruses 0
Unclassified 25

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
2 2920168565 Paludibacter sp. 221 Isolate Blattidae
3 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
4 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
5 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
6 3300012806 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG Metagenome
7 3300012832 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG Metagenome Culicidae
8 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
9 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
10 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
11 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
12 3300012828 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG Metagenome
13 643348524 Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 Isolate Unclassified
14 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
15 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
16 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
17 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
18 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
19 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
20 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
21 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
22 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
23 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
24 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
25 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
26 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
27 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
28 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
29 2820736622 Unclassified Bacteroidetes Th196P4bin26 Isolate Unclassified
30 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
31 3300007150 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut Metagenome Drosophilidae
32 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
33 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
34 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
35 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
36 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
37 2579779088 Sphingobacterium paucimobilis HER1398 Isolate Bombycidae
38 2820740053 Unclassified Bacteroidetes Th196P3bin81 Isolate Unclassified
39 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
40 2820776227 Unclassified Bacteroidetes Emb289P4bin3 Isolate Unclassified
41 2590828803 Pedobacter glucosidilyticus DD6b Isolate Daphniidae
42 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
43 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
44 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
45 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
46 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
47 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
48 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
49 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
50 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
51 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
52 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
53 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
54 2820770630 Unclassified Bacteroidetes Lab288P3bin130 Isolate Unclassified
55 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
56 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
