Protein Family IF00882
Metagenome
Isolate
136
Members
58
Samples
121
Scaffolds
106.82
Avg Length
Representative Sequence
- ID
- 3300002504|JGI24705J35276_12227218|JGI24705J35276_122272182
- Length
- 122 aa
- Sequence
- VNYKYKCYLCRIKQYDMEVTFEKEYLRDLYKTGKTTDKKYRFQPEIVRKYQHCIDTLLGAKNIEVLYTINSLNYEVLKGDKAGITSIRVNKQYRVEFTVKDNGIEPLITVCNILELSNHYK*
Sample Types
Isolate
11.0%
Metagenome
89.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
36.2%
Kalotermitidae
22.4%
Blattidae
20.7%
Unclassified
8.6%
Termopsidae
5.2%
Passalidae
3.4%
Rhinotermitidae
1.7%
Hodotermitidae
1.7%
Taxonomy
Archaea
0
Bacteria
126
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 2 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 3 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 4 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 5 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 6 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 7 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 8 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 9 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 10 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 11 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 12 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 13 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 14 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 15 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 16 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 17 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 18 | 2820772500 | Unclassified Bacteroidetes Lab288P1bin72 | Isolate | Unclassified |
| 19 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 20 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 21 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 22 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 23 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 24 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 25 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 26 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 27 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 28 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 29 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 30 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 31 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 32 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 33 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 34 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 35 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 36 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 37 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 38 | 2820767225 | Unclassified Bacteroidetes Lab288P3bin34 | Isolate | Unclassified |
