Protein Family IF00869

Metagenome Isolate
188 Members
94 Samples
139 Scaffolds
437.32 Avg Length

🧬 Representative Sequence

ID
3300002501|JGI24703J35330_11748815|JGI24703J35330_1174881532
Length
491 aa
Sequence
MDLRGFRKELDIFDSCRNMGKIEKIIGMTIEASGPSCNIGDVCRIFSKDMKEFVYAEVVGFNSSKVLLMPYTDIEGIGPGSIVDNTGEKLMVKTTPDLVGRIIDAIGRPLDGKGEIEYTGSLPITGISVNPLTRPKISEPLEMGVKAIDGLLTLGKGQRIGIFAGSGVGKSTLMGMVARKVKADLNVIALVGERGREVREFIENDLGDEGMARSVVVVATGDQPAMLRNKCPLTATAIAEYFMQQGKDVLLMMDNLTRFAMAQREVGLSIGEPPIARGYTPSIYSALPKLLERAGSFETGSITGIYAVLVEGDDTNEPISDTVRGIIDGHIILSRKIAARNHYPAIDILGSISRLMTIICPEDHNEAANRLRDLLALYDDNYDLITIGAYKKGTNPKLDEAIDKIDEINAFLKQKVNESFDLDETVAMLKQVVVADKAGNRRPVGAMSGTLGASGGAGISNQPTPEQLLQQAQGSPYSPSSGGAGQTAVV*

📊 Sample Types

Isolate 26.1%
Metagenome 73.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 33.3%
Termitidae 21.1%
Kalotermitidae 11.1%
Blattidae 10.0%
Elmidae 4.4%
Rhinotermitidae 3.3%
Culicidae 3.3%
Armadillidiidae 2.2%
Coreidae 1.1%
Porcellionidae 1.1%
Nephropidae 1.1%
Hydrophilidae 1.1%
Hodotermitidae 1.1%
Passalidae 1.1%
Noctuidae 1.1%
Termopsidae 1.1%
Tenebrionidae 1.1%
Curculionidae 1.1%

🌳 Taxonomy

Archaea 0
Bacteria 172
Eukaryota 0
Viruses 0
Unclassified 16

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940400224 Paenibacillus sp. PastM-2 Isolate Blattidae
2 2820238527 Unclassified Firmicutes Th196P3bin90 Isolate Unclassified
3 2820453354 Unclassified Firmicutes Lab288P3bin172 Isolate Unclassified
4 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
5 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
6 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
7 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
8 8018794549 Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 Isolate
9 8078130113 Caballeronia sp. INDeC2 Isolate Coreidae
10 8073539042 Candidatus Rhabdochlamydia porcellionis 15C Isolate Porcellionidae
11 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
12 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
13 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
14 2864937364 Acidovorax soli S00198 Isolate Elmidae
15 2940406939 Paenibacillus sp. PastM-3 Isolate Blattidae
16 2820080004 Unclassified Proteobacteria Lab288P4bin34 Isolate Unclassified
17 2820280018 Unclassified Firmicutes Th196P3bin149 Isolate Unclassified
18 2820155744 Unclassified Proteobacteria Cu122P5bin24 Isolate Unclassified
19 2820727601 Unclassified Cloacimonetes Nt197P3bin46 Isolate Unclassified
20 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
21 8043041867 Bacillus pumilus Ha06YP001 Isolate Nephropidae
22 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
23 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
24 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
25 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
26 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
27 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
28 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
29 2873571580 Diaphorobacter sp. HDW4B Isolate Hydrophilidae
30 2940419646 Paenibacillus sp. PastF-4 Isolate Blattidae
