Protein Family IF00889

Metagenome Metatranscriptome Isolate
231 Members
89 Samples
188 Scaffolds
357.97 Avg Length

🧬 Representative Sequence

ID
3300002504|JGI24705J35276_12232821|JGI24705J35276_122328215
Length
424 aa
Sequence
MVGYLVLENGDVFKGERIGSNNDVAFELVFNTEMFGYMEVFTDPSYFGQGLLMTYPLIGNYGVIPEDFESEKIWAEAIFVNEFVENGNNFRAKCGLDKFLKNSNIPGLKGVNTEEIAKVLKECGTLKGYLTSEINNIEEILEKIKKYKIEKPIDKVTCRTKLVFGKTKPKQIALIDYGVKHNIVNSLLKRNVGVTVYPAGTSAETILTVRPSGIVLSNGPGNPKEYDTQIEVIKKLCKTNIPILGIGLGHQLLAIAMGAKTEKLKYGHRGNYPIKNLKKDKVNITSQNHGYCVSKNSIDLEIAEIVHINLEDETIEGLKYKNKNIVSVQFQPEACPGPEDANYIFDEFVNGFYKNIDEDGNIKLLKTVPNIEDKQSLKDIMQAINVPYMSKDEKHIADWKEIGYELIRDNKRKLYNSLQHGKY*

📊 Sample Types

Isolate 18.6%
Metagenome 81.0%
MAG 0.0%
Metatranscriptome 0.4%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 44.0%
Termitidae 32.1%
Kalotermitidae 7.1%
Formicidae 3.6%
Elmidae 2.4%
Passalidae 2.4%
Rhinotermitidae 2.4%
Termopsidae 1.2%
Daphniidae 1.2%
Drosophilidae 1.2%
Cambaridae 1.2%
Hodotermitidae 1.2%

🌳 Taxonomy

Archaea 3
Bacteria 223
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2864878056 Flavobacterium notoginsengisoli S00128 Isolate Elmidae
2 2864886855 Flavobacterium nitrogenifigens S00142 Isolate Elmidae
3 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
4 2778260941 Unclassified Fibrobacteres Th196P3bin8 Isolate Unclassified
5 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
6 2820261600 Unclassified Firmicutes Th196P3bin40 Isolate Unclassified
7 2820272499 Unclassified Firmicutes Th196P3bin18 Isolate Unclassified
8 2820277137 Unclassified Firmicutes Th196P3bin150 Isolate Unclassified
9 2820362221 Unclassified Firmicutes Nt197P3bin116 Isolate Unclassified
10 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
11 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
12 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
13 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
14 2820234266 Unclassified Firmicutes Th196P3bin99 Isolate Unclassified
15 2820255904 Unclassified Firmicutes Th196P3bin48 Isolate Unclassified
16 2820408893 Unclassified Firmicutes Lab288P4bin80 Isolate Unclassified
17 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
18 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
19 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
20 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
21 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
22 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
23 2781125681 Treponema sp. Lab288P1bin11 Isolate Unclassified
24 2781125690 Treponema sp. Th196P3bin63 Isolate Unclassified
25 2820246658 Unclassified Firmicutes Th196P3bin70 Isolate Unclassified
26 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
27 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
28 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
29 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
30 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
31 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
32 2820001644 Unclassified Synergistetes Th196P3bin106 Isolate Unclassified
33 2820290662 Unclassified Firmicutes Th196P3bin135 Isolate Unclassified
34 2820707375 Unclassified Firmicutes Co191P1bin31 Isolate Unclassified
35 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
36 3300021235 Termite gut microbial communities from nest from French Guiana - FG16_2_6 mRNA SA Metatranscriptome
37 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
38 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
39 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
40 2904728850 Flavobacterium sp. xlx-214 Isolate
41 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