57 3300007153 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut Metagenome Drosophilidae
58 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
59 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
60 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
61 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
62 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
63 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
64 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
65 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
66 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
67 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
68 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
69 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
70 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
71 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
72 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
73 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0160458_100016 3300012832 Bacteria 326466
2 Ga0466690_316215 3300042590 Unclassified 5005
3 Ga0466692_100725 3300042591 Bacteria 1959
4 Ga0466696_141025 3300042596 Bacteria 7823
5 Ga0466696_445279 3300042596 Bacteria 4432
6 Ga0466696_491992 3300042596 Bacteria 12228
7 Ga0123357_10014381 3300009784 Unclassified 10326
8 Ga0123357_10034584 3300009784 Bacteria 6871
9 Ga0123356_10013726 3300010049 Bacteria 7804
10 Ga0466706_152064 3300042599 Bacteria 39646
11 Ga0466700_391349 3300042600 Bacteria 41227
12 Ga0466719_032426 3300042606 Bacteria 5598
13 JGI24699J35502_11133381 3300002509 Bacteria 10209
14 Ga0123357_10002074 3300009784 Bacteria 22005
15 Ga0466726_126009 3300042619 Bacteria 2436
16 Ga0466726_288283 3300042619 Bacteria 3371
17 Ga0466728_363953 3300042620 Unclassified 2262
18 Ga0466735_203842 3300042624 Bacteria 8446
19 Ga0466730_103184 3300042625 Bacteria 430539
20 Ga0466709_132999 3300042648 Bacteria 1811
21 Ga0466708_085297 3300042652 Bacteria 6461
22 Ga0466708_435989 3300042652 Bacteria 40969
23 Ga0466727_005039 3300042655 Bacteria 11326
24 Ga0160457_1000837 3300012858 Bacteria 10808
25 Ga0466692_005178 3300042591 Unclassified 2265
26 Ga0466696_057862 3300042596 Bacteria 9153
27 Ga0466696_174136 3300042596 Bacteria 71806
28 Ga0123354_10003206 3300010882 Bacteria 22421
29 Ga0123354_10037503 3300010882 Bacteria 7544
30 Ga0466701_028503 3300042598 Unclassified 26058
31 Ga0466713_083350 3300042602 Bacteria 30734
32 Ga0466716_308172 3300042605 Bacteria 4261
33 Ga0466722_039485 3300042609 Bacteria 16948
34 Ga0466697_015033 3300042611 Bacteria 7981
35 Ga0068305_10159603 3300005083 Bacteria 4317
36 Ga0104045_1004822 3300007085 Unclassified 2716
37 Ga0466711_057204 3300042615 Bacteria 4437
38 Ga0466723_252593 3300042618 Bacteria 12378
39 Ga0466728_026624 3300042620 Unclassified 5202
40 Ga0466729_274747 3300042621 Bacteria 4173
41 Ga0466735_207110 3300042624 Bacteria 2950
42 Ga0466703_186419 3300042636 Bacteria 5082
43 Ga0466704_295143 3300042643 Bacteria 2913
44 Ga0466709_159448 3300042648 Bacteria 14626
45 Ga0466724_26684 3300042649 Unclassified 8299
46 Ga0466708_058687 3300042652 Bacteria 40531
47 Ga0466705_018553 3300042612 Bacteria 11173
48 Ga0466733_104374 3300042659 Bacteria 7778
49 Ga0160455_100119 3300012837 Bacteria 109702
50 Ga0466690_128671 3300042590 Bacteria 5257
51 Ga0466695_142173 3300042595 Bacteria 17700
52 Ga0123357_10074969 3300009784 Unclassified 4473
53 Ga0123353_10109686 3300010167 Bacteria 4446
54 Ga0123353_10426653 3300010167 Bacteria 1962