| 39 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 40 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 41 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 42 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 43 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 44 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 45 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 46 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 47 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 48 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 49 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 50 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 51 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 52 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 53 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 54 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 55 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 56 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 57 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 58 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_025699 | 3300042612 | Bacteria | 3326 |
| 2 | Ga0466733_145267 | 3300042659 | Bacteria | 6262 |
| 3 | Ga0466700_126678 | 3300042600 | Bacteria | 10654 |
| 4 | Ga0466700_139603 | 3300042600 | Bacteria | 1428 |
| 5 | Ga0466719_109098 | 3300042606 | Bacteria | 1081 |
| 6 | Ga0466697_054973 | 3300042611 | Bacteria | 1131 |
| 7 | Ga0466705_519058 | 3300042612 | Bacteria | 2891 |
| 8 | Ga0466711_438584 | 3300042615 | Bacteria | 48599 |
| 9 | Ga0466731_432202 | 3300042622 | Bacteria | 2420 |
| 10 | Ga0466735_147710 | 3300042624 | Bacteria | 5582 |
| 11 | Ga0466730_011878 | 3300042625 | Bacteria | 2609 |
| 12 | Ga0466708_271470 | 3300042652 | Bacteria | 1771 |
| 13 | Ga0466708_407224 | 3300042652 | Bacteria | 1321 |
| 14 | Ga0466725_371448 | 3300042654 | Bacteria | 1669 |
| 15 | Ga0123353_11039264 | 3300010167 | Bacteria | 1096 |
| 16 | Ga0123354_10272838 | 3300010882 | Bacteria | 1661 |
| 17 | JGI24702J35022_10126659 | 3300002462 | Unclassified | 1415 |
| 18 | JGI24696J40584_12945880 | 3300002834 | Bacteria | 1871 |
| 19 | Ga0466706_220907 | 3300042599 | Bacteria | 1066 |
| 20 | Ga0466719_152797 | 3300042606 | Bacteria | 2318 |
| 21 | Ga0466656_336954 | 3300042550 | Bacteria | 17924 |
| 22 | Ga0466690_148599 | 3300042590 | Unclassified | 1108 |
| 23 | Ga0466696_161924 | 3300042596 | Bacteria | 47189 |
| 24 | Ga0466704_178379 | 3300042643 | Bacteria | 1086 |
| 25 | Ga0466708_185733 | 3300042652 | Bacteria | 6975 |
| 26 | Ga0466708_382122 | 3300042652 | Bacteria | 1093 |
| 27 | Ga0466727_060946 | 3300042655 | Bacteria | 1329 |
| 28 | Ga0123356_12592330 | 3300010049 | Bacteria | 635 |
| 29 | Ga0123353_10073484 | 3300010167 | Bacteria | 5496 |
| 30 | Ga0123353_11163325 | 3300010167 | Bacteria | 1017 |
| 31 | Ga0123354_10336478 | 3300010882 | Bacteria | 1367 |
| 32 | Ga0123354_10915904 | 3300010882 | Bacteria | 573 |
| 33 | JGI24702J35022_10006231 | 3300002462 | Bacteria | 6910 |
| 34 | JGI24702J35022_10152963 | 3300002462 | Bacteria | 1295 |
| 35 | Ga0466706_281248 | 3300042599 | Bacteria | 7977 |