42 2811995047 Flavobacterium succinicans DD5b Isolate Daphniidae
43 2820488713 Unclassified Firmicutes Lab288P1bin69 Isolate Unclassified
44 2820551407 Unclassified Firmicutes Emb289P4bin38 Isolate Unclassified
45 2820633305 Unclassified Firmicutes Emb289P1bin118 Isolate Unclassified
46 2820669764 Unclassified Firmicutes Co191P3bin30 Isolate Unclassified
47 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
48 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
49 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
50 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
51 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
52 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
53 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
54 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
55 2820288918 Unclassified Firmicutes Th196P3bin137 Isolate Unclassified
56 2820387566 Unclassified Firmicutes Nt197P1bin1 Isolate Unclassified
57 2820654856 Unclassified Firmicutes Cu122P1bin2 Isolate Unclassified
58 2820679524 Unclassified Firmicutes Co191P1bin94 Isolate Unclassified
59 2820688768 Unclassified Firmicutes Co191P1bin74 Isolate Unclassified
60 2820702360 Unclassified Firmicutes Co191P1bin4 Isolate Unclassified
61 2758568796 Unclassified Deltaproteobacteria Th196P3_bin21 Isolate Unclassified
62 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
63 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
64 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
65 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
66 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
67 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
68 2958471994 Flavobacterium sp. xlx-221 Isolate Cambaridae
69 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified
70 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
71 2781125655 Treponema sp. Emb289P1bin105 Isolate Unclassified
72 2820244222 Unclassified Firmicutes Th196P3bin75 Isolate Unclassified
73 2820292184 Unclassified Firmicutes Th196P3bin109 Isolate Unclassified
74 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
75 2882250448 Bizionia sp. APA-3 Isolate
76 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
77 2820306284 Unclassified Firmicutes Th196P1bin11 Isolate Unclassified
78 2820447167 Unclassified Firmicutes Lab288P3bin192 Isolate Unclassified
79 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
80 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
81 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
82 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
83 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
84 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
85 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
86 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
87 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
88 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
89 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_148094 3300042656 Bacteria 1988
2 Ga0466732_370565 3300042656 Bacteria 1464
3 Ga0466733_134180 3300042659 Bacteria 1406
4 Ga0466719_462795 3300042606 Bacteria 6384
5 Ga0466720_218416 3300042607 Bacteria 1318
6 Ga0466722_147052 3300042609 Bacteria 82065
7 2227119714 2225789004 Bacteria 9170
8 IMNBL1DRAFT_c0000032 3300000062 Bacteria 125696
9 IMNBL1DRAFT_c0000334 3300000062 Bacteria 40007
10 AustNasuHG_c1009740 3300000089 Bacteria 3366
11 JGI24698J34947_10001444 3300002449 Bacteria 12509
12 JGI24698J34947_10016631 3300002449 Bacteria 3990
13 JGI24698J34947_10018469 3300002449 Bacteria 3766
14 JGI24698J34947_10037175 3300002449 Bacteria 2531
15 JGI24695J34938_10006443 3300002450 Bacteria 7045