31 2820056190 Unclassified Proteobacteria Nt197P4bin9 Isolate Unclassified
32 2820227065 Unclassified Firmicutes Th196P4bin44 Isolate Unclassified
33 2820254385 Unclassified Firmicutes Th196P3bin54 Isolate Unclassified
34 2820306284 Unclassified Firmicutes Th196P1bin11 Isolate Unclassified
35 2820339298 Unclassified Firmicutes Nt197P3bin68 Isolate Unclassified
36 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
37 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
38 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
39 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
40 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
41 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
42 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
43 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
44 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
45 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
46 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
47 2864801025 Bacillus aerius S00042 Isolate Elmidae
48 2940393498 Paenibacillus sp. PastF-2 Isolate Blattidae
49 2820244222 Unclassified Firmicutes Th196P3bin75 Isolate Unclassified
50 2820347164 Unclassified Firmicutes Nt197P3bin58 Isolate Unclassified
51 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
52 2864816158 Priestia aryabhattai S00060 Isolate Elmidae
53 2940380068 Paenibacillus sp. PastH-2 Isolate Blattidae
54 2940413413 Paenibacillus sp. PastH-3 Isolate Blattidae
55 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
56 2775507073 Enterococcus sp. CR-Ec1 Isolate Unclassified
57 2820272499 Unclassified Firmicutes Th196P3bin18 Isolate Unclassified
58 2820463629 Unclassified Firmicutes Lab288P3bin124 Isolate Unclassified
59 2820483401 Unclassified Firmicutes Lab288P1bin74 Isolate Unclassified
60 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
61 2864895409 Bacillus aerius S00152 Isolate Elmidae
62 2940221333 Paenibacillus sp. PastF-3 Isolate Blattidae
63 2940425923 Paenibacillus sp. PastH-4 Isolate Blattidae
64 2820259584 Unclassified Firmicutes Th196P3bin43 Isolate Unclassified
65 2820265624 Unclassified Firmicutes Th196P3bin36 Isolate Unclassified
66 2820288918 Unclassified Firmicutes Th196P3bin137 Isolate Unclassified
67 2820294436 Unclassified Firmicutes Th196P3bin104 Isolate Unclassified
68 2820387566 Unclassified Firmicutes Nt197P1bin1 Isolate Unclassified
69 2820398208 Unclassified Firmicutes Nc150P1bin1 Isolate Unclassified
70 2983866074 Paenibacillus polymyxa A18 Isolate Unclassified
71 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
72 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
73 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
74 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
75 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
76 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
77 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
78 2551306396 Paenibacillus sp. ICGEB2008 Isolate Noctuidae
79 2576861701 Paenibacillus sp. JCM 10914 Isolate Termitidae
80 2820101058 Unclassified Proteobacteria Emb289P4bin76 Isolate Unclassified