| 36 | Ga0466721_079953 | 3300042608 | Bacteria | 1859 |
| 37 | Ga0466711_108183 | 3300042615 | Bacteria | 17429 |
| 38 | Ga0466715_287434 | 3300042616 | Bacteria | 1951 |
| 39 | Ga0466715_405188 | 3300042616 | Bacteria | 3735 |
| 40 | Ga0466691_221889 | 3300042593 | Bacteria | 2912 |
| 41 | Ga0466734_033670 | 3300042623 | Bacteria | 1127 |
| 42 | Ga0466708_457792 | 3300042652 | Bacteria | 1616 |
| 43 | Ga0123357_10099302 | 3300009784 | Bacteria | 3759 |
| 44 | Ga0123354_10577585 | 3300010882 | Unclassified | 834 |
| 45 | JGI24702J35022_10273728 | 3300002462 | Bacteria | 989 |
| 46 | Ga0068305_10477861 | 3300005083 | Bacteria | 1298 |
| 47 | Ga0466705_262977 | 3300042612 | Bacteria | 2504 |
| 48 | Ga0466698_038315 | 3300042610 | Bacteria | 1473 |
| 49 | Ga0466710_038682 | 3300042613 | Bacteria | 1231 |
| 50 | Ga0466710_049227 | 3300042613 | Bacteria | 1660 |
| 51 | Ga0466711_338568 | 3300042615 | Bacteria | 23627 |
| 52 | Ga0466728_004541 | 3300042620 | Bacteria | 1532 |
| 53 | Ga0466704_498064 | 3300042643 | Bacteria | 11466 |
| 54 | Ga0123356_13493001 | 3300010049 | Bacteria | 545 |
| 55 | Ga0123353_10724055 | 3300010167 | Bacteria | 1391 |
| 56 | 2227242754 | 2225789004 | Bacteria | 1337 |
| 57 | 2227488535 | 2225789004 | Bacteria | 20704 |
| 58 | IMNBL1DRAFT_c0083147 | 3300000062 | Bacteria | 893 |
| 59 | JGI24702J35022_10143524 | 3300002462 | Bacteria | 1334 |
| 60 | JGI24705J35276_12217373 | 3300002504 | Bacteria | 2090 |
| 61 | Ga0466717_071878 | 3300042604 | Bacteria | 1644 |
| 62 | Ga0466719_127776 | 3300042606 | Bacteria | 3328 |
| 63 | Ga0466715_553479 | 3300042616 | Bacteria | 7519 |
| 64 | Ga0466656_163942 | 3300042550 | Unclassified | 1017 |
| 65 | Ga0466704_342648 | 3300042643 | Bacteria | 1395 |
| 66 | Ga0466709_097023 | 3300042648 | Bacteria | 2308 |
| 67 | Ga0466727_036741 | 3300042655 | Bacteria | 9781 |
| 68 | 2227476303 | 2225789004 | Bacteria | 4628 |
| 69 | JGI24702J35022_10033670 | 3300002462 | Bacteria | 2740 |
| 70 | JGI24696J40584_12846242 | 3300002834 | Bacteria | 968 |
| 71 | Ga0068302_10145941 | 3300005071 | Bacteria | 1241 |
| 72 | Ga0072940_1116821 | 3300005200 | Bacteria | 3276 |
| 73 | Ga0466733_161991 | 3300042659 | Bacteria | 2081 |
| 74 | Ga0466707_075184 | 3300042601 | Bacteria | 5561 |
| 75 | Ga0466721_074757 | 3300042608 | Bacteria | 1278 |
| 76 | Ga0466722_263251 | 3300042609 | Bacteria | 1267 |
| 77 | Ga0466715_143280 | 3300042616 | Bacteria | 5787 |
| 78 | Ga0466715_627196 | 3300042616 | Unclassified | 5764 |
| 79 | Ga0466690_306407 | 3300042590 | Bacteria | 2005 |
| 80 | Ga0466691_185507 | 3300042593 | Bacteria | 1342 |
| 81 | Ga0466696_104249 | 3300042596 | Bacteria | 1613 |
| 82 | Ga0466735_018661 | 3300042624 | Bacteria | 3036 |
| 83 | Ga0466704_361257 | 3300042643 | Bacteria | 3045 |
| 84 | Ga0123356_10078161 | 3300010049 | Bacteria | 3122 |
| 85 | Ga0123354_10434569 | 3300010882 | Unclassified | 1078 |
| 86 | IMNBL1DRAFT_c0000830 | 3300000062 | Bacteria | 24333 |
| 87 | JGI24702J35022_10009350 | 3300002462 | Bacteria | 5503 |