55 Ga0123354_10200282 3300010882 Bacteria 2198
56 Ga0160442_100009 3300012806 Bacteria 498468
57 Ga0466700_287679 3300042600 Bacteria 7143
58 Ga0466707_112084 3300042601 Bacteria 44312
59 Ga0466716_144617 3300042605 Bacteria 10946
60 Ga0466716_477229 3300042605 Unclassified 3477
61 Ga0466719_534977 3300042606 Bacteria 2655
62 IMNBL1DRAFT_c0000742 3300000062 Bacteria 25880
63 JGI24702J35022_10001699 3300002462 Bacteria 13645
64 Ga0104019_1005418 3300007150 Bacteria 4684
65 Ga0466711_034882 3300042615 Bacteria 28602
66 Ga0466711_283385 3300042615 Bacteria 2799
67 Ga0466723_071095 3300042618 Bacteria 3817
68 Ga0466728_108850 3300042620 Bacteria 10024
69 Ga0466735_079085 3300042624 Bacteria 4033
70 Ga0466703_100833 3300042636 Bacteria 8806
71 Ga0466704_030112 3300042643 Bacteria 18466
72 Ga0466704_265452 3300042643 Bacteria 8952
73 Ga0466709_132712 3300042648 Unclassified 3996
74 Ga0466727_097877 3300042655 Bacteria 5333
75 Ga0466732_395811 3300042656 Bacteria 2624
76 Ga0160458_100129 3300012832 Bacteria 71995
77 Ga0466691_195596 3300042593 Bacteria 68522
78 Ga0466694_248831 3300042594 Bacteria 5736
79 Ga0466696_127301 3300042596 Bacteria 14363
80 Ga0466696_241291 3300042596 Bacteria 14156
81 Ga0466701_032440 3300042598 Bacteria 36525
82 Ga0466701_101937 3300042598 Unclassified 8170
83 Ga0466713_004082 3300042602 Bacteria 11197
84 Ga0466714_119108 3300042603 Bacteria 31126
85 Ga0466716_061326 3300042605 Bacteria 14963
86 Ga0466719_412780 3300042606 Bacteria 4726
87 Ga0466719_511887 3300042606 Bacteria 13009
88 Ga0466722_056344 3300042609 Bacteria 10160
89 CVPL010W_10001589 3300002931 Bacteria 26737
90 Ga0466711_154451 3300042615 Bacteria 10134
91 Ga0466715_348550 3300042616 Bacteria 8791
92 Ga0466728_002199 3300042620 Bacteria 14747
93 Ga0466735_127370 3300042624 Unclassified 2057
94 Ga0466703_164218 3300042636 Unclassified 3890
95 Ga0466703_245659 3300042636 Bacteria 4137
96 Ga0466704_213533 3300042643 Bacteria 18721
97 Ga0466709_097888 3300042648 Bacteria 12367
98 Ga0466725_356370 3300042654 Bacteria 4548
99 Ga0466727_088136 3300042655 Bacteria 36415
100 Ga0466705_134737 3300042612 Unclassified 2981
101 Ga0160431_101746 3300012828 Bacteria 5785
102 Ga0160458_100057 3300012832 Bacteria 146622
103 Ga0466690_008010 3300042590 Unclassified 2488
104 Ga0466690_276223 3300042590 Bacteria 213056
105 Ga0466692_103283 3300042591 Bacteria 43769
106 Ga0466696_289430 3300042596 Bacteria 8723
107 Ga0123356_10004477 3300010049 Bacteria 14432
108 Ga0123353_10039984 3300010167 Bacteria 7392
109 Ga0466713_000880 3300042602 Bacteria 20825
110 Ga0466713_039709 3300042602 Bacteria 19483
111 Ga0466717_288197 3300042604 Bacteria 8896
112 Ga0466722_113613 3300042609 Bacteria 129604
113 2227264126 2225789004 Bacteria 6978
114 Ga0104019_1001707 3300007150 Bacteria 4657
115 Ga0466715_009351 3300042616 Bacteria 3651
116 Ga0466703_018901 3300042636 Bacteria 24174
117 Ga0466704_016556 3300042643 Bacteria 24571
118 Ga0466709_395947 3300042648 Unclassified 3591
119 Ga0466690_088921 3300042590 Bacteria 12214
120 Ga0466690_093077 3300042590 Bacteria 18297
121 Ga0466691_162062 3300042593 Bacteria 7215
122 Ga0466691_195996 3300042593 Bacteria 7862
123 Ga0466696_094865 3300042596 Bacteria 7119
124 Ga0123354_10157760 3300010882 Unclassified 2712
125 Ga0466700_492297 3300042600 Bacteria 3817
126 Ga0466707_110727 3300042601 Bacteria 35379
127 IMNBL1DRAFT_c0000175 3300000062 Bacteria 57822
128 IMNBL1DRAFT_c0002118 3300000062 Bacteria 14131