16 JGI24703J35330_11748536 3300002501 Bacteria 18955
17 Ga0072941_1040491 3300005201 Bacteria 4947
18 Ga0466718_004635 3300042617 Bacteria 2032
19 Ga0466718_103383 3300042617 Bacteria 7751
20 Ga0466718_167103 3300042617 Bacteria 12579
21 Ga0466702_336294 3300042635 Bacteria 3942
22 Ga0264413_108908 3300024493 Bacteria 9597
23 Ga0466693_127953 3300042592 Bacteria 1983
24 Ga0466699_438660 3300042597 Bacteria 3199
25 Ga0123355_10004150 3300009826 Bacteria 21021
26 Ga0123355_10012453 3300009826 Bacteria 13172
27 Ga0123355_10075814 3300009826 Bacteria 5381
28 Ga0123355_10270630 3300009826 Bacteria 2361
29 Ga0123356_10488058 3300010049 Bacteria 1386
30 Ga0123353_10049349 3300010167 Bacteria 6705
31 Ga0466732_127171 3300042656 Bacteria 9699
32 Ga0466706_041625 3300042599 Bacteria 25684
33 Ga0466719_043513 3300042606 Bacteria 2743
34 Ga0466720_066729 3300042607 Bacteria 10048
35 Ga0466720_110133 3300042607 Bacteria 7084
36 Ga0466720_218873 3300042607 Unclassified 1303
37 AustNasuHG_c1001306 3300000089 Bacteria 8942
38 AustNasuHG_c1002286 3300000089 Bacteria 6921
39 JGI24698J34947_10002764 3300002449 Bacteria 9495
40 JGI24698J34947_10012821 3300002449 Archaea 4586
41 JGI24698J34947_10018571 3300002449 Bacteria 3756
42 Ga0072941_1475654 3300005201 Bacteria 2095
43 Ga0104045_1003632 3300007085 Bacteria 6755
44 Ga0123357_10000157 3300009784 Bacteria 60865
45 Ga0466705_506414 3300042612 Bacteria 5165
46 Ga0466712_032721 3300042614 Bacteria 21348
47 Ga0466712_155308 3300042614 Bacteria 2734
48 Ga0466715_213689 3300042616 Bacteria 48053
49 Ga0466715_536042 3300042616 Bacteria 12233
50 Ga0466718_162315 3300042617 Bacteria 1735
51 Ga0466702_298503 3300042635 Bacteria 3095
52 Ga0466704_613158 3300042643 Unclassified 1113
53 Ga0466696_079855 3300042596 Bacteria 15369
54 Ga0466706_223825 3300042599 Bacteria 13439
55 Ga0466720_027910 3300042607 Bacteria 7389
56 Ga0466720_056099 3300042607 Bacteria 4477
57 Ga0466720_127186 3300042607 Bacteria 4515
58 Ga0466698_029699 3300042610 Bacteria 18817
59 Ga0466698_063566 3300042610 Bacteria 5197
60 Ga0466698_243001 3300042610 Bacteria 1715
61 IMNBL1DRAFT_c0026273 3300000062 Bacteria 2214
62 JGI24698J34947_10002262 3300002449 Bacteria 10317
63 JGI24695J34938_10000486 3300002450 Bacteria 38538
64 JGI24700J35501_10930570 3300002508 Bacteria 15892
65 Ga0072940_1000897 3300005200 Bacteria 20293
66 Ga0074263_109624 3300005485 Bacteria 5458
67 Ga0466712_314745 3300042614 Bacteria 34934
68 Ga0466718_043711 3300042617 Bacteria 5622
69 Ga0466718_052770 3300042617 Bacteria 5596
70 Ga0466718_160334 3300042617 Bacteria 1378
71 Ga0466702_249320 3300042635 Bacteria 14080
72 Ga0466693_248755 3300042592 Bacteria 5479
73 Ga0466694_174349 3300042594 Bacteria 93398
74 Ga0466699_071356 3300042597 Bacteria 5028
75 Ga0123355_10000853 3300009826 Bacteria 42039
76 Ga0123355_10087766 3300009826 Bacteria 4942
77 Ga0123355_10284939 3300009826 Bacteria 2275
78 Ga0466705_158168 3300042612 Bacteria 10450
79 Ga0466732_208334 3300042656 Bacteria 3846
80 Ga0466706_163386 3300042599 Bacteria 5158
81 Ga0466720_202859 3300042607 Unclassified 1823
82 IMNBL1DRAFT_c0000373 3300000062 Unclassified 38278
83 JGI24698J34947_10007770 3300002449 Bacteria 5890
84 JGI24698J34947_10010383 3300002449 Bacteria 5107
85 JGI24698J34947_10012741 3300002449 Bacteria 4602
86 JGI24698J34947_10026764 3300002449 Bacteria 3062
87 Ga0072940_1032719 3300005200 Bacteria 3672
88 Ga0072941_1005628 3300005201 Bacteria 4615
89 Ga0466712_012817 3300042614 Bacteria 12480
90 Ga0466712_054915 3300042614 Bacteria 81067
91 Ga0466712_086077 3300042614 Bacteria 2324
92 Ga0466715_626207 3300042616 Bacteria 54952
93 Ga0466718_109287 3300042617 Bacteria 23473