81 2820255904 Unclassified Firmicutes Th196P3bin48 Isolate Unclassified
82 2820319488 Unclassified Firmicutes Nt197P3bin88 Isolate Unclassified
83 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
84 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
85 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
86 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
87 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
88 2940386776 Paenibacillus sp. PastF-1 Isolate Blattidae
89 2524614537 Lysinibacillus sphaericus OT4b.31 Isolate Unclassified
90 2820570671 Unclassified Firmicutes Emb289P3bin19 Isolate Unclassified
91 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
92 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
93 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
94 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0562379_0352 3300056790 Bacteria 109127
2 Ga0466706_089626 3300042599 Bacteria 23631
3 Ga0466706_107608 3300042599 Bacteria 10439
4 Ga0466706_147182 3300042599 Bacteria 6606
5 Ga0466706_231484 3300042599 Unclassified 7721
6 Ga0466706_250289 3300042599 Bacteria 7424
7 Ga0466706_289260 3300042599 Bacteria 2224
8 Ga0466716_123682 3300042605 Bacteria 132543
9 Ga0466715_054449 3300042616 Bacteria 20065
10 Ga0466723_015357 3300042618 Bacteria 4442
11 Ga0466723_043513 3300042618 Bacteria 11582
12 Ga0466692_091327 3300042591 Bacteria 32670
13 Ga0123353_10070859 3300010167 Bacteria 5601
14 Ga0466703_286621 3300042636 Bacteria 31377
15 2227513536 2225789004 Bacteria 17986
16 JGI24703J35330_11748815 3300002501 Bacteria 40125
17 JGI24705J35276_12237689 3300002504 Bacteria 12558
18 Ga0466706_202901 3300042599 Bacteria 8120
19 Ga0466706_237730 3300042599 Bacteria 20408
20 Ga0466714_072370 3300042603 Bacteria 11147
21 Ga0466715_052477 3300042616 Bacteria 7960
22 Ga0466723_267344 3300042618 Bacteria 7165
23 Ga0466728_113606 3300042620 Bacteria 2440
24 Ga0415639_003286 3300038395 Bacteria 56769
25 Ga0415639_003489 3300038395 Bacteria 30262
26 Ga0415639_009362 3300038395 Bacteria 20604
27 Ga0415639_010516 3300038395 Bacteria 10052
28 Ga0415639_111051 3300038395 Unclassified 5169
29 Ga0123356_10000021 3300010049 Bacteria 176996
30 Ga0123356_10144531 3300010049 Bacteria 2351
31 Ga0466702_205562 3300042635 Bacteria 1759
32 Ga0466702_378261 3300042635 Bacteria 4346
33 JGI24702J35022_10003781 3300002462 Bacteria 9097
34 Ga0466705_197160 3300042612 Bacteria 3277
35 Ga0466706_063946 3300042599 Bacteria 37826
36 Ga0466706_077647 3300042599 Bacteria 12505
37 Ga0466706_147628 3300042599 Unclassified 4324
38 Ga0466706_164052 3300042599 Bacteria 208763
39 Ga0466721_138292 3300042608 Bacteria 2900
40 Ga0466722_192099 3300042609 Bacteria 92456
41 Ga0466715_356515 3300042616 Bacteria 18946
42 Ga0160472_106018 3300012839 Bacteria 1862
43 Ga0466693_218860 3300042592 Bacteria 2463
44 Ga0160454_100018 3300012798 Bacteria 326271
45 Ga0063521_1000974 3300003973 Bacteria 9243
46 Ga0072940_1126053 3300005200 Unclassified 6537
47 Ga0466733_107473 3300042659 Bacteria 6053
48 Ga0466733_187866 3300042659 Bacteria 2330
49 Ga0466706_012433 3300042599 Bacteria 76595