129 JGI24702J35022_10003654 3300002462 Bacteria 9268
130 JGI24705J35276_12235710 3300002504 Bacteria 6871
131 Ga0068302_10146079 3300005071 Bacteria 2911
132 Ga0072941_1064385 3300005201 Bacteria 11729
133 Ga0104045_1004243 3300007085 Bacteria 3071
134 Ga0104050_1026374 3300007153 Bacteria 4150
135 Ga0104050_1030412 3300007153 Unclassified 5381
136 Ga0123357_10000724 3300009784 Bacteria 33173
137 Ga0466711_156960 3300042615 Bacteria 4410
138 Ga0466711_211189 3300042615 Bacteria 5626
139 Ga0466715_029715 3300042616 Bacteria 12268
140 Ga0466715_366812 3300042616 Bacteria 14293
141 Ga0466723_065795 3300042618 Bacteria 9437
142 Ga0466723_092262 3300042618 Bacteria 12052
143 Ga0466726_092632 3300042619 Bacteria 13843
144 Ga0466729_265155 3300042621 Bacteria 6087
145 Ga0466704_615496 3300042643 Unclassified 2181
146 Ga0466708_338675 3300042652 Bacteria 3137
147 Ga0466727_090088 3300042655 Bacteria 55654
148 Ga0466705_310410 3300042612 Bacteria 12899
149 Ga0160452_100806 3300012834 Bacteria 13737
150 Ga0160433_100665 3300012846 Bacteria 13502
151 Ga0466690_024889 3300042590 Bacteria 13821
152 Ga0466692_008187 3300042591 Bacteria 121981
153 Ga0466691_003757 3300042593 Bacteria 18190
154 Ga0466696_287294 3300042596 Bacteria 5023
155 Ga0123353_10088065 3300010167 Bacteria 5000
156 Ga0466700_204350 3300042600 Bacteria 4775
157 Ga0466707_346613 3300042601 Bacteria 17564
158 Ga0466719_198979 3300042606 Unclassified 9325
159 JGI24702J35022_10004968 3300002462 Bacteria 7846
160 Ga0123357_10002653 3300009784 Bacteria 20125
161 Ga0466715_168192 3300042616 Bacteria 33620
162 Ga0466715_175132 3300042616 Bacteria 16269
163 Ga0466715_418895 3300042616 Bacteria 29319
164 Ga0466723_171557 3300042618 Bacteria 14480
165 Ga0466726_073500 3300042619 Bacteria 2609
166 Ga0466728_427621 3300042620 Bacteria 4465
167 Ga0466729_139286 3300042621 Unclassified 2363
168 Ga0466724_44335 3300042649 Bacteria 16884
169 Ga0466708_442571 3300042652 Bacteria 24731
170 Ga0466697_258576 3300042611 Bacteria 357278
171 Ga0466705_077004 3300042612 Bacteria 12788
172 Ga0466705_264233 3300042612 Bacteria 10858
173 Ga0466705_286306 3300042612 Bacteria 5728
174 Ga0160470_100336 3300012813 Bacteria 25224
175 Ga0466657_303136 3300042582 Bacteria 4234
176 Ga0466692_073863 3300042591 Bacteria 38781
177 Ga0466693_209652 3300042592 Bacteria 2161
178 Ga0466691_010649 3300042593 Unclassified 10744
179 Ga0466691_080715 3300042593 Bacteria 6729
180 Ga0466696_116151 3300042596 Bacteria 3613
181 Ga0123353_10173875 3300010167 Bacteria 3416
182 Ga0123354_10004820 3300010882 Bacteria 19303
183 Ga0466701_035983 3300042598 Bacteria 36269
184 Ga0466707_207403 3300042601 Bacteria 18254
185 Ga0466707_400533 3300042601 Bacteria 11392
186 Ga0466713_094343 3300042602 Bacteria 28200
187 Ga0466714_165081 3300042603 Bacteria 2582
188 Ga0466719_300126 3300042606 Bacteria 15229
189 Ga0466719_355017 3300042606 Bacteria 2131
190 Ga0466722_117747 3300042609 Bacteria 2525
191 JGI24699J35502_11133691 3300002509 Bacteria 13646
192 JGI24699J35502_11133950 3300002509 Bacteria 20831
193 Ga0104050_1003365 3300007153 Bacteria 6891
194 Ga0466715_086917 3300042616 Bacteria 56772
195 Ga0466728_101688 3300042620 Unclassified 2120
196 Ga0466728_114249 3300042620 Bacteria 4369
197 Ga0466703_034121 3300042636 Bacteria 4794
198 Ga0466703_053718 3300042636 Bacteria 3003
199 Ga0466703_250543 3300042636 Bacteria 6655
200 Ga0466703_297454 3300042636 Bacteria 6380
201 Ga0466704_155034 3300042643 Bacteria 9967