94 Ga0466718_118279 3300042617 Bacteria 3267
95 Ga0466718_130583 3300042617 Bacteria 2943
96 Ga0466702_184273 3300042635 Bacteria 2889
97 Ga0466702_239165 3300042635 Bacteria 2208
98 Ga0264413_104306 3300024493 Bacteria 15415
99 Ga0123355_10003266 3300009826 Bacteria 23169
100 Ga0123355_10167797 3300009826 Bacteria 3289
101 Ga0123353_10112447 3300010167 Bacteria 4385
102 Ga0466732_255003 3300042656 Archaea 12212
103 Ga0466732_379577 3300042656 Bacteria 21224
104 Ga0466706_131160 3300042599 Bacteria 9350
105 Ga0466707_200198 3300042601 Bacteria 7294
106 Ga0466716_183734 3300042605 Bacteria 316127
107 Ga0466720_085977 3300042607 Bacteria 8276
108 Ga0466720_113530 3300042607 Bacteria 6898
109 2227471850 2225789004 Bacteria 23461
110 IMNBL1DRAFT_c0002348 3300000062 Bacteria 13240
111 IMNBL1DRAFT_c0002469 3300000062 Bacteria 12861
112 JGI24698J34947_10047480 3300002449 Bacteria 2179
113 JGI24698J34947_10061795 3300002449 Bacteria 1841
114 JGI24695J34938_10002241 3300002450 Bacteria 14990
115 Ga0466718_011030 3300042617 Bacteria 12848
116 Ga0466718_115277 3300042617 Bacteria 30003
117 Ga0466702_075402 3300042635 Bacteria 1210
118 Ga0466702_449019 3300042635 Bacteria 1513
119 Ga0466704_471434 3300042643 Bacteria 11240
120 Ga0223674_1023338 3300021235 Bacteria 1453
121 Ga0123355_10001092 3300009826 Bacteria 37485
122 Ga0123355_10002423 3300009826 Bacteria 26361
123 Ga0466720_064250 3300042607 Bacteria 3302
124 Ga0466721_251890 3300042608 Bacteria 3052
125 Ga0466722_167478 3300042609 Bacteria 5842
126 IMNBL1DRAFT_c0002172 3300000062 Bacteria 13871
127 IMNBL1DRAFT_c0006731 3300000062 Bacteria 6217
128 JGI24698J34947_10001674 3300002449 Bacteria 11831
129 JGI24695J34938_10000233 3300002450 Bacteria 52947
130 JGI24695J34938_10017801 3300002450 Bacteria 3569
131 Ga0102734_1002625 3300007129 Bacteria 5394
132 Ga0466712_002731 3300042614 Bacteria 17880
133 Ga0466718_001573 3300042617 Bacteria 3698
134 Ga0466718_012651 3300042617 Bacteria 5596
135 Ga0466704_354940 3300042643 Bacteria 13993
136 Ga0466727_326385 3300042655 Bacteria 4249
137 Ga0264413_101913 3300024493 Bacteria 41909
138 Ga0466657_098945 3300042582 Bacteria 51985
139 Ga0123355_10003039 3300009826 Bacteria 23900
140 Ga0123355_10013571 3300009826 Bacteria 12690
141 Ga0123355_10081314 3300009826 Bacteria 5170
142 Ga0123354_10069272 3300010882 Bacteria 5117
143 Ga0466732_127367 3300042656 Bacteria 10479
144 Ga0466706_104187 3300042599 Bacteria 6292
145 Ga0466706_253390 3300042599 Bacteria 4333
146 Ga0466714_076058 3300042603 Bacteria 2122
147 Ga0466720_121956 3300042607 Bacteria 8223
148 Ga0466722_204410 3300042609 Bacteria 3451
149 Ga0466698_083405 3300042610 Bacteria 2680
150 IMNBL1DRAFT_c0001484 3300000062 Bacteria 17492
151 AustNasuHG_c1001496 3300000089 Bacteria 8376
152 JGI24698J34947_10001576 3300002449 Bacteria 12081
153 JGI24698J34947_10007479 3300002449 Bacteria 6003
154 JGI24698J34947_10048912 3300002449 Bacteria 2139
155 JGI24695J34938_10002198 3300002450 Bacteria 15203
156 JGI24695J34938_10008106 3300002450 Bacteria 6044
157 JGI24705J35276_12232821 3300002504 Bacteria 4531
158 Ga0072941_1018149 3300005201 Bacteria 8007
159 Ga0074263_110359 3300005485 Bacteria 4470
160 Ga0102740_1001050 3300007140 Bacteria 7283
161 Ga0466712_055244 3300042614 Bacteria 3078
162 Ga0466712_219405 3300042614 Bacteria 1291
163 Ga0466718_011941 3300042617 Archaea 2920
164 Ga0466729_147210 3300042621 Bacteria 6405
165 Ga0264413_101684 3300024493 Bacteria 18599
166 Ga0415639_092149 3300038395 Bacteria 1577
167 Ga0415639_151752 3300038395 Bacteria 4808
168 Ga0466693_364957 3300042592 Bacteria 2653
169 Ga0466699_087352 3300042597 Bacteria 2748
170 Ga0466714_121495 3300042603 Bacteria 28903