50 Ga0466706_018452 3300042599 Bacteria 54272
51 Ga0466706_091489 3300042599 Bacteria 50051
52 Ga0466706_122442 3300042599 Bacteria 110911
53 Ga0466706_140640 3300042599 Bacteria 14900
54 Ga0466706_158486 3300042599 Bacteria 10110
55 Ga0466706_165413 3300042599 Unclassified 7935
56 Ga0466706_182332 3300042599 Bacteria 21381
57 Ga0466706_235766 3300042599 Bacteria 3076
58 Ga0466714_073203 3300042603 Bacteria 47226
59 Ga0466719_007898 3300042606 Bacteria 2474
60 Ga0466715_366951 3300042616 Bacteria 22918
61 Ga0415639_001826 3300038395 Bacteria 43745
62 Ga0415639_001914 3300038395 Bacteria 21167
63 Ga0415639_005306 3300038395 Bacteria 40315
64 Ga0415639_009295 3300038395 Bacteria 2204
65 Ga0415639_071627 3300038395 Bacteria 20757
66 Ga0466696_031977 3300042596 Bacteria 9061
67 Ga0123355_10124935 3300009826 Bacteria 3979
68 Ga0123356_10014968 3300010049 Unclassified 7442
69 Ga0123356_10172490 3300010049 Bacteria 2175
70 Ga0466704_433946 3300042643 Bacteria 3414
71 Ga0072941_1012607 3300005201 Bacteria 25516
72 Ga0466707_204796 3300042601 Bacteria 17774
73 Ga0466698_085302 3300042610 Bacteria 3094
74 Ga0466715_213381 3300042616 Bacteria 1445
75 Ga0415639_003747 3300038395 Bacteria 47783
76 Ga0123356_10006261 3300010049 Bacteria 12016
77 Ga0123356_10008835 3300010049 Bacteria 9978
78 Ga0466702_450343 3300042635 Bacteria 22416
79 AustNasuHG_c1000009 3300000089 Bacteria 54182
80 Ga0072941_1035979 3300005201 Unclassified 8452
81 Ga0466705_106827 3300042612 Bacteria 52611
82 Ga0466705_321332 3300042612 Bacteria 14109
83 Ga0562379_0335 3300056790 Bacteria 115222
84 Ga0466706_124855 3300042599 Bacteria 9609
85 Ga0466706_169045 3300042599 Unclassified 6781
86 Ga0466706_170418 3300042599 Unclassified 2346
87 Ga0466706_220349 3300042599 Bacteria 1432
88 Ga0466707_235204 3300042601 Unclassified 3758
89 Ga0466714_125379 3300042603 Bacteria 1554
90 Ga0466716_270313 3300042605 Bacteria 2401
91 Ga0466721_117367 3300042608 Bacteria 20226
92 Ga0466722_162527 3300042609 Bacteria 3956
93 Ga0466729_148217 3300042621 Bacteria 33223
94 Ga0160452_100096 3300012834 Bacteria 116013
95 Ga0160435_1003417 3300012857 Bacteria 3756
96 Ga0466696_089674 3300042596 Bacteria 1824
97 Ga0123356_10052108 3300010049 Bacteria 3806
98 Ga0123353_10078628 3300010167 Bacteria 5301
99 Ga0123353_10255801 3300010167 Unclassified 2709
100 Ga0466704_117584 3300042643 Bacteria 58461
101 Ga0466708_372274 3300042652 Unclassified 3456
102 Ga0072940_1126052 3300005200 Bacteria 6530
103 Ga0072941_1032947 3300005201 Bacteria 9641
104 Ga0072941_1128989 3300005201 Unclassified 7048
105 Ga0123357_10000023 3300009784 Bacteria 136176
106 Ga0466705_281070 3300042612 Bacteria 46866
107 Ga0466706_044311 3300042599 Bacteria 66484
108 Ga0466706_141960 3300042599 Bacteria 10037
109 Ga0466706_230473 3300042599 Bacteria 13380
110 Ga0466706_233582 3300042599 Bacteria 3497
111 Ga0466716_173266 3300042605 Bacteria 5773
112 Ga0466721_160537 3300042608 Bacteria 71411
113 Ga0466726_239004 3300042619 Bacteria 26340
114 Ga0160467_100807 3300012829 Bacteria 20999
115 Ga0160447_101633 3300012849 Unclassified 8544