| 88 | JGI24702J35022_10227077 | 3300002462 | Bacteria | 1078 |
| 89 | JGI24702J35022_10364001 | 3300002462 | Bacteria | 867 |
| 90 | JGI24705J35276_12227218 | 3300002504 | Unclassified | 2966 |
| 91 | Ga0466706_037437 | 3300042599 | Bacteria | 17939 |
| 92 | Ga0466728_152707 | 3300042620 | Bacteria | 23106 |
| 93 | Ga0466696_184260 | 3300042596 | Bacteria | 3029 |
| 94 | Ga0466703_343158 | 3300042636 | Bacteria | 23443 |
| 95 | Ga0466704_136608 | 3300042643 | Bacteria | 15825 |
| 96 | Ga0466727_190523 | 3300042655 | Bacteria | 1567 |
| 97 | Ga0123356_11107747 | 3300010049 | Unclassified | 960 |
| 98 | Ga0123353_11754750 | 3300010167 | Bacteria | 774 |
| 99 | Ga0123354_10284657 | 3300010882 | Bacteria | 1597 |
| 100 | IMNBL1DRAFT_c0123664 | 3300000062 | Bacteria | 678 |
| 101 | JGI24702J35022_10015315 | 3300002462 | Unclassified | 4223 |
| 102 | Ga0123357_10000445 | 3300009784 | Bacteria | 39844 |
| 103 | Ga0466705_134552 | 3300042612 | Bacteria | 1419 |
| 104 | Ga0466701_068696 | 3300042598 | Bacteria | 1364 |
| 105 | Ga0466722_098074 | 3300042609 | Bacteria | 7514 |
| 106 | Ga0466722_245690 | 3300042609 | Bacteria | 2573 |
| 107 | Ga0466711_455232 | 3300042615 | Bacteria | 1046 |
| 108 | Ga0466723_153938 | 3300042618 | Bacteria | 19175 |
| 109 | Ga0466690_235692 | 3300042590 | Bacteria | 1052 |
| 110 | Ga0466690_314683 | 3300042590 | Bacteria | 8921 |
| 111 | Ga0466735_087584 | 3300042624 | Bacteria | 3393 |
| 112 | Ga0466703_045696 | 3300042636 | Bacteria | 1611 |
| 113 | Ga0123357_10999991 | 3300009784 | Bacteria | 520 |
| 114 | Ga0123356_10176953 | 3300010049 | Bacteria | 2151 |
| 115 | Ga0123356_13395068 | 3300010049 | Bacteria | 553 |
| 116 | Ga0123353_10562165 | 3300010167 | Bacteria | 1642 |
| 117 | Ga0123353_10843768 | 3300010167 | Unclassified | 1257 |
| 118 | Ga0123353_13124138 | 3300010167 | Bacteria | 533 |
| 119 | JGI24702J35022_10326126 | 3300002462 | Bacteria | 912 |
| 120 | JGI24696J40584_12932130 | 3300002834 | Bacteria | 1497 |
| 121 | JGI24696J40584_12944219 | 3300002834 | Bacteria | 1804 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 2225789004 | 2227242754 | 2227682679 | 105 |
| 2 | 2225789004 | 2227476303 | 2227928758 | 105 |
| 3 | 2225789004 | 2227488535 | 2227957791 | 105 |
| 4 | 3300002504 | JGI24705J35276_12217373 | JGI24705J35276_122173733 | 105 |
| 5 | 3300042550 | Ga0466656_163942 | Ga0466656_163942_111_428 | 105 |
| 6 | 3300042550 | Ga0466656_336954 | Ga0466656_336954_2691_3008 | 105 |
| 7 | 3300042590 | Ga0466690_148599 | Ga0466690_148599_606_923 | 105 |
| 8 | 3300042590 | Ga0466690_235692 | Ga0466690_235692_355_672 | 105 |
| 9 | 3300042590 | Ga0466690_306407 | Ga0466690_306407_602_919 | 105 |
| 10 | 3300042590 | Ga0466690_314683 | Ga0466690_314683_3975_4292 | 105 |
| 11 | 3300042593 | Ga0466691_221889 | Ga0466691_221889_1695_2012 | 105 |
| 12 | 3300042596 | Ga0466696_104249 | Ga0466696_104249_985_1302 | 105 |
| 13 | 3300042596 | Ga0466696_161924 | Ga0466696_161924_5828_6145 | 105 |