171 Ga0466720_115322 3300042607 Bacteria 42347
172 Ga0466722_014813 3300042609 Bacteria 8778
173 Ga0466698_365833 3300042610 Bacteria 2264
174 Ga0466698_381628 3300042610 Bacteria 10303
175 2227494066 2225789004 Bacteria 20333
176 AustNasuHG_c1015706 3300000089 Bacteria 2549
177 JGI24698J34947_10003566 3300002449 Bacteria 8450
178 CVPL010W_10006998 3300002931 Bacteria 11295
179 Ga0104045_1075333 3300007085 Bacteria 2036
180 Ga0466712_021182 3300042614 Bacteria 18924
181 Ga0466712_250860 3300042614 Bacteria 5394
182 Ga0466729_261638 3300042621 Bacteria 163955
183 Ga0466702_106398 3300042635 Bacteria 2252
184 Ga0466704_608829 3300042643 Bacteria 104400
185 Ga0264413_130950 3300024493 Unclassified 1594
186 Ga0415639_057604 3300038395 Bacteria 1630
187 Ga0123355_10001344 3300009826 Bacteria 34139
188 Ga0123353_10002784 3300010167 Bacteria 21829

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042643 Ga0466704_613158 Ga0466704_613158_204_1100 298
2 3300024493 Ga0264413_130950 Ga0264413_1309502 309
3 3300002449 JGI24698J34947_10012821 JGI24698J34947_100128215 331
4 3300009826 Ga0123355_10000853 Ga0123355_1000085321 332
5 3300002450 JGI24695J34938_10002198 JGI24695J34938_100021984 339
6 3300042610 Ga0466698_243001 Ga0466698_243001_594_1649 340
7 3300042655 Ga0466727_326385 Ga0466727_326385_1718_2743 341
8 3300024493 Ga0264413_108908 Ga0264413_1089087 343
9 3300042608 Ga0466721_251890 Ga0466721_251890_705_1736 343
10 3300009826 Ga0123355_10012453 Ga0123355_100124532 346
11 3300002449 JGI24698J34947_10037175 JGI24698J34947_100371752 347
12 iso_pr_bacteria 2820688768 2820689290 347
13 3300000089 AustNasuHG_c1009740 AustNasuHG_10097402 348
14 3300042594 Ga0466694_174349 Ga0466694_174349_73103_74149 348
15 3300042635 Ga0466702_239165 Ga0466702_239165_858_1904 348
16 3300009826 Ga0123355_10013571 Ga0123355_100135712 349
17 3300009826 Ga0123355_10075814 Ga0123355_100758142 349
18 3300009826 Ga0123355_10284939 Ga0123355_102849392 349
19 3300024493 Ga0264413_101913 Ga0264413_1019133 349
20 3300042609 Ga0466722_204410 Ga0466722_204410_1858_2907 349
21 3300042635 Ga0466702_298503 Ga0466702_298503_879_1928 349
22 3300042656 Ga0466732_208334 Ga0466732_208334_329_1378 349
23 iso_pr_bacteria 2820001644 2820001717 349
24 iso_pr_bacteria 2820244222 2820246296 349
25 iso_pr_bacteria 2820654856 2820656736 349
26 3300009826 Ga0123355_10004150 Ga0123355_1000415019 350
27 3300009826 Ga0123355_10087766 Ga0123355_100877662 350
28 3300042607 Ga0466720_115322 Ga0466720_115322_34182_35264 350
29 3300042614 Ga0466712_021182 Ga0466712_021182_11226_12278 350
30 3300042617 Ga0466718_115277 Ga0466718_115277_6389_7441 350
31 3300042656 Ga0466732_127171 Ga0466732_127171_6489_7559 350
32 iso_pr_bacteria 2758568796 2761047280 350
33 iso_pr_bacteria 2820261600 2820261908 350
34 iso_pr_bacteria 2820272499 2820272895 350
35 iso_pr_bacteria 2820277137 2820277570 350
36 iso_pr_bacteria 2820290662 2820291934 350
37 3300009826 Ga0123355_10167797 Ga0123355_101677972 351
38 3300021235 Ga0223674_1023338 Ga0223674_10233382 351
39 3300024493 Ga0264413_101684 Ga0264413_1016845 351
40 3300038395 Ga0415639_151752 Ga0415639_151752_1088_2143 351
41 3300042601 Ga0466707_200198 Ga0466707_200198_1982_3037 351
42 3300042610 Ga0466698_029699 Ga0466698_029699_5047_6102 351
43 3300042617 Ga0466718_001573 Ga0466718_001573_1764_2819 351
44 3300042617 Ga0466718_109287 Ga0466718_109287_7299_8354 351
45 3300042617 Ga0466718_167103 Ga0466718_167103_4464_5519 351
46 3300042635 Ga0466702_249320 Ga0466702_249320_938_1993 351
47 iso_pr_bacteria 2820255904 2820257407 351
48 iso_pr_bacteria 2820292184 2820292445 351
49 iso_pr_bacteria 2820488713 2820489713 351
50 iso_pr_bacteria 2820633305 2820634250 351