202 Ga0466709_135583 3300042648 Bacteria 17502
203 Ga0466724_04938 3300042649 Bacteria 66026
204 Ga0466727_023475 3300042655 Unclassified 6670
205 Ga0466727_172706 3300042655 Bacteria 9365
206 Ga0466727_195524 3300042655 Bacteria 5700

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042624 Ga0466735_207110 Ga0466735_207110_13_1422 469
2 3300042596 Ga0466696_241291 Ga0466696_241291_7335_8915 480
3 3300042598 Ga0466701_101937 Ga0466701_101937_6676_8121 481
4 3300042649 Ga0466724_26684 Ga0466724_26684_55_1500 481
5 3300002504 JGI24705J35276_12235710 JGI24705J35276_122357103 484
6 3300007153 Ga0104050_1030412 Ga0104050_10304126 484
7 3300005201 Ga0072941_1064385 Ga0072941_10643857 491
8 3300042596 Ga0466696_127301 Ga0466696_127301_12567_14147 500
9 3300042600 Ga0466700_391349 Ga0466700_391349_6634_8208 502
10 3300042604 Ga0466717_288197 Ga0466717_288197_3767_5353 503
11 3300042636 Ga0466703_297454 Ga0466703_297454_1130_2704 503
12 3300042643 Ga0466704_213533 Ga0466704_213533_2266_3828 503
13 3300042603 Ga0466714_119108 Ga0466714_119108_1736_3313 504
14 3300042611 Ga0466697_258576 Ga0466697_258576_211109_212689 504
15 3300042621 Ga0466729_265155 Ga0466729_265155_1296_2870 504
16 3300010167 Ga0123353_10173875 Ga0123353_101738752 505
17 3300042655 Ga0466727_005039 Ga0466727_005039_1561_3123 505
18 3300042652 Ga0466708_442571 Ga0466708_442571_1866_3431 506
19 3300042648 Ga0466709_132712 Ga0466709_132712_112_1638 508
20 3300042648 Ga0466709_135583 Ga0466709_135583_14121_15653 510
21 3300042590 Ga0466690_024889 Ga0466690_024889_4260_5834 511
22 3300042636 Ga0466703_100833 Ga0466703_100833_6785_8365 512
23 3300042582 Ga0466657_303136 Ga0466657_303136_775_2361 513
24 3300042654 Ga0466725_356370 Ga0466725_356370_126_1706 513
25 3300042599 Ga0466706_152064 Ga0466706_152064_4743_6296 517
26 3300042612 Ga0466705_264233 Ga0466705_264233_7700_9298 518
27 3300042648 Ga0466709_159448 Ga0466709_159448_2108_3664 518
28 3300042600 Ga0466700_287679 Ga0466700_287679_1679_3262 519
29 3300042590 Ga0466690_316215 Ga0466690_316215_1139_2701 520
30 3300042595 Ga0466695_142173 Ga0466695_142173_8002_9564 520
31 3300042596 Ga0466696_094865 Ga0466696_094865_146_1708 520
32 3300042596 Ga0466696_141025 Ga0466696_141025_2044_3606 520
33 3300042606 Ga0466719_300126 Ga0466719_300126_4889_6451 520
34 3300042615 Ga0466711_211189 Ga0466711_211189_1552_3114 520
35 3300042616 Ga0466715_175132 Ga0466715_175132_4455_6017 520
36 3300042636 Ga0466703_250543 Ga0466703_250543_1337_2899 520
37 3300042643 Ga0466704_155034 Ga0466704_155034_372_1934 520
38 iso_pr_bacteria 2820770630 2820771153 520
39 3300042593 Ga0466691_003757 Ga0466691_003757_2776_4341 521
40 3300042593 Ga0466691_010649 Ga0466691_010649_5457_7022 521
41 3300042596 Ga0466696_174136 Ga0466696_174136_25433_26998 521
42 3300042601 Ga0466707_112084 Ga0466707_112084_33312_34877 521
43 3300042602 Ga0466713_000880 Ga0466713_000880_7003_8568 521
44 3300042605 Ga0466716_477229 Ga0466716_477229_1486_3051 521
45 3300042606 Ga0466719_355017 Ga0466719_355017_110_1675 521
46 3300042606 Ga0466719_511887 Ga0466719_511887_11239_12804 521
47 3300042612 Ga0466705_018553 Ga0466705_018553_2671_4236 521
48 3300042618 Ga0466723_092262 Ga0466723_092262_134_1699 521
49 3300042620 Ga0466728_002199 Ga0466728_002199_7435_9000 521
50 3300042620 Ga0466728_108850 Ga0466728_108850_646_2211 521
51 3300042624 Ga0466735_079085 Ga0466735_079085_1312_2877 521
52 3300042643 Ga0466704_265452 Ga0466704_265452_4152_5717 521