116 Ga0160435_1004852 3300012857 Bacteria 3091
117 Ga0415639_054312 3300038395 Bacteria 19658
118 Ga0415639_115546 3300038395 Bacteria 1527
119 Ga0123356_10123030 3300010049 Bacteria 2527
120 Ga0123353_10000210 3300010167 Bacteria 74209
121 JGI24702J35022_10023777 3300002462 Bacteria 3312
122 Ga0466733_001402 3300042659 Bacteria 14257
123 Ga0466701_063665 3300042598 Bacteria 121183
124 Ga0466706_097354 3300042599 Unclassified 7404
125 Ga0466706_193086 3300042599 Unclassified 5485
126 Ga0466721_065983 3300042608 Bacteria 17419
127 Ga0160455_100014 3300012837 Bacteria 483318
128 Ga0466696_215093 3300042596 Bacteria 2662
129 Ga0123356_10281790 3300010049 Bacteria 1758
130 Ga0123353_10061601 3300010167 Bacteria 6017
131 Ga0123354_10003644 3300010882 Bacteria 21371
132 Ga0466703_044066 3300042636 Bacteria 1564
133 Ga0466704_064085 3300042643 Bacteria 388657
134 Ga0466704_164591 3300042643 Bacteria 88701
135 JGI24702J35022_10002466 3300002462 Bacteria 11291
136 Ga0072940_1074278 3300005200 Bacteria 2593
137 Ga0072940_1077712 3300005200 Bacteria 3134
138 Ga0072941_1009033 3300005201 Bacteria 8786
139 Ga0072941_1047732 3300005201 Bacteria 12684

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300010049 Ga0123356_10281790 Ga0123356_102817903 380
2 3300042599 Ga0466706_147182 Ga0466706_147182_3505_4716 393
3 3300042616 Ga0466715_213381 Ga0466715_213381_224_1426 400
4 3300042636 Ga0466703_286621 Ga0466703_286621_28960_30270 406
5 iso_pr_bacteria 2820288918 2820290468 408
6 3300042616 Ga0466715_054449 Ga0466715_054449_17584_18879 412
7 3300042599 Ga0466706_170418 Ga0466706_170418_777_2090 413
8 3300042599 Ga0466706_140640 Ga0466706_140640_13423_14739 414
9 3300042603 Ga0466714_125379 Ga0466714_125379_289_1536 415
10 3300042635 Ga0466702_378261 Ga0466702_378261_1156_2406 416
11 3300042635 Ga0466702_450343 Ga0466702_450343_3035_4285 416
12 3300042659 Ga0466733_187866 Ga0466733_187866_636_1886 416
13 3300038395 Ga0415639_071627 Ga0415639_071627_12929_14182 417
14 3300042635 Ga0466702_205562 Ga0466702_205562_157_1410 417
15 3300038395 Ga0415639_054312 Ga0415639_054312_11528_12784 418
16 3300012839 Ga0160472_106018 Ga0160472_1060182 421
17 3300012849 Ga0160447_101633 Ga0160447_1016337 421
18 3300042599 Ga0466706_124855 Ga0466706_124855_4744_6054 421
19 3300042599 Ga0466706_018452 Ga0466706_018452_34468_35892 422
20 3300042599 Ga0466706_097354 Ga0466706_097354_2083_3417 422
21 3300042643 Ga0466704_433946 Ga0466704_433946_1507_2814 422
22 3300042659 Ga0466733_001402 Ga0466733_001402_11131_12441 423
23 iso_pr_bacteria 2820727601 2820728083 424
24 3300038395 Ga0415639_115546 Ga0415639_115546_169_1446 425
25 3300042599 Ga0466706_012433 Ga0466706_012433_2994_4364 426
26 3300010167 Ga0123353_10070859 Ga0123353_100708592 427
27 3300038395 Ga0415639_003286 Ga0415639_003286_1574_2878 427
28 3300042599 Ga0466706_107608 Ga0466706_107608_1871_3184 427
29 3300042643 Ga0466704_064085 Ga0466704_064085_257930_259213 427
30 3300042596 Ga0466696_089674 Ga0466696_089674_145_1434 429
31 3300042599 Ga0466706_193086 Ga0466706_193086_2619_3908 429
32 3300042599 Ga0466706_233582 Ga0466706_233582_423_1712 429