51 3300002449 JGI24698J34947_10001674 JGI24698J34947_100016742 352
52 3300002449 JGI24698J34947_10016631 JGI24698J34947_100166314 352
53 3300005200 Ga0072940_1032719 Ga0072940_10327193 352
54 3300009826 Ga0123355_10081314 Ga0123355_100813142 352
55 3300024493 Ga0264413_104306 Ga0264413_10430611 352
56 3300042599 Ga0466706_223825 Ga0466706_223825_2272_3393 352
57 3300042607 Ga0466720_027910 Ga0466720_027910_2875_3933 352
58 3300042607 Ga0466720_085977 Ga0466720_085977_3762_4820 352
59 3300042610 Ga0466698_365833 Ga0466698_365833_52_1110 352
60 3300042614 Ga0466712_054915 Ga0466712_054915_51415_52473 352
61 3300042614 Ga0466712_219405 Ga0466712_219405_27_1085 352
62 3300042617 Ga0466718_011941 Ga0466718_011941_267_1325 352
63 3300042617 Ga0466718_012651 Ga0466718_012651_3620_4678 352
64 3300042617 Ga0466718_052770 Ga0466718_052770_3620_4678 352
65 3300042617 Ga0466718_118279 Ga0466718_118279_1577_2635 352
66 3300042617 Ga0466718_130583 Ga0466718_130583_1455_2513 352
67 3300042635 Ga0466702_336294 Ga0466702_336294_431_1489 352
68 iso_pr_bacteria 2820306284 2820308197 352
69 3300000062 IMNBL1DRAFT_c0002348 IMNBL1DRAFT_000234812 353
70 3300000089 AustNasuHG_c1002286 AustNasuHG_10022862 353
71 3300002449 JGI24698J34947_10003566 JGI24698J34947_100035661 353
72 3300002449 JGI24698J34947_10007770 JGI24698J34947_100077702 353
73 3300002449 JGI24698J34947_10010383 JGI24698J34947_100103835 353
74 3300002449 JGI24698J34947_10018571 JGI24698J34947_100185714 353
75 3300002449 JGI24698J34947_10047480 JGI24698J34947_100474802 353
76 3300002449 JGI24698J34947_10061795 JGI24698J34947_100617952 353
77 3300002508 JGI24700J35501_10930570 JGI24700J35501_1093057015 353
78 3300005201 Ga0072941_1005628 Ga0072941_10056282 353
79 3300005201 Ga0072941_1018149 Ga0072941_10181492 353
80 3300005201 Ga0072941_1040491 Ga0072941_10404914 353
81 3300009826 Ga0123355_10003039 Ga0123355_1000303915 353
82 3300042607 Ga0466720_110133 Ga0466720_110133_1806_2867 353
83 3300042610 Ga0466698_063566 Ga0466698_063566_635_1696 353
84 3300042610 Ga0466698_083405 Ga0466698_083405_606_1694 353
85 3300042614 Ga0466712_055244 Ga0466712_055244_472_1533 353
86 3300042617 Ga0466718_011030 Ga0466718_011030_2294_3355 353
87 3300042617 Ga0466718_103383 Ga0466718_103383_1353_2414 353
88 3300042635 Ga0466702_184273 Ga0466702_184273_1198_2259 353
89 3300042643 Ga0466704_354940 Ga0466704_354940_12436_13497 353
90 3300042656 Ga0466732_127367 Ga0466732_127367_1167_2228 353
91 iso_pr_bacteria 2781125655 2781317435 353
92 iso_pr_bacteria 2819992462 2819993664 353
93 iso_pr_bacteria 2820447167 2820448220 353
94 3300000089 AustNasuHG_c1001306 AustNasuHG_10013062 354
95 3300002449 JGI24698J34947_10048912 JGI24698J34947_100489122 354
96 3300009784 Ga0123357_10000157 Ga0123357_1000015734 354
97 3300009826 Ga0123355_10001092 Ga0123355_1000109221 354
98 3300009826 Ga0123355_10001344 Ga0123355_1000134449 354
99 3300009826 Ga0123355_10002423 Ga0123355_100024238 354
100 3300009826 Ga0123355_10003266 Ga0123355_100032667 354
101 3300010167 Ga0123353_10049349 Ga0123353_100493493 354
102 3300042607 Ga0466720_056099 Ga0466720_056099_1259_2338 354
103 3300042609 Ga0466722_014813 Ga0466722_014813_147_1211 354
104 3300042614 Ga0466712_314745 Ga0466712_314745_12749_13813 354
105 3300042617 Ga0466718_160334 Ga0466718_160334_118_1182 354
106 iso_pr_bacteria 2820669764 2820670131 354
107 iso_pr_bacteria 2820679524 2820679550 354
108 3300002450 JGI24695J34938_10017801 JGI24695J34938_100178012 355
109 3300042607 Ga0466720_218873 Ga0466720_218873_135_1202 355
110 3300042617 Ga0466718_162315 Ga0466718_162315_390_1457 355
111 3300042635 Ga0466702_106398 Ga0466702_106398_703_1770 355