53 3300042648 Ga0466709_132999 Ga0466709_132999_73_1638 521
54 3300042652 Ga0466708_338675 Ga0466708_338675_704_2269 521
55 iso_pr_bacteria 2820736622 2820737237 521
56 iso_pr_bacteria 2820740053 2820740280 521
57 3300002462 JGI24702J35022_10001699 JGI24702J35022_1000169911 522
58 3300005083 Ga0068305_10159603 Ga0068305_101596033 522
59 3300042591 Ga0466692_008187 Ga0466692_008187_93667_95235 522
60 3300042598 Ga0466701_035983 Ga0466701_035983_22261_23829 522
61 3300042602 Ga0466713_004082 Ga0466713_004082_8122_9690 522
62 3300042602 Ga0466713_094343 Ga0466713_094343_9577_11145 522
63 3300042606 Ga0466719_198979 Ga0466719_198979_26_1594 522
64 3300042616 Ga0466715_168192 Ga0466715_168192_7315_8883 522
65 3300042618 Ga0466723_252593 Ga0466723_252593_6144_7712 522
66 3300042619 Ga0466726_073500 Ga0466726_073500_495_2063 522
67 3300042636 Ga0466703_164218 Ga0466703_164218_1993_3561 522
68 3300042648 Ga0466709_097888 Ga0466709_097888_4957_6525 522
69 iso_pr_bacteria 2820762746 2820763548 522
70 iso_pr_bacteria 643348524 643422995 522
71 3300002509 JGI24699J35502_11133950 JGI24699J35502_111339509 523
72 3300002931 CVPL010W_10001589 CVPL010W_100015893 523
73 3300005071 Ga0068302_10146079 Ga0068302_101460793 523
74 3300010167 Ga0123353_10426653 Ga0123353_104266531 523
75 3300042591 Ga0466692_005178 Ga0466692_005178_335_1906 523
76 3300042596 Ga0466696_287294 Ga0466696_287294_342_1913 523
77 3300042598 Ga0466701_032440 Ga0466701_032440_459_2030 523
78 3300042600 Ga0466700_492297 Ga0466700_492297_1498_3069 523
79 3300042601 Ga0466707_346613 Ga0466707_346613_6129_7700 523
80 3300042611 Ga0466697_015033 Ga0466697_015033_4944_6515 523
81 3300042648 Ga0466709_395947 Ga0466709_395947_993_2564 523
82 3300042652 Ga0466708_435989 Ga0466708_435989_25364_26935 523
83 3300042656 Ga0466732_395811 Ga0466732_395811_619_2190 523
84 iso_pr_bacteria 2920168565 2920171067 523
85 2225789004 2227264126 2227711176 524
86 3300000062 IMNBL1DRAFT_c0000175 IMNBL1DRAFT_000017529 524
87 3300010049 Ga0123356_10013726 Ga0123356_100137264 524
88 3300042590 Ga0466690_093077 Ga0466690_093077_7767_9341 524
89 3300042591 Ga0466692_073863 Ga0466692_073863_11496_13070 524
90 3300042596 Ga0466696_057862 Ga0466696_057862_7240_8814 524
91 3300042605 Ga0466716_061326 Ga0466716_061326_449_2023 524
92 3300042612 Ga0466705_134737 Ga0466705_134737_615_2189 524
93 3300042619 Ga0466726_288283 Ga0466726_288283_916_2490 524
94 3300042624 Ga0466735_203842 Ga0466735_203842_835_2409 524
95 3300042636 Ga0466703_186419 Ga0466703_186419_509_2083 524
96 3300042643 Ga0466704_016556 Ga0466704_016556_2671_4245 524
97 iso_pr_bacteria 2940216256 2940218256 524
98 3300009784 Ga0123357_10002653 Ga0123357_100026534 525
99 3300009784 Ga0123357_10014381 Ga0123357_100143811 525
100 3300010167 Ga0123353_10109686 Ga0123353_101096864 525
101 3300042602 Ga0466713_039709 Ga0466713_039709_16417_17994 525
102 3300042609 Ga0466722_056344 Ga0466722_056344_2618_4195 525
103 3300042609 Ga0466722_113613 Ga0466722_113613_81446_83023 525
104 3300042615 Ga0466711_283385 Ga0466711_283385_647_2224 525
105 3300042616 Ga0466715_366812 Ga0466715_366812_9570_11147 525
106 3300042620 Ga0466728_101688 Ga0466728_101688_383_1960 525
107 3300042620 Ga0466728_114249 Ga0466728_114249_232_1854 525
108 3300042620 Ga0466728_363953 Ga0466728_363953_593_2170 525
109 3300042636 Ga0466703_018901 Ga0466703_018901_14164_15741 525
110 3300042636 Ga0466703_034121 Ga0466703_034121_1996_3573 525
111 3300042652 Ga0466708_085297 Ga0466708_085297_1355_2932 525