33 3300010167 Ga0123353_10255801 Ga0123353_102558012 430
34 3300042659 Ga0466733_107473 Ga0466733_107473_1277_2569 430
35 3300042612 Ga0466705_281070 Ga0466705_281070_36103_37431 432
36 3300042599 Ga0466706_063946 Ga0466706_063946_7382_8683 433
37 3300042599 Ga0466706_122442 Ga0466706_122442_73301_74602 433
38 3300003973 Ga0063521_1000974 Ga0063521_10009744 434
39 3300005201 Ga0072941_1047732 Ga0072941_10477328 434
40 3300010049 Ga0123356_10014968 Ga0123356_100149683 434
41 3300038395 Ga0415639_001826 Ga0415639_001826_15084_16388 434
42 3300038395 Ga0415639_001914 Ga0415639_001914_6078_7382 434
43 3300038395 Ga0415639_003489 Ga0415639_003489_23048_24352 434
44 3300038395 Ga0415639_005306 Ga0415639_005306_33029_34333 434
45 3300038395 Ga0415639_010516 Ga0415639_010516_2268_3572 434
46 3300042603 Ga0466714_073203 Ga0466714_073203_2305_3609 434
47 3300042608 Ga0466721_065983 Ga0466721_065983_12242_13546 434
48 3300042608 Ga0466721_160537 Ga0466721_160537_25138_26442 434
49 3300042610 Ga0466698_085302 Ga0466698_085302_1492_2796 434
50 iso_pr_bacteria 2820398208 2820400232 434
51 iso_pr_bacteria 2820453354 2820453869 434
52 iso_pr_bacteria 2820463629 2820464016 434
53 3300000089 AustNasuHG_c1000009 AustNasuHG_100000943 435
54 3300002462 JGI24702J35022_10023777 JGI24702J35022_100237771 435
55 3300005200 Ga0072940_1126052 Ga0072940_11260527 435
56 3300005200 Ga0072940_1126053 Ga0072940_11260537 435
57 3300010049 Ga0123356_10006261 Ga0123356_100062612 435
58 3300010167 Ga0123353_10000210 Ga0123353_1000021025 435
59 3300010167 Ga0123353_10061601 Ga0123353_100616016 435
60 3300042596 Ga0466696_215093 Ga0466696_215093_190_1497 435
61 3300042599 Ga0466706_182332 Ga0466706_182332_16348_17655 435
62 3300042605 Ga0466716_173266 Ga0466716_173266_555_1862 435
63 3300042609 Ga0466722_162527 Ga0466722_162527_501_1808 435
64 3300042616 Ga0466715_366951 Ga0466715_366951_14079_15386 435
65 3300042618 Ga0466723_015357 Ga0466723_015357_2080_3387 435
66 3300042618 Ga0466723_043513 Ga0466723_043513_6401_7708 435
67 3300042618 Ga0466723_267344 Ga0466723_267344_3838_5145 435
68 iso_pr_bacteria 2820272499 2820273303 435
69 iso_pr_bacteria 2820294436 2820296332 435
70 iso_pr_bacteria 2820319488 2820320029 435
71 iso_pr_bacteria 2820483401 2820484741 435
72 3300010049 Ga0123356_10144531 Ga0123356_101445312 436
73 3300038395 Ga0415639_009295 Ga0415639_009295_23_1333 436
74 3300042596 Ga0466696_031977 Ga0466696_031977_4178_5488 436
75 3300042605 Ga0466716_123682 Ga0466716_123682_57324_58634 436
76 3300042606 Ga0466719_007898 Ga0466719_007898_1139_2449 436
77 3300042612 Ga0466705_106827 Ga0466705_106827_36149_37459 436
78 3300042616 Ga0466715_356515 Ga0466715_356515_5702_7012 436
79 3300042619 Ga0466726_239004 Ga0466726_239004_13968_15278 436
80 3300042620 Ga0466728_113606 Ga0466728_113606_208_1518 436
81 3300042636 Ga0466703_044066 Ga0466703_044066_153_1463 436
82 3300042643 Ga0466704_117584 Ga0466704_117584_30518_31828 436
83 3300042652 Ga0466708_372274 Ga0466708_372274_1624_2934 436
84 iso_pr_bacteria 2820244222 2820244431 436
85 iso_pr_bacteria 2820254385 2820254798 436