112 iso_pr_bacteria 2778260941 2778358503 355
113 iso_pr_bacteria 2781125632 2781269394 355
114 3300000062 IMNBL1DRAFT_c0000032 IMNBL1DRAFT_000003291 356
115 3300002449 JGI24698J34947_10026764 JGI24698J34947_100267644 356
116 3300005485 Ga0074263_110359 Ga0074263_1103593 356
117 3300009826 Ga0123355_10270630 Ga0123355_102706301 356
118 3300010167 Ga0123353_10002784 Ga0123353_1000278416 356
119 3300042603 Ga0466714_076058 Ga0466714_076058_772_1842 356
120 3300042603 Ga0466714_121495 Ga0466714_121495_9519_10589 356
121 3300042614 Ga0466712_002731 Ga0466712_002731_308_1378 356
122 3300042617 Ga0466718_004635 Ga0466718_004635_11_1081 356
123 iso_pr_bacteria 2781125681 2781407891 356
124 iso_pr_bacteria 2820288918 2820290209 356
125 2225789004 2227494066 2227969154 357
126 3300000089 AustNasuHG_c1015706 AustNasuHG_10157063 357
127 3300002449 JGI24698J34947_10002262 JGI24698J34947_1000226214 357
128 3300002449 JGI24698J34947_10002764 JGI24698J34947_100027648 357
129 3300042592 Ga0466693_364957 Ga0466693_364957_454_1527 357
130 3300042656 Ga0466732_379577 Ga0466732_379577_4577_5650 357
131 3300000062 IMNBL1DRAFT_c0002469 IMNBL1DRAFT_00024693 358
132 3300002449 JGI24698J34947_10012741 JGI24698J34947_100127413 358
133 3300002450 JGI24695J34938_10000233 JGI24695J34938_1000023341 358
134 3300038395 Ga0415639_057604 Ga0415639_057604_166_1242 358
135 3300042614 Ga0466712_250860 Ga0466712_250860_3720_4796 358
136 3300042656 Ga0466732_370565 Ga0466732_370565_165_1241 358
137 iso_pr_bacteria 2781125637 2781282028 358
138 iso_pr_bacteria 2781125649 2781306697 358
139 iso_pr_bacteria 2820387566 2820388249 358
140 3300000089 AustNasuHG_c1001496 AustNasuHG_10014962 359
141 3300002450 JGI24695J34938_10002241 JGI24695J34938_100022417 359
142 3300042597 Ga0466699_087352 Ga0466699_087352_78_1157 359
143 3300042607 Ga0466720_113530 Ga0466720_113530_5457_6536 359
144 3300042609 Ga0466722_147052 Ga0466722_147052_66247_67326 359
145 3300042616 Ga0466715_213689 Ga0466715_213689_14750_15829 359
146 3300005200 Ga0072940_1000897 Ga0072940_100089721 360
147 3300042599 Ga0466706_104187 Ga0466706_104187_4343_5458 360
148 3300042607 Ga0466720_127186 Ga0466720_127186_2227_3309 360
149 3300042607 Ga0466720_202859 Ga0466720_202859_178_1260 360
150 3300042607 Ga0466720_218416 Ga0466720_218416_135_1217 360
151 3300042609 Ga0466722_167478 Ga0466722_167478_1432_2514 360
152 3300042614 Ga0466712_086077 Ga0466712_086077_507_1640 360
153 3300042621 Ga0466729_147210 Ga0466729_147210_3443_4525 360
154 iso_pr_bacteria 2820688768 2820689502 360
155 3300002450 JGI24695J34938_10008106 JGI24695J34938_100081069 361
156 iso_pr_bacteria 2781125690 2781427721 361
157 iso_pr_bacteria 2820702360 2820704580 361
158 iso_pr_bacteria 2820707375 2820708656 361
159 3300002450 JGI24695J34938_10006443 JGI24695J34938_100064432 362
160 3300005201 Ga0072941_1475654 Ga0072941_14756541 362
161 3300042607 Ga0466720_064250 Ga0466720_064250_1993_3081 362
162 3300042610 Ga0466698_381628 Ga0466698_381628_5991_7079 362
163 3300042656 Ga0466732_148094 Ga0466732_148094_587_1675 362
164 3300042656 Ga0466732_255003 Ga0466732_255003_1476_2564 362
165 2225789004 2227119714 2227512235 363
166 2225789004 2227471850 2227918683 363
167 3300000062 IMNBL1DRAFT_c0000334 IMNBL1DRAFT_000033432 363
168 3300000062 IMNBL1DRAFT_c0026273 IMNBL1DRAFT_00262732 363
169 3300042597 Ga0466699_071356 Ga0466699_071356_1174_2265 363
170 3300042599 Ga0466706_041625 Ga0466706_041625_12132_13223 363
171 3300042599 Ga0466706_131160 Ga0466706_131160_5572_6663 363
172 3300042599 Ga0466706_163386 Ga0466706_163386_2966_4057 363
173 3300042614 Ga0466712_012817 Ga0466712_012817_1949_3040 363
174 3300042635 Ga0466702_449019 Ga0466702_449019_143_1273 363