112 3300042655 Ga0466727_097877 Ga0466727_097877_2615_4192 525
113 3300042659 Ga0466733_104374 Ga0466733_104374_3421_4998 525
114 iso_pr_bacteria 2820759988 2820760777 525
115 iso_pr_bacteria 2820776227 2820778311 525
116 3300002509 JGI24699J35502_11133381 JGI24699J35502_111333814 526
117 3300002509 JGI24699J35502_11133691 JGI24699J35502_111336917 526
118 3300042590 Ga0466690_008010 Ga0466690_008010_30_1610 526
119 3300042590 Ga0466690_128671 Ga0466690_128671_1925_3505 526
120 3300042591 Ga0466692_100725 Ga0466692_100725_323_1903 526
121 3300042591 Ga0466692_103283 Ga0466692_103283_41736_43316 526
122 3300042593 Ga0466691_195996 Ga0466691_195996_4303_5883 526
123 3300042600 Ga0466700_204350 Ga0466700_204350_272_1852 526
124 3300042601 Ga0466707_110727 Ga0466707_110727_24165_25745 526
125 3300042601 Ga0466707_207403 Ga0466707_207403_3354_4934 526
126 3300042601 Ga0466707_400533 Ga0466707_400533_8032_9612 526
127 3300042603 Ga0466714_165081 Ga0466714_165081_620_2200 526
128 3300042609 Ga0466722_039485 Ga0466722_039485_12937_14517 526
129 3300042612 Ga0466705_077004 Ga0466705_077004_4590_6170 526
130 3300042612 Ga0466705_310410 Ga0466705_310410_3060_4640 526
131 3300042615 Ga0466711_034882 Ga0466711_034882_2014_3594 526
132 3300042616 Ga0466715_009351 Ga0466715_009351_216_1796 526
133 3300042616 Ga0466715_029715 Ga0466715_029715_6288_7868 526
134 3300042616 Ga0466715_418895 Ga0466715_418895_25497_27077 526
135 3300042618 Ga0466723_171557 Ga0466723_171557_3319_4899 526
136 3300042619 Ga0466726_092632 Ga0466726_092632_11057_12637 526
137 3300042620 Ga0466728_427621 Ga0466728_427621_386_1966 526
138 3300042621 Ga0466729_139286 Ga0466729_139286_414_1994 526
139 3300042624 Ga0466735_127370 Ga0466735_127370_328_1908 526
140 3300042636 Ga0466703_245659 Ga0466703_245659_303_1883 526
141 3300042643 Ga0466704_030112 Ga0466704_030112_295_1875 526
142 3300042643 Ga0466704_615496 Ga0466704_615496_419_1999 526
143 3300042655 Ga0466727_023475 Ga0466727_023475_4148_5728 526
144 3300042655 Ga0466727_088136 Ga0466727_088136_8075_9655 526
145 3300042655 Ga0466727_090088 Ga0466727_090088_37185_38765 526
146 3300042655 Ga0466727_172706 Ga0466727_172706_6459_8039 526
147 iso_pr_bacteria 2967483437 2967484788 526
148 3300000062 IMNBL1DRAFT_c0000742 IMNBL1DRAFT_000074220 527
149 3300000062 IMNBL1DRAFT_c0002118 IMNBL1DRAFT_000211812 527
150 3300002462 JGI24702J35022_10003654 JGI24702J35022_100036542 527
151 3300002462 JGI24702J35022_10004968 JGI24702J35022_100049682 527
152 3300009784 Ga0123357_10000724 Ga0123357_1000072425 527
153 3300009784 Ga0123357_10002074 Ga0123357_100020742 527
154 3300042593 Ga0466691_162062 Ga0466691_162062_1476_3059 527
155 3300042596 Ga0466696_289430 Ga0466696_289430_1815_3398 527
156 3300042596 Ga0466696_491992 Ga0466696_491992_7431_9014 527
157 3300042606 Ga0466719_032426 Ga0466719_032426_230_1813 527
158 3300042616 Ga0466715_348550 Ga0466715_348550_5288_6871 527
159 3300042619 Ga0466726_126009 Ga0466726_126009_138_1721 527
160 3300010882 Ga0123354_10004820 Ga0123354_1000482013 528
161 3300010882 Ga0123354_10037503 Ga0123354_100375036 528
162 3300042590 Ga0466690_088921 Ga0466690_088921_5329_6915 528
163 3300042592 Ga0466693_209652 Ga0466693_209652_78_1664 528
164 3300042593 Ga0466691_080715 Ga0466691_080715_1754_3340 528
165 3300042596 Ga0466696_445279 Ga0466696_445279_2769_4355 528
166 3300042615 Ga0466711_057204 Ga0466711_057204_494_2080 528
167 3300042616 Ga0466715_086917 Ga0466715_086917_25976_27562 528