| 14 | 3300042596 | Ga0466696_184260 | Ga0466696_184260_885_1202 | 105 |
| 15 | 3300042598 | Ga0466701_068696 | Ga0466701_068696_86_403 | 105 |
| 16 | 3300042599 | Ga0466706_281248 | Ga0466706_281248_1154_1471 | 105 |
| 17 | 3300042600 | Ga0466700_126678 | Ga0466700_126678_10006_10323 | 105 |
| 18 | 3300042600 | Ga0466700_139603 | Ga0466700_139603_30_347 | 105 |
| 19 | 3300042601 | Ga0466707_075184 | Ga0466707_075184_3161_3478 | 105 |
| 20 | 3300042604 | Ga0466717_071878 | Ga0466717_071878_16_333 | 105 |
| 21 | 3300042606 | Ga0466719_127776 | Ga0466719_127776_1029_1346 | 105 |
| 22 | 3300042606 | Ga0466719_152797 | Ga0466719_152797_256_573 | 105 |
| 23 | 3300042608 | Ga0466721_074757 | Ga0466721_074757_368_685 | 105 |
| 24 | 3300042608 | Ga0466721_079953 | Ga0466721_079953_1122_1439 | 105 |
| 25 | 3300042609 | Ga0466722_098074 | Ga0466722_098074_1810_2127 | 105 |
| 26 | 3300042609 | Ga0466722_245690 | Ga0466722_245690_1920_2237 | 105 |
| 27 | 3300042609 | Ga0466722_263251 | Ga0466722_263251_222_539 | 105 |
| 28 | 3300042610 | Ga0466698_038315 | Ga0466698_038315_997_1314 | 105 |
| 29 | 3300042611 | Ga0466697_054973 | Ga0466697_054973_443_760 | 105 |
| 30 | 3300042612 | Ga0466705_025699 | Ga0466705_025699_2918_3235 | 105 |
| 31 | 3300042612 | Ga0466705_262977 | Ga0466705_262977_1889_2206 | 105 |
| 32 | 3300042612 | Ga0466705_519058 | Ga0466705_519058_551_868 | 105 |
| 33 | 3300042613 | Ga0466710_038682 | Ga0466710_038682_637_954 | 105 |
| 34 | 3300042613 | Ga0466710_049227 | Ga0466710_049227_808_1125 | 105 |
| 35 | 3300042615 | Ga0466711_108183 | Ga0466711_108183_15398_15715 | 105 |
| 36 | 3300042615 | Ga0466711_338568 | Ga0466711_338568_10546_10863 | 105 |
| 37 | 3300042615 | Ga0466711_438584 | Ga0466711_438584_1254_1571 | 105 |
| 38 | 3300042615 | Ga0466711_455232 | Ga0466711_455232_62_379 | 105 |
| 39 | 3300042616 | Ga0466715_143280 | Ga0466715_143280_647_964 | 105 |
| 40 | 3300042616 | Ga0466715_287434 | Ga0466715_287434_616_933 | 105 |
| 41 | 3300042616 | Ga0466715_553479 | Ga0466715_553479_6939_7256 | 105 |
| 42 | 3300042616 | Ga0466715_627196 | Ga0466715_627196_2179_2496 | 105 |
| 43 | 3300042618 | Ga0466723_153938 | Ga0466723_153938_8566_8883 | 105 |
| 44 | 3300042620 | Ga0466728_004541 | Ga0466728_004541_508_825 | 105 |
| 45 | 3300042620 | Ga0466728_152707 | Ga0466728_152707_21068_21385 | 105 |
| 46 | 3300042622 | Ga0466731_432202 | Ga0466731_432202_1449_1766 | 105 |
| 47 | 3300042624 | Ga0466735_087584 | Ga0466735_087584_574_891 | 105 |
| 48 | 3300042624 | Ga0466735_147710 | Ga0466735_147710_4120_4437 | 105 |
| 49 | 3300042625 | Ga0466730_011878 | Ga0466730_011878_69_386 | 105 |
| 50 | 3300042636 | Ga0466703_045696 | Ga0466703_045696_859_1176 | 105 |
| 51 | 3300042636 | Ga0466703_343158 | Ga0466703_343158_17680_17997 | 105 |
| 52 | 3300042643 | Ga0466704_136608 | Ga0466704_136608_5667_5984 | 105 |
| 53 | 3300042643 | Ga0466704_178379 | Ga0466704_178379_526_843 | 105 |
| 54 | 3300042643 | Ga0466704_342648 | Ga0466704_342648_968_1285 | 105 |