86 iso_pr_bacteria 2820255904 2820256044 436
87 iso_pr_bacteria 2820265624 2820265987 436
88 iso_pr_bacteria 2820280018 2820280871 436
89 iso_pr_bacteria 2820339298 2820339305 436
90 iso_pr_bacteria 2820570671 2820571339 436
91 3300010049 Ga0123356_10000021 Ga0123356_10000021147 437
92 3300010049 Ga0123356_10008835 Ga0123356_100088355 437
93 3300038395 Ga0415639_009362 Ga0415639_009362_5151_6464 437
94 3300042591 Ga0466692_091327 Ga0466692_091327_21834_23147 437
95 3300042612 Ga0466705_197160 Ga0466705_197160_1905_3218 437
96 iso_pr_bacteria 2820259584 2820259990 437
97 iso_pr_bacteria 2864816158 2864820067 437
98 3300002462 JGI24702J35022_10002466 JGI24702J35022_1000246611 438
99 3300005201 Ga0072941_1009033 Ga0072941_100903311 438
100 3300005201 Ga0072941_1012607 Ga0072941_101260718 438
101 3300005201 Ga0072941_1128989 Ga0072941_11289893 438
102 3300012857 Ga0160435_1003417 Ga0160435_10034174 438
103 3300038395 Ga0415639_111051 Ga0415639_111051_198_1514 438
104 3300042608 Ga0466721_117367 Ga0466721_117367_15915_17231 438
105 3300042608 Ga0466721_138292 Ga0466721_138292_290_1606 438
106 iso_pr_bacteria 2864801025 2864802809 438
107 iso_pr_bacteria 2864895409 2864896700 438
108 iso_pr_bacteria 8043041867 8043043091 438
109 iso_pr_bacteria 8073539042 8073539307 438
110 3300005201 Ga0072941_1032947 Ga0072941_10329473 439
111 3300005201 Ga0072941_1035979 Ga0072941_10359796 439
112 3300010167 Ga0123353_10078628 Ga0123353_100786285 439
113 3300042598 Ga0466701_063665 Ga0466701_063665_92371_93690 439
114 3300042616 Ga0466715_052477 Ga0466715_052477_4106_5425 439
115 iso_pr_bacteria 2551306396 2552923512 439
116 iso_pr_bacteria 2576861701 2579268511 439
117 iso_pr_bacteria 2820227065 2820227508 439
118 iso_pr_bacteria 2820238527 2820239425 439
119 iso_pr_bacteria 2983866074 2983868655 439
120 3300002462 JGI24702J35022_10003781 JGI24702J35022_100037814 440
121 3300005200 Ga0072940_1077712 Ga0072940_10777124 440
122 3300009826 Ga0123355_10124935 Ga0123355_101249353 440
123 3300012798 Ga0160454_100018 Ga0160454_100018226 440
124 3300042612 Ga0466705_321332 Ga0466705_321332_3221_4543 440
125 iso_pr_bacteria 2820347164 2820347731 440
126 3300010049 Ga0123356_10172490 Ga0123356_101724902 441
127 3300042599 Ga0466706_164052 Ga0466706_164052_70236_71561 441
128 3300042599 Ga0466706_202901 Ga0466706_202901_2630_3955 441
129 3300042599 Ga0466706_220349 Ga0466706_220349_10_1335 441
130 3300042599 Ga0466706_230473 Ga0466706_230473_5378_6703 441
131 3300042599 Ga0466706_231484 Ga0466706_231484_10_1335 441
132 iso_pr_bacteria 2524614537 2524833644 441
133 iso_pr_bacteria 2940380068 2940382508 441
134 iso_pr_bacteria 2940386776 2940389184 441
135 iso_pr_bacteria 2940393498 2940395900 441
136 iso_pr_bacteria 2940400224 2940402635 441
137 iso_pr_bacteria 2940406939 2940409163 441
138 3300012829 Ga0160467_100807 Ga0160467_10080719 442
139 3300012834 Ga0160452_100096 Ga0160452_10009610 442
140 3300012837 Ga0160455_100014 Ga0160455_1000142 442
141 3300042601 Ga0466707_204796 Ga0466707_204796_9243_10571 442
142 3300042603 Ga0466714_072370 Ga0466714_072370_7042_8370 442