175 iso_pr_bacteria 2820234266 2820234929 363
176 3300000062 IMNBL1DRAFT_c0006731 IMNBL1DRAFT_00067313 364
177 3300010167 Ga0123353_10112447 Ga0123353_101124475 364
178 3300042592 Ga0466693_127953 Ga0466693_127953_773_1867 364
179 3300042659 Ga0466733_134180 Ga0466733_134180_118_1212 364
180 3300002449 JGI24698J34947_10018469 JGI24698J34947_100184692 365
181 3300042582 Ga0466657_098945 Ga0466657_098945_44989_46137 365
182 3300042592 Ga0466693_248755 Ga0466693_248755_428_1525 365
183 3300042607 Ga0466720_066729 Ga0466720_066729_2361_3458 365
184 3300042612 Ga0466705_158168 Ga0466705_158168_5043_6140 365
185 3300042616 Ga0466715_536042 Ga0466715_536042_7035_8132 365
186 3300042635 Ga0466702_075402 Ga0466702_075402_11_1108 365
187 3300042643 Ga0466704_608829 Ga0466704_608829_37088_38185 365
188 3300002501 JGI24703J35330_11748536 JGI24703J35330_1174853615 366
189 3300042612 Ga0466705_506414 Ga0466705_506414_3759_4859 366
190 3300010049 Ga0123356_10488058 Ga0123356_104880582 367
191 3300038395 Ga0415639_092149 Ga0415639_092149_239_1342 367
192 iso_pr_bacteria 2882250448 2882252317 367
193 3300000062 IMNBL1DRAFT_c0002172 IMNBL1DRAFT_00021722 368
194 3300042599 Ga0466706_253390 Ga0466706_253390_3110_4216 368
195 3300042621 Ga0466729_261638 Ga0466729_261638_153102_154208 368
196 iso_pr_bacteria 2820408893 2820410138 368
197 3300002449 JGI24698J34947_10001576 JGI24698J34947_100015766 369
198 3300002931 CVPL010W_10006998 CVPL010W_100069982 369
199 3300005485 Ga0074263_109624 Ga0074263_1096242 369
200 3300007085 Ga0104045_1075333 Ga0104045_10753332 369
201 3300010882 Ga0123354_10069272 Ga0123354_100692722 369
202 3300042597 Ga0466699_438660 Ga0466699_438660_219_1328 369
203 iso_pr_bacteria 2811995047 2812947408 369
204 iso_pr_bacteria 2820246658 2820247432 369
205 iso_pr_bacteria 2864878056 2864881697 369
206 iso_pr_bacteria 2864886855 2864890665 369
207 3300042614 Ga0466712_155308 Ga0466712_155308_578_1690 370
208 iso_pr_bacteria 2904728850 2904731193 370
209 iso_pr_bacteria 2958471994 2958474078 370
210 3300000062 IMNBL1DRAFT_c0001484 IMNBL1DRAFT_00014845 371
211 3300002449 JGI24698J34947_10007479 JGI24698J34947_100074792 372
212 3300007085 Ga0104045_1003632 Ga0104045_10036326 372
213 iso_pr_bacteria 2820551407 2820551630 372
214 3300002449 JGI24698J34947_10001444 JGI24698J34947_100014446 373
215 3300042614 Ga0466712_032721 Ga0466712_032721_1422_2546 374
216 3300042617 Ga0466718_043711 Ga0466718_043711_113_1237 374
217 iso_pr_bacteria 2781125635 2781277395 377
218 iso_pr_bacteria 2781125645 2781299063 377
219 3300002450 JGI24695J34938_10000486 JGI24695J34938_1000048612 378
220 3300007140 Ga0102740_1001050 Ga0102740_10010503 380
221 3300042605 Ga0466716_183734 Ga0466716_183734_278986_280128 380
222 3300042606 Ga0466719_043513 Ga0466719_043513_451_1593 380
223 iso_pr_bacteria 2820362221 2820363638 380
224 3300042606 Ga0466719_462795 Ga0466719_462795_1082_2227 381
225 3300042616 Ga0466715_626207 Ga0466715_626207_4409_5554 381
226 3300042643 Ga0466704_471434 Ga0466704_471434_4350_5495 381
227 3300042607 Ga0466720_121956 Ga0466720_121956_5225_6376 383
228 3300000062 IMNBL1DRAFT_c0000373 IMNBL1DRAFT_000037333 384
229 3300007129 Ga0102734_1002625 Ga0102734_10026257 384
230 3300042596 Ga0466696_079855 Ga0466696_079855_4181_5350 389
231 3300002504 JGI24705J35276_12232821 JGI24705J35276_122328215 424

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00988 CPSase_sm_chain Carbamoyl-phosphate synthase small chain, CPSase domain 5 129 0.99
PF00117 GATase Glutamine amidotransferase class-I 174 349 0.95

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.81 0.88 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.