| 55 | 3300042643 | Ga0466704_361257 | Ga0466704_361257_2070_2387 | 105 |
| 56 | 3300042643 | Ga0466704_498064 | Ga0466704_498064_3711_4028 | 105 |
| 57 | 3300042648 | Ga0466709_097023 | Ga0466709_097023_1808_2125 | 105 |
| 58 | 3300042652 | Ga0466708_185733 | Ga0466708_185733_2239_2556 | 105 |
| 59 | 3300042652 | Ga0466708_382122 | Ga0466708_382122_541_858 | 105 |
| 60 | 3300042652 | Ga0466708_407224 | Ga0466708_407224_699_1016 | 105 |
| 61 | 3300042652 | Ga0466708_457792 | Ga0466708_457792_830_1147 | 105 |
| 62 | 3300042654 | Ga0466725_371448 | Ga0466725_371448_1167_1484 | 105 |
| 63 | 3300042655 | Ga0466727_036741 | Ga0466727_036741_6295_6612 | 105 |
| 64 | 3300042655 | Ga0466727_060946 | Ga0466727_060946_396_713 | 105 |
| 65 | 3300042655 | Ga0466727_190523 | Ga0466727_190523_667_984 | 105 |
| 66 | 3300042659 | Ga0466733_145267 | Ga0466733_145267_5284_5601 | 105 |
| 67 | 3300042659 | Ga0466733_161991 | Ga0466733_161991_1525_1842 | 105 |
| 68 | iso_pr_bacteria | 2820767225 | 2820768017 | 105 |
| 69 | iso_pr_bacteria | 2820772500 | 2820772876 | 105 |
| 70 | iso_pr_bacteria | 2820778767 | 2820779358 | 105 |
| 71 | iso_pr_bacteria | 2940205530 | 2940208956 | 105 |
| 72 | iso_pr_bacteria | 2940212447 | 2940215871 | 105 |
| 73 | iso_pr_bacteria | 2940298504 | 2940301969 | 105 |
| 74 | iso_pr_bacteria | 2940302308 | 2940305772 | 105 |
| 75 | iso_pr_bacteria | 2940306115 | 2940309664 | 105 |
| 76 | iso_pr_bacteria | 2940309933 | 2940313500 | 105 |
| 77 | iso_pr_bacteria | 2940313741 | 2940317270 | 105 |
| 78 | iso_pr_bacteria | 2940317558 | 2940321083 | 105 |
| 79 | iso_pr_bacteria | 2940321370 | 2940324884 | 105 |
| 80 | iso_pr_bacteria | 2940325180 | 2940328642 | 105 |
| 81 | iso_pr_bacteria | 2940328985 | 2940332449 | 105 |
| 82 | iso_pr_bacteria | 2940332795 | 2940336321 | 105 |
| 83 | 3300000062 | IMNBL1DRAFT_c0000830 | IMNBL1DRAFT_000083010 | 106 |
| 84 | 3300000062 | IMNBL1DRAFT_c0083147 | IMNBL1DRAFT_00831472 | 106 |
| 85 | 3300000062 | IMNBL1DRAFT_c0123664 | IMNBL1DRAFT_01236641 | 106 |
| 86 | 3300002462 | JGI24702J35022_10006231 | JGI24702J35022_100062312 | 106 |
| 87 | 3300002462 | JGI24702J35022_10009350 | JGI24702J35022_100093504 | 106 |
| 88 | 3300002462 | JGI24702J35022_10033670 | JGI24702J35022_100336703 | 106 |
| 89 | 3300002462 | JGI24702J35022_10126659 | JGI24702J35022_101266592 | 106 |
| 90 | 3300002462 | JGI24702J35022_10143524 | JGI24702J35022_101435243 | 106 |
| 91 | 3300002462 | JGI24702J35022_10152963 | JGI24702J35022_101529631 | 106 |
| 92 | 3300002462 | JGI24702J35022_10227077 | JGI24702J35022_102270771 | 106 |
| 93 | 3300002462 | JGI24702J35022_10326126 | JGI24702J35022_103261261 | 106 |
| 94 | 3300002462 | JGI24702J35022_10364001 | JGI24702J35022_103640011 | 106 |
| 95 | 3300002834 | JGI24696J40584_12846242 | JGI24696J40584_128462422 | 106 |
| 96 | 3300002834 | JGI24696J40584_12932130 | JGI24696J40584_129321304 | 106 |
| 97 | 3300002834 | JGI24696J40584_12944219 | JGI24696J40584_129442193 | 106 |
| 98 | 3300002834 | JGI24696J40584_12945880 | JGI24696J40584_129458803 | 106 |