143 iso_pr_bacteria 8078130113 8078135063 442
144 3300005200 Ga0072940_1074278 Ga0072940_10742782 443
145 3300042599 Ga0466706_089626 Ga0466706_089626_22066_23397 443
146 3300042599 Ga0466706_147628 Ga0466706_147628_1146_2477 443
147 3300042599 Ga0466706_235766 Ga0466706_235766_665_1996 443
148 3300042599 Ga0466706_289260 Ga0466706_289260_37_1368 443
149 3300042605 Ga0466716_270313 Ga0466716_270313_959_2290 443
150 iso_pr_bacteria 2820306284 2820309206 443
151 3300010049 Ga0123356_10052108 Ga0123356_100521082 444
152 3300010049 Ga0123356_10123030 Ga0123356_101230302 444
153 3300042599 Ga0466706_141960 Ga0466706_141960_4735_6069 444
154 3300042599 Ga0466706_158486 Ga0466706_158486_258_1592 444
155 3300042599 Ga0466706_165413 Ga0466706_165413_5682_7016 444
156 3300042599 Ga0466706_169045 Ga0466706_169045_178_1512 444
157 3300042599 Ga0466706_237730 Ga0466706_237730_10584_11918 444
158 3300042599 Ga0466706_044311 Ga0466706_044311_36299_37636 445
159 3300042599 Ga0466706_091489 Ga0466706_091489_43663_45000 445
160 3300042643 Ga0466704_164591 Ga0466704_164591_64047_65384 445
161 iso_pr_bacteria 2940221333 2940222290 445
162 iso_pr_bacteria 2940413413 2940415879 445
163 iso_pr_bacteria 2940419646 2940422435 445
164 iso_pr_bacteria 2940425923 2940428630 445
165 3300042592 Ga0466693_218860 Ga0466693_218860_118_1458 446
166 3300042599 Ga0466706_250289 Ga0466706_250289_2841_4400 446
167 3300002504 JGI24705J35276_12237689 JGI24705J35276_122376898 448
168 iso_pr_bacteria 2775507073 2777015827 450
169 iso_pr_bacteria 8018794549 8018794803 450
170 2225789004 2227513536 2228010236 451
171 3300042621 Ga0466729_148217 Ga0466729_148217_19742_21097 451
172 3300056790 Ga0562379_0335 Ga0562379_0335_25449_26804 451
173 3300056790 Ga0562379_0352 Ga0562379_0352_25178_26533 451
174 3300038395 Ga0415639_003747 Ga0415639_003747_10313_11671 452
175 3300012857 Ga0160435_1004852 Ga0160435_10048524 455
176 iso_pr_bacteria 2820056190 2820057866 459
177 iso_pr_bacteria 2820101058 2820102079 459
178 3300009784 Ga0123357_10000023 Ga0123357_10000023107 460
179 3300042609 Ga0466722_192099 Ga0466722_192099_53958_55343 461
180 iso_pr_bacteria 2820080004 2820080436 462
181 iso_pr_bacteria 2864937364 2864942997 462
182 iso_pr_bacteria 2873571580 2873573502 462
183 3300010882 Ga0123354_10003644 Ga0123354_1000364418 463
184 iso_pr_bacteria 2820155744 2820156300 464
185 3300042599 Ga0466706_077647 Ga0466706_077647_7723_9165 470
186 3300042601 Ga0466707_235204 Ga0466707_235204_197_1609 470
187 iso_pr_bacteria 2820387566 2820388818 490
188 3300002501 JGI24703J35330_11748815 JGI24703J35330_1174881532 491

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00006 ATP-synt_ab ATP synthase alpha/beta family, nucleotide-binding domain 144 353 0.99
PF18269 T3SS_ATPase_C T3SS EscN ATPase C-terminal domain 361 431 0.98
PF02874 ATP-synt_ab_N ATP synthase alpha/beta family, beta-barrel domain 23 87 0.93

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00006 GO:0005524 ATP binding MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.85 0.92 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.