168 3300042618 Ga0466723_065795 Ga0466723_065795_2389_3975 528
169 3300042620 Ga0466728_026624 Ga0466728_026624_3018_4604 528
170 3300042636 Ga0466703_053718 Ga0466703_053718_1338_2924 528
171 3300042643 Ga0466704_295143 Ga0466704_295143_183_1769 528
172 3300042652 Ga0466708_058687 Ga0466708_058687_16876_18462 528
173 3300042655 Ga0466727_195524 Ga0466727_195524_2987_4573 528
174 3300010049 Ga0123356_10004477 Ga0123356_1000447710 529
175 3300010167 Ga0123353_10039984 Ga0123353_100399845 529
176 3300010882 Ga0123354_10157760 Ga0123354_101577602 529
177 3300010882 Ga0123354_10200282 Ga0123354_102002821 529
178 3300012813 Ga0160470_100336 Ga0160470_10033610 529
179 3300012828 Ga0160431_101746 Ga0160431_1017462 529
180 3300012832 Ga0160458_100016 Ga0160458_100016207 529
181 3300012832 Ga0160458_100057 Ga0160458_10005779 529
182 3300012834 Ga0160452_100806 Ga0160452_1008067 529
183 3300012837 Ga0160455_100119 Ga0160455_10011991 529
184 3300012846 Ga0160433_100665 Ga0160433_1006657 529
185 3300012858 Ga0160457_1000837 Ga0160457_10008375 529
186 3300042602 Ga0466713_083350 Ga0466713_083350_7952_9541 529
187 3300042606 Ga0466719_412780 Ga0466719_412780_309_1898 529
188 iso_pr_bacteria 2590828803 2592929017 529
189 3300009784 Ga0123357_10074969 Ga0123357_100749692 530
190 3300042593 Ga0466691_195596 Ga0466691_195596_39352_40944 530
191 3300042598 Ga0466701_028503 Ga0466701_028503_15676_17268 530
192 3300042605 Ga0466716_144617 Ga0466716_144617_8463_10055 530
193 3300042605 Ga0466716_308172 Ga0466716_308172_1906_3498 530
194 3300042609 Ga0466722_117747 Ga0466722_117747_408_2000 530
195 3300042649 Ga0466724_04938 Ga0466724_04938_42343_43935 530
196 3300042649 Ga0466724_44335 Ga0466724_44335_5175_6767 530
197 iso_pr_bacteria 2579779088 2582237633 530
198 3300007085 Ga0104045_1004243 Ga0104045_10042432 531
199 3300007085 Ga0104045_1004822 Ga0104045_10048221 531
200 3300007150 Ga0104019_1001707 Ga0104019_10017072 531
201 3300007153 Ga0104050_1003365 Ga0104050_10033653 531
202 3300007153 Ga0104050_1026374 Ga0104050_10263743 531
203 3300009784 Ga0123357_10034584 Ga0123357_100345844 531
204 3300010882 Ga0123354_10003206 Ga0123354_100032067 531
205 3300012806 Ga0160442_100009 Ga0160442_100009391 531
206 3300012832 Ga0160458_100129 Ga0160458_10012957 531
207 3300042615 Ga0466711_156960 Ga0466711_156960_2370_3965 531
208 3300042621 Ga0466729_274747 Ga0466729_274747_1266_2861 531
209 3300007150 Ga0104019_1005418 Ga0104019_10054182 532
210 3300010167 Ga0123353_10088065 Ga0123353_100880656 532
211 3300042594 Ga0466694_248831 Ga0466694_248831_1928_3526 532
212 3300042615 Ga0466711_154451 Ga0466711_154451_4620_6221 533
213 3300042612 Ga0466705_286306 Ga0466705_286306_901_2508 535
214 3300042625 Ga0466730_103184 Ga0466730_103184_79950_81557 535
215 3300042596 Ga0466696_116151 Ga0466696_116151_1244_2875 543
216 3300042606 Ga0466719_534977 Ga0466719_534977_717_2354 545
217 3300042590 Ga0466690_276223 Ga0466690_276223_101279_102934 551
218 3300042618 Ga0466723_071095 Ga0466723_071095_194_1867 557

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00890 FAD_binding_2 FAD binding domain 6 370 0.97
PF02910 Succ_DH_flav_C Fumarate reductase flavoprotein C-term 400 480 0.94
PF01266 DAO FAD dependent oxidoreductase 6 145 0.77

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02910 GO:0016491 oxidoreductase activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.85 0.85 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.