| 99 | 3300005071 | Ga0068302_10145941 | Ga0068302_101459413 | 106 |
| 100 | 3300005083 | Ga0068305_10477861 | Ga0068305_104778612 | 106 |
| 101 | 3300005200 | Ga0072940_1116821 | Ga0072940_11168213 | 106 |
| 102 | 3300009784 | Ga0123357_10000445 | Ga0123357_1000044532 | 106 |
| 103 | 3300009784 | Ga0123357_10999991 | Ga0123357_109999912 | 106 |
| 104 | 3300010049 | Ga0123356_10078161 | Ga0123356_100781616 | 106 |
| 105 | 3300010049 | Ga0123356_10176953 | Ga0123356_101769533 | 106 |
| 106 | 3300010049 | Ga0123356_11107747 | Ga0123356_111077471 | 106 |
| 107 | 3300010049 | Ga0123356_12592330 | Ga0123356_125923301 | 106 |
| 108 | 3300010049 | Ga0123356_13395068 | Ga0123356_133950681 | 106 |
| 109 | 3300010049 | Ga0123356_13493001 | Ga0123356_134930011 | 106 |
| 110 | 3300010167 | Ga0123353_10073484 | Ga0123353_100734845 | 106 |
| 111 | 3300010167 | Ga0123353_10562165 | Ga0123353_105621653 | 106 |
| 112 | 3300010167 | Ga0123353_10724055 | Ga0123353_107240553 | 106 |
| 113 | 3300010167 | Ga0123353_10843768 | Ga0123353_108437683 | 106 |
| 114 | 3300010167 | Ga0123353_11039264 | Ga0123353_110392642 | 106 |
| 115 | 3300010167 | Ga0123353_11163325 | Ga0123353_111633252 | 106 |
| 116 | 3300010167 | Ga0123353_11754750 | Ga0123353_117547502 | 106 |
| 117 | 3300010167 | Ga0123353_13124138 | Ga0123353_131241381 | 106 |
| 118 | 3300010882 | Ga0123354_10272838 | Ga0123354_102728382 | 106 |
| 119 | 3300010882 | Ga0123354_10284657 | Ga0123354_102846573 | 106 |
| 120 | 3300010882 | Ga0123354_10336478 | Ga0123354_103364782 | 106 |
| 121 | 3300010882 | Ga0123354_10577585 | Ga0123354_105775851 | 106 |
| 122 | 3300010882 | Ga0123354_10915904 | Ga0123354_109159041 | 106 |
| 123 | 3300042593 | Ga0466691_185507 | Ga0466691_185507_363_683 | 106 |
| 124 | 3300042599 | Ga0466706_037437 | Ga0466706_037437_14637_14957 | 106 |
| 125 | 3300042599 | Ga0466706_220907 | Ga0466706_220907_233_553 | 106 |
| 126 | 3300042624 | Ga0466735_018661 | Ga0466735_018661_307_627 | 106 |
| 127 | 3300042612 | Ga0466705_134552 | Ga0466705_134552_466_789 | 107 |
| 128 | 3300042616 | Ga0466715_405188 | Ga0466715_405188_732_1058 | 108 |
| 129 | 3300002462 | JGI24702J35022_10015315 | JGI24702J35022_100153154 | 122 |
| 130 | 3300002504 | JGI24705J35276_12227218 | JGI24705J35276_122272182 | 122 |
| 131 | 3300009784 | Ga0123357_10099302 | Ga0123357_100993023 | 122 |
| 132 | 3300002462 | JGI24702J35022_10273728 | JGI24702J35022_102737282 | 123 |
| 133 | 3300010882 | Ga0123354_10434569 | Ga0123354_104345692 | 123 |
| 134 | 3300042623 | Ga0466734_033670 | Ga0466734_033670_305_697 | 130 |
| 135 | 3300042652 | Ga0466708_271470 | Ga0466708_271470_346_777 | 143 |
| 136 | 3300042606 | Ga0466719_109098 | Ga0466719_109098_164_628 | 154 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF05015 | HigB-like_toxin | RelE-like toxin of type II toxin-antitoxin system HigB | 20 | 104 | 0.89 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.73 | 0.79